4C7PA

Crystal structure of legionella pneumophila ralf f255k mutant
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
347
structure length
347
Chain Sequence
SHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFKTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RALF
publication title A Novel Membrane Sensor Controls the Localization and Arfgef Activity of Bacterial Ralf.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 119
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF18248 RalF_SCD RalF C-terminal Sec-7 capping domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4c7pA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 4c7pA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 4c7pA03
1R8SE 3LTLA 2R0DA 4OIYA 3L8NA 1R8ME 4JWLA 2R09A 4A4PA 4JXHA 3SWVA 4Z21A 1KU1A 1R8QE 1RE0B 4L5MA 1S9DE 4JMOA 1BC9A 1XT0B 4C7PA 4D7QA 1PBVA 1XSZA 4JMIA 4D7RA 4C0AA
chains in the Genus database with same CATH superfamily
2NLVA 2R0DA 3CW7A 2HYUA 3CWTA 2ZFDB 1TBAB 1Q9UA 2JHNA 2XHIA 3L8NA 1K2YX 1LWVA 2OOXA 1AIIA 2HYVA 1AXNA 1HVGA 1R4XA 5F9CA 1QC7A 5IYDP 4C0AA 4WXAA 3OGDA 1AVHA 3LTLA 1QNAA 1C4GA 1AEIA 4X9PA 2Y8LA 1R8ME 2IV9A 3ABQA 1QN7A 3OC3C 1N44A 2V92A 1QN5A 1KO9A 1LKVX 1NH2A 1YQRA 2NOEA 3TE5A 2YA3A 2NOFA 2V8QA 2MJ7A 2HSNA 4Q2SA 4JXHA 3N89A 4ROCB 4C7PA 3F0ZA 3VN5A 1EBMA 1HM6A 1VOKA 1KFIA 2F7LA 2IE6A 1KYFA 3ASMA 4DULA 4FHRB 1BC1A 1BCWA 1HU0A 1N00A 2NOHA 1C1KA 1P5DX 1BO9A 1MP9A 1A8AA 1FN7A 2V9JA 4CFFA 1TUOA 2HZSA 2OY9A 2NWVA 3ENOC 4PY5A 1BCYA 3I0XA 1G5NA 3ABSA 1B9KA 4BJUA 1UT7A 3CVTA 1ALAA 2IE7A 1VKLA 3ULXA 3OLPA 1M3HA 3D4VA 1HVDA 1WQAA 1YTBA 5IYBP 4EAKA 1MPGA 4EALA 1TGHA 2ZOCA 5AN4A 1YQKA 4EAGA 1BC0A 1KU1A 2QEZA 1NVPA 2Q4CA 4IL8A 4QG5A 5IYCP 4MDUA 3NA5A 2HYWA 5JN5A 1N39A 3HS8A 2R5XA 2FUVA 1DIZA 2HL8A 4KN7X 2VXGA 3HS9A 1XJLA 4I8OA 1QTSA 4TPSA 4FQ0C 1V5SA 2H0LA 3OSMA 2YH5A 2I5WA 4D7RA 3ANYA 1ANNA 2D0CA 1A8BA 3UW2A 3OCIA 1D3UA 3CWSA 4B0AA 1C9BB 1UL7A 1MCXA 1N3AA 2D0BA 4MDVA 1KYDA 1YQMA 1BC9A 1XT0B 2FKMX 2VJ0A 4WX8A 1PBVA 1N41A 1JFIC 4EVFA 1LWYA 4MRQA 1W3WA 1YCNA 3USWA 3DPTA 3PMGA 2K6XA 1N42A 2PWWA 2NOZA 3EAYA 2OOYA 1YIIA 2XO3A 2NOBA 1QTPA 2QLVA 1W80A 1TBPA 2DKCA 3CWUA 5BMPA 3DPUA 3OSTA 3BRXA 3EIKA 5BMNA 1VOLB 3I0WA 3H1ZA 3I3WA 1J3MA 4L5MA 4HJHA 1VTOA 2LAEA 1UT4A 1AISA 4JMIA 3CVSA 3USYA 2H0KA 2H4LX 3HJLA 2EHBD 4HREA 2Z0FA 1LWWA 4OIYA 4EVHA 1ANXA 4EAJA 3KRMA 1I4AA 1HAKA 