1S9DE

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
192
Chain Sequence
KTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLNPGVFQSTDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-Ribosylation Factor 1
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 65
structure length 192
sequence length 193
ec nomenclature
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1s9dE01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1s9dE02
4C7PA 1R8QE 4A4PA 4JXHA 2R09A 3LTLA 1PBVA 4JMOA 1XSZA 3L8NA 1RE0B 4L5MA 3SWVA 1R8ME 1S9DE 1KU1A 4D7QA 4JWLA 1R8SE 4D7RA 4C0AA 4OIYA 4Z21A 1XT0B 2R0DA 4JMIA 1BC9A
chains in the Genus database with same CATH superfamily
4C7PA 1BO9A 1AVHA 1HVGA 1R8QE 2OY9A 4FHRB 4Q2SA 2IE6A 2HYUA 4JXHA 2ZOCA 2HYVA 1XSZA 3SWVA 1ANNA 3ANYA 4D7QA 1Q8DA 2ZHJA 4C0AA 1ALAA 2H0MA 2IE7A 2II2A 1YGMA 1XJLA 1N42A 2HSNA 1HAKA 1G5NA 3HJLA 3ABOA 4EVFA 1AEIA 1R4AE 1AIIA 1W7BA 1YJ0A 1BC0A 3TW5A 4L5MA 1A8AA 4JK1X 1N41A 1R8SE 1HVEA 4D7RA 4KN4X 2H0KA 1YCNA 4OIYA 1HM6A 4Z21A 1XT0B 4KMUX 1AOWA 1SAVA 4JMIA 3USYA 4FQ0C 1N00A 2H0LA 1UPTB 1DK5A 1M9IA 4A4PA 1AVRA 3ABSA 1LKVX 1N44A 2R09A 4EVHA 1PBVA 4JMOA 3L8NA 1YIIA 1R8ME 1S9DE 1W3WA 2K6XA 3AO0A 4JWLA 4X9PA 2ZHIA 4MDVA 4MDUA 1C1KA 2HYWA 2QEZA 2Q4CA 1BC1A 1MCXA 1HVDA 4HREA 2R0DA 1QC7A 1BCZA 2RANA 1ANXA 1W45A 3USWA 4KN7X 3LTLA 1BCWA 3ABRA 1RE0B 1I4AA 1A8BA 1KU1A 3ABQA 1BC3A 3AJCA 1AXNA 1HVFA 2IICA 1BCYA 2VXGA 3SOHB 3BRXA 1ANWA 2XO2A 1DM5A 1BC9A 1AVCA 2XO3A
chains in the Genus database with same CATH topology
4C7PA 1R8QE 2HSNA 4A4PA 4FHRB 3HJLA 1LKVX 3USWA 4KN7X 4JXHA 2R09A 3LTLA 1PBVA 4JMOA 1XSZA 3L8NA 3TW5A 1RE0B 4L5MA 3SWVA 4JK1X 1R8ME 1S9DE 1KU1A 4D7QA 2K6XA 4JWLA 3AJCA 1R8SE 1Q8DA 3SOHB 4D7RA 4KN4X 4C0AA 4OIYA 4Z21A 1XT0B 2R0DA 4KMUX 1QC7A 4JMIA 3USYA 1BC9A 4FQ0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7P A;  1R8Q E;  4A4P A;  4JXH A;  2R09 A;  3LTL A;  1PBV A;  4JMO A;  1XSZ A;  3L8N A;  1RE0 B;  4L5M A;  3SWV A;  1R8M E;  1S9D E;  1KU1 A;  4D7Q A;  4JWL A;  1R8S E;  4D7R A;  4C0A A;  4OIY A;  4Z21 A;  1XT0 B;  2R0D A;  4JMI A;  1BC9 A; 
#chains in the Genus database with same CATH topology
 4C7P A;  1BO9 A;  1AVH A;  1HVG A;  1R8Q E;  2OY9 A;  4FHR B;  4Q2S A;  2IE6 A;  2HYU A;  4JXH A;  2ZOC A;  2HYV A;  1XSZ A;  3SWV A;  1ANN A;  3ANY A;  4D7Q A;  1Q8D A;  2ZHJ A;  4C0A A;  1ALA A;  2H0M A;  2IE7 A;  2II2 A;  1YGM A;  1XJL A;  1N42 A;  2HSN A;  1HAK A;  1G5N A;  3HJL A;  3ABO A;  4EVF A;  1AEI A;  1R4A E;  1AII A;  1W7B A;  1YJ0 A;  1BC0 A;  3TW5 A;  4L5M A;  1A8A A;  4JK1 X;  1N41 A;  1R8S E;  1HVE A;  4D7R A;  4KN4 X;  2H0K A;  1YCN A;  4OIY A;  1HM6 A;  4Z21 A;  1XT0 B;  4KMU X;  1AOW A;  1SAV A;  4JMI A;  3USY A;  4FQ0 C;  1N00 A;  2H0L A;  1UPT B;  1DK5 A;  1M9I A;  4A4P A;  1AVR A;  3ABS A;  1LKV X;  1N44 A;  2R09 A;  4EVH A;  1PBV A;  4JMO A;  3L8N A;  1YII A;  1R8M E;  1S9D E;  1W3W A;  2K6X A;  3AO0 A;  4JWL A;  4X9P A;  2ZHI A;  4MDV A;  4MDU A;  1C1K A;  2HYW A;  2QEZ A;  2Q4C A;  1BC1 A;  1MCX A;  1HVD A;  4HRE A;  2R0D A;  1QC7 A;  1BCZ A;  2RAN A;  1ANX A;  1W45 A;  3USW A;  4KN7 X;  3LTL A;  1BCW A;  3ABR A;  1RE0 B;  1I4A A;  1A8B A;  1KU1 A;  3ABQ A;  1BC3 A;  3AJC A;  1AXN A;  1HVF A;  2IIC A;  1BCY A;  2VXG A;  3SOH B;  3BRX A;  1ANW A;  2XO2 A;  1DM5 A;  1BC9 A;  1AVC A;  2XO3 A; 
#chains in the Genus database with same CATH homology
 4C7P A;  1R8Q E;  2HSN A;  4A4P A;  4FHR B;  3HJL A;  1LKV X;  3USW A;  4KN7 X;  4JXH A;  2R09 A;  3LTL A;  1PBV A;  4JMO A;  1XSZ A;  3L8N A;  3TW5 A;  1RE0 B;  4L5M A;  3SWV A;  4JK1 X;  1R8M E;  1S9D E;  1KU1 A;  4D7Q A;  2K6X A;  4JWL A;  3AJC A;  1R8S E;  1Q8D A;  3SOH B;  4D7R A;  4KN4 X;  4C0A A;  4OIY A;  4Z21 A;  1XT0 B;  2R0D A;  4KMU X;  1QC7 A;  4JMI A;  3USY A;  1BC9 A;  4FQ0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...