1R8SE

Arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
187
Chain Sequence
NRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGKAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 69
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1r8sE01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1r8sE02
4A4PA 1R8ME 1BC9A 1R8SE 1PBVA 4JMOA 4JWLA 2R09A 1XT0B 4JMIA 3L8NA 4Z21A 3SWVA 4D7QA 1R8QE 4C0AA 1XSZA 4C7PA 2R0DA 4JXHA 4L5MA 1KU1A 4D7RA 1S9DE 3LTLA 4OIYA 1RE0B
chains in the Genus database with same CATH superfamily
4EVHA 1R4AE 1R8ME 2HYUA 2R09A 4Q2SA 4JK1X 1AVRA 4HREA 3SWVA 2HYWA 2H0KA 2HYVA 1MCXA 1AVHA 1AVCA 4D7RA 4FHRB 2RANA 2ZOCA 1Q8DA 1AXNA 3LTLA 4OIYA 1BC0A 2II2A 1BC1A 1BC9A 1HVFA 1UPTB 1YIIA 1ANNA 1LKVX 1R8SE 1A8AA 1YJ0A 3ABQA 1YCNA 2IE7A 2IICA 1XT0B 4JMIA 4C0AA 3ANYA 1DM5A 4KN7X 4C7PA 3ABRA 1ALAA 2R0DA 1ANXA 1ANWA 1BCZA 4MDVA 2ZHJA 1QC7A 1BCYA 3USYA 1C1KA 1G5NA 1N00A 3HJLA 1AEIA 2HSNA 1XJLA 3AJCA 1PBVA 4JMOA 4EVFA 4FQ0C 1HAKA 2XO3A 2OY9A 1W45A 3L8NA 4Z21A 2H0MA 4X9PA 4D7QA 1BC3A 1W3WA 4JXHA 1HVGA 4L5MA 1SAVA 1N41A 3TW5A 3USWA 1RE0B 1HVEA 4A4PA 1I4AA 1AOWA 1YGMA 3SOHB 1DK5A 3AO0A 4JWLA 1BCWA 3ABSA 1HM6A 4MDUA 1A8BA 2QEZA 1N44A 2VXGA 4KMUX 1BO9A 2ZHIA 1R8QE 1HVDA 1XSZA 1W7BA 2H0LA 2XO2A 2IE6A 2Q4CA 1KU1A 3BRXA 1M9IA 4KN4X 1S9DE 2K6XA 3ABOA 1AIIA 1N42A
chains in the Genus database with same CATH topology
4A4PA 3AJCA 3SOHB 1R8ME 1BC9A 1LKVX 1R8SE 1PBVA 4JMOA 1RE0B 4JWLA 2R09A 4FQ0C 4JK1X 1XT0B 4JMIA 3L8NA 4Z21A 3SWVA 4KMUX 4D7QA 1R8QE 4C0AA 1XSZA 4KN7X 4C7PA 2R0DA 1QC7A 4JXHA 3USYA 4L5MA 1KU1A 4D7RA 4FHRB 1S9DE 4KN4X 2K6XA 3LTLA 1Q8DA 3TW5A 4OIYA 3USWA 3HJLA 2HSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4P A;  1R8M E;  1BC9 A;  1R8S E;  1PBV A;  4JMO A;  4JWL A;  2R09 A;  1XT0 B;  4JMI A;  3L8N A;  4Z21 A;  3SWV A;  4D7Q A;  1R8Q E;  4C0A A;  1XSZ A;  4C7P A;  2R0D A;  4JXH A;  4L5M A;  1KU1 A;  4D7R A;  1S9D E;  3LTL A;  4OIY A;  1RE0 B; 
#chains in the Genus database with same CATH topology
 4EVH A;  1R4A E;  1R8M E;  2HYU A;  2R09 A;  4Q2S A;  4JK1 X;  1AVR A;  4HRE A;  3SWV A;  2HYW A;  2H0K A;  2HYV A;  1MCX A;  1AVH A;  1AVC A;  4D7R A;  4FHR B;  2RAN A;  2ZOC A;  1Q8D A;  1AXN A;  3LTL A;  4OIY A;  1BC0 A;  2II2 A;  1BC1 A;  1BC9 A;  1HVF A;  1UPT B;  1YII A;  1ANN A;  1LKV X;  1R8S E;  1A8A A;  1YJ0 A;  3ABQ A;  1YCN A;  2IE7 A;  2IIC A;  1XT0 B;  4JMI A;  4C0A A;  3ANY A;  1DM5 A;  4KN7 X;  4C7P A;  3ABR A;  1ALA A;  2R0D A;  1ANX A;  1ANW A;  1BCZ A;  4MDV A;  2ZHJ A;  1QC7 A;  1BCY A;  3USY A;  1C1K A;  1G5N A;  1N00 A;  3HJL A;  1AEI A;  2HSN A;  1XJL A;  3AJC A;  1PBV A;  4JMO A;  4EVF A;  4FQ0 C;  1HAK A;  2XO3 A;  2OY9 A;  1W45 A;  3L8N A;  4Z21 A;  2H0M A;  4X9P A;  4D7Q A;  1BC3 A;  1W3W A;  4JXH A;  1HVG A;  4L5M A;  1SAV A;  1N41 A;  3TW5 A;  3USW A;  1RE0 B;  1HVE A;  4A4P A;  1I4A A;  1AOW A;  1YGM A;  3SOH B;  1DK5 A;  3AO0 A;  4JWL A;  1BCW A;  3ABS A;  1HM6 A;  4MDU A;  1A8B A;  2QEZ A;  1N44 A;  2VXG A;  4KMU X;  1BO9 A;  2ZHI A;  1R8Q E;  1HVD A;  1XSZ A;  1W7B A;  2H0L A;  2XO2 A;  2IE6 A;  2Q4C A;  1KU1 A;  3BRX A;  1M9I A;  4KN4 X;  1S9D E;  2K6X A;  3ABO A;  1AII A;  1N42 A; 
#chains in the Genus database with same CATH homology
 4A4P A;  3AJC A;  3SOH B;  1R8M E;  1BC9 A;  1LKV X;  1R8S E;  1PBV A;  4JMO A;  1RE0 B;  4JWL A;  2R09 A;  4FQ0 C;  4JK1 X;  1XT0 B;  4JMI A;  3L8N A;  4Z21 A;  3SWV A;  4KMU X;  4D7Q A;  1R8Q E;  4C0A A;  1XSZ A;  4KN7 X;  4C7P A;  2R0D A;  1QC7 A;  4JXH A;  3USY A;  4L5M A;  1KU1 A;  4D7R A;  4FHR B;  1S9D E;  4KN4 X;  2K6X A;  3LTL A;  1Q8D A;  3TW5 A;  4OIY A;  3USW A;  3HJL A;  2HSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...