2IV8A 1Q8DA 1PVSA 3CWAA 1QN8A 1BCZA 2HL9A 4KN4X 5JMVD 2D0AA 4EJYA 1CDWA 4KMUX 2JOIA 1KY7A 1PCZA 2R09A 2RANA 4A4PA 3SOHB 1QN6A 1PCMX 2ZHIA 1QN3A 3OSEA 2FGTA 3SNSA 1XSZA 1RM1A 1W45A 1M3QA 1YJ0A 1M9IA 2FKFA 1ANWA 1SAVA 1AOWA 2HZMA 1N3CA 2II2A 1NGMA 2QREA 2NOIA 3ABRA 4JMOA 1R4AE 2Y8QA 3D7QA 1W7BA 1LXTA 1M5Q1 4EJZA 1DK5A 1JDYA 3F10A 3KTUA 3AO0A 2XO2A 4Q11A 1E42A 2DKDA 1KY6A 1AVRA 3T4NA 2ZHJA 3TW5A 2QRDA 3OH9A 1YGMA 3SWVA 4Z21A 2MZ8A 2H5AX 1YQLA 1RE0B 1BC3A 4EAIA 4RODB 1K35A 1HVEA 1PCJX 2O3OA 1AVCA 2Z8UA 2NOLA 5HSHA 4WZSD 3AJCA 1T6AA 3OH6A 4JWLA 1QNEA 2HKPA 3ENCA 4ROEB 1S9DE 1KFQA 3RSMA 2QRCA 1C47A 2JPIA 1QN9A 4JK1X 2NVMA 1EUVA 1R8SE 3BKQX 2JHJA 3ABOA 2QR1A 3TDHA 1WJWA 1P5GX 1UPTB 1VTLE 1KYUA 1HVFA 3RPJA 5KL0A 1R8QE 2G30A 3PDKA 1PZDA 1QN4A 1DM5A 1QNCA 5EPCA 3IH7A 2IICA 4D7QA 2DKAA 1YTFA 3C04A 2H0MA 1QNBA
chains in the Genus database with same CATH topology
1R8SE 3LTLA 4KN4X 2R0DA 3HJLA 3USWA 4FHRB 2K6XA 4KMUX 4OIYA 2HSNA 3AJCA 4KN7X 3L8NA 3TW5A 1R8ME 4JWLA 2R09A 4A4PA 4JXHA 3SWVA 4Z21A 1KU1A 1R8QE 1RE0B 4L5MA 3SOHB 1Q8DA 1S9DE 4FQ0C 4JMOA 1BC9A 1XT0B 4C7PA 4D7QA 1PBVA 1QC7A 1XSZA 4JK1X 4JMIA 1LKVX 4D7RA 4C0AA 3USYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8S E;  3LTL A;  2R0D A;  4OIY A;  3L8N A;  1R8M E;  4JWL A;  2R09 A;  4A4P A;  4JXH A;  3SWV A;  4Z21 A;  1KU1 A;  1R8Q E;  1RE0 B;  4L5M A;  1S9D E;  4JMO A;  1BC9 A;  1XT0 B;  4C7P A;  4D7Q A;  1PBV A;  1XSZ A;  4JMI A;  4D7R A;  4C0A A; 
#chains in the Genus database with same CATH topology
 2NLV A;  2R0D A;  3CW7 A;  2HYU A;  3CWT A;  2ZFD B;  1TBA B;  1Q9U A;  2JHN A;  2XHI A;  3L8N A;  1K2Y X;  1LWV A;  2OOX A;  1AII A;  2HYV A;  1AXN A;  1HVG A;  1R4X A;  5F9C A;  1QC7 A;  5IYD P;  4C0A A;  4WXA A;  3OGD A;  1AVH A;  3LTL A;  1QNA A;  1C4G A;  1AEI A;  4X9P A;  2Y8L A;  1R8M E;  2IV9 A;  3ABQ A;  1QN7 A;  3OC3 C;  1N44 A;  2V92 A;  1QN5 A;  1KO9 A;  1LKV X;  1NH2 A;  1YQR A;  2NOE A;  3TE5 A;  2YA3 A;  2NOF A;  2V8Q A;  2MJ7 A;  2HSN A;  4Q2S A;  4JXH A;  3N89 A;  4ROC B;  4C7P A;  3F0Z A;  3VN5 A;  1EBM A;  1HM6 A;  1VOK A;  1KFI A;  2F7L A;  2IE6 A;  1KYF A;  3ASM A;  4DUL A;  4FHR B;  1BC1 A;  1BCW A;  1HU0 A;  1N00 A;  2NOH A;  1C1K A;  1P5D X;  1BO9 A;  1MP9 A;  1A8A A;  1FN7 A;  2V9J A;  4CFF A;  1TUO A;  2HZS A;  2OY9 A;  2NWV A;  3ENO C;  4PY5 A;  1BCY A;  3I0X A;  1G5N A;  3ABS A;  1B9K A;  4BJU