4JXHA

Complexe of arno sec7 domain with the protein-protein interaction inhibitor n-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at ph 8.5
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
MSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-2
publication title Fragment-based identification of a locus in the Sec7 domain of Arno for the design of protein-protein interaction inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 71
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4jxhA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 4jxhA02
3SWVA 1R8ME 4C7PA 4C0AA 2R09A 4JMOA 1R8QE 4JMIA 4A4PA 4JXHA 4OIYA 1R8SE 3L8NA 4D7QA 4D7RA 1RE0B 1XSZA 4L5MA 3LTLA 4JWLA 2R0DA 1S9DE 1XT0B 1BC9A 1PBVA 1KU1A 4Z21A
chains in the Genus database with same CATH superfamily
1BCYA 2IE7A 1R8QE 4X9PA 1A8BA 1BCWA 3ABOA 1HVDA 2Q4CA 1UPTB 1AVCA 2RANA 1N42A 4D7QA 1BC3A 1RE0B 3HJLA 1A8AA 1M9IA 3ABQA 1XJLA 3LTLA 4EVFA 4KN4X 2QEZA 1YGMA 4JWLA 1DK5A 1QC7A 1W7BA 1S9DE 3ABSA 3BRXA 4Q2SA 1PBVA 4MDUA 4JMIA 1AOWA 2H0LA 1AVHA 3ANYA 4EVHA 1SAVA 1R8ME 4C7PA 1ALAA 4FHRB 2IICA 1I4AA 1HVFA 1LKVX 4JXHA 1BCZA 2ZHIA 3L8NA 1YJ0A 1XSZA 3AO0A 3USWA 1ANNA 1N41A 2XO2A 1HM6A 2HYVA 1R4AE 1ANWA 3USYA 1AIIA 3SWVA 4KN7X 4JMOA 1MCXA 2XO3A 3SOHB 1AVRA 2IE6A 1ANXA 4D7RA 2HSNA 2HYUA 4KMUX 1BO9A 1BC1A 2H0MA 1BC0A 1HVEA 1N00A 2ZOCA 4JK1X 1W3WA 2VXGA 2II2A 2R0DA 3AJCA 1W45A 2OY9A 1KU1A 4Z21A 2K6XA 3ABRA 4MDVA 2HYWA 4C0AA 2R09A 2ZHJA 1G5NA 1AXNA 2H0KA 1YIIA 4A4PA 4OIYA 1R8SE 1Q8DA 3TW5A 1AEIA 1DM5A 1HVGA 1C1KA 1YCNA 4HREA 4L5MA 4FQ0C 1N44A 1XT0B 1BC9A 1HAKA
chains in the Genus database with same CATH topology
3SWVA 1R8ME 4KN7X 4C7PA 4C0AA 2R09A 4FHRB 4JMOA 1R8QE 3SOHB 4JMIA 1LKVX 4A4PA 4JXHA 4OIYA 1R8SE 1Q8DA 3L8NA 4D7QA 2HSNA 4D7RA 3TW5A 1RE0B 3HJLA 1XSZA 4KMUX 3USWA 4L5MA 3LTLA 4FQ0C 4KN4X 4JK1X 4JWLA 2R0DA 1QC7A 3USYA 3AJCA 1S9DE 1XT0B 1BC9A 1PBVA 1KU1A 4Z21A 2K6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWV A;  1R8M E;  4C7P A;  4C0A A;  2R09 A;  4JMO A;  1R8Q E;  4JMI A;  4A4P A;  4JXH A;  4OIY A;  1R8S E;  3L8N A;  4D7Q A;  4D7R A;  1RE0 B;  1XSZ A;  4L5M A;  3LTL A;  4JWL A;  2R0D A;  1S9D E;  1XT0 B;  1BC9 A;  1PBV A;  1KU1 A;  4Z21 A; 
#chains in the Genus database with same CATH topology
 1BCY A;  2IE7 A;  1R8Q E;  4X9P A;  1A8B A;  1BCW A;  3ABO A;  1HVD A;  2Q4C A;  1UPT B;  1AVC A;  2RAN A;  1N42 A;  4D7Q A;  1BC3 A;  1RE0 B;  3HJL A;  1A8A A;  1M9I A;  3ABQ A;  1XJL A;  3LTL A;  4EVF A;  4KN4 X;  2QEZ A;  1YGM A;  4JWL A;  1DK5 A;  1QC7 A;  1W7B A;  1S9D E;  3ABS A;  3BRX A;  4Q2S A;  1PBV A;  4MDU A;  4JMI A;  1AOW A;  2H0L A;  1AVH A;  3ANY A;  4EVH A;  1SAV A;  1R8M E;  4C7P A;  1ALA A;  4FHR B;  2IIC A;  1I4A A;  1HVF A;  1LKV X;  4JXH A;  1BCZ A;  2ZHI A;  3L8N A;  1YJ0 A;  1XSZ A;  3AO0 A;  3USW A;  1ANN A;  1N41 A;  2XO2 A;  1HM6 A;  2HYV A;  1R4A E;  1ANW A;  3USY A;  1AII A;  3SWV A;  4KN7 X;  4JMO A;  1MCX A;  2XO3 A;  3SOH B;  1AVR A;  2IE6 A;  1ANX A;  4D7R A;  2HSN A;  2HYU A;  4KMU X;  1BO9 A;  1BC1 A;  2H0M A;  1BC0 A;  1HVE A;  1N00 A;  2ZOC A;  4JK1 X;  1W3W A;  2VXG A;  2II2 A;  2R0D A;  3AJC A;  1W45 A;  2OY9 A;  1KU1 A;  4Z21 A;  2K6X A;  3ABR A;  4MDV A;  2HYW A;  4C0A A;  2R09 A;  2ZHJ A;  1G5N A;  1AXN A;  2H0K A;  1YII A;  4A4P A;  4OIY A;  1R8S E;  1Q8D A;  3TW5 A;  1AEI A;  1DM5 A;  1HVG A;  1C1K A;  1YCN A;  4HRE A;  4L5M A;  4FQ0 C;  1N44 A;  1XT0 B;  1BC9 A;  1HAK A; 
#chains in the Genus database with same CATH homology
 3SWV A;  1R8M E;  4KN7 X;  4C7P A;  4C0A A;  2R09 A;  4FHR B;  4JMO A;  1R8Q E;  3SOH B;  4JMI A;  1LKV X;  4A4P A;  4JXH A;  4OIY A;  1R8S E;  1Q8D A;  3L8N A;  4D7Q A;  2HSN A;  4D7R A;  3TW5 A;  1RE0 B;  3HJL A;  1XSZ A;  4KMU X;  3USW A;  4L5M A;  3LTL A;  4FQ0 C;  4KN4 X;  4JK1 X;  4JWL A;  2R0D A;  1QC7 A;  3USY A;  3AJC A;  1S9D E;  1XT0 B;  1BC9 A;  1PBV A;  1KU1 A;  4Z21 A;  2K6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...