A;  1UT7 A;  3CVT A;  1ALA A;  2IE7 A;  1VKL A;  3ULX A;  3OLP A;  1M3H A;  3D4V A;  1HVD A;  1WQA A;  1YTB A;  5IYB P;  4EAK A;  1MPG A;  4EAL A;  1TGH A;  2ZOC A;  5AN4 A;  1YQK A;  4EAG A;  1BC0 A;  1KU1 A;  2QEZ A;  1NVP A;  2Q4C A;  4IL8 A;  4QG5 A;  5IYC P;  4MDU A;  3NA5 A;  2HYW A;  5JN5 A;  1N39 A;  3HS8 A;  2R5X A;  2FUV A;  1DIZ A;  2HL8 A;  4KN7 X;  2VXG A;  3HS9 A;  1XJL A;  4I8O A;  1QTS A;  4TPS A;  4FQ0 C;  1V5S A;  2H0L A;  3OSM A;  2YH5 A;  2I5W A;  4D7R A;  3ANY A;  1ANN A;  2D0C A;  1A8B A;  3UW2 A;  3OCI A;  1D3U A;  3CWS A;  4B0A A;  1C9B B;  1UL7 A;  1MCX A;  1N3A A;  2D0B A;  4MDV A;  1KYD A;  1YQM A;  1BC9 A;  1XT0 B;  2FKM X;  2VJ0 A;  4WX8 A;  1PBV A;  1N41 A;  1JFI C;  4EVF A;  1LWY A;  4MRQ A;  1W3W A;  1YCN A;  3USW A;  3DPT A;  3PMG A;  2K6X A;  1N42 A;  2PWW A;  2NOZ A;  3EAY A;  2OOY A;  1YII A;  2XO3 A;  2NOB A;  1QTP A;  2QLV A;  1W80 A;  1TBP A;  2DKC A;  3CWU A;  5BMP A;  3DPU A;  3OST A;  3BRX A;  3EIK A;  5BMN A;  1VOL B;  3I0W A;  3H1Z A;  3I3W A;  1J3M A;  4L5M A;  4HJH A;  1VTO A;  2LAE A;  1UT4 A;  1AIS A;  4JMI A;  3CVS A;  3USY A;  2H0K A;  2H4L X;  3HJL A;  2EHB D;  4HRE A;  2Z0F A;  1LWW A;  4OIY A;  4EVH A;  1ANX A;  4EAJ A;  3KRM A;  1I4A A;  1HAK A;  2IV8 A;  1Q8D A;  1PVS A;  3CWA A;  1QN8 A;  1BCZ A;  2HL9 A;  4KN4 X;  5JMV D;  2D0A A;  4EJY A;  1CDW A;  4KMU X;  2JOI A;  1KY7 A;  1PCZ A;  2R09 A;  2RAN A;  4A4P A;  3SOH B;  1QN6 A;  1PCM X;  2ZHI A;  1QN3 A;  3OSE A;  2FGT A;  3SNS A;  1XSZ A;  1RM1 A;  1W45 A;  1M3Q A;  1YJ0 A;  1M9I A;  2FKF A;  1ANW A;  1SAV A;  1AOW A;  2HZM A;  1N3C A;  2II2 A;  1NGM A;  2QRE A;  2NOI A;  3ABR A;  4JMO A;  1R4A E;  2Y8Q A;  3D7Q A;  1W7B A;  1LXT A;  1M5Q 1;  4EJZ A;  1DK5 A;  1JDY A;  3F10 A;  3KTU A;  3AO0 A;  2XO2 A;  4Q11 A;  1E42 A;  2DKD A;  1KY6 A;  1AVR A;  3T4N A;  2ZHJ A;  3TW5 A;  2QRD A;  3OH9 A;  1YGM A;  3SWV A;  4Z21 A;  2MZ8 A;  2H5A X;  1YQL A;  1RE0 B;  1BC3 A;  4EAI A;  4ROD B;  1K35 A;  1HVE A;  1PCJ X;  2O3O A;  1AVC A;  2Z8U A;  2NOL A;  5HSH A;  4WZS D;  3AJC A;  1T6A A;  3OH6 A;  4JWL A;  1QNE A;  2HKP A;  3ENC A;  4ROE B;  1S9D E;  1KFQ A;  3RSM A;  2QRC A;  1C47 A;  2JPI A;  1QN9 A;  4JK1 X;  2NVM A;  1EUV A;  1R8S E;  3BKQ X;  2JHJ A;  3ABO A;  2QR1 A;  3TDH A;  1WJW A;  1P5G X;  1UPT B;  1VTL E;  1KYU A;  1HVF A;  3RPJ A;  5KL0 A;  1R8Q E;  2G30 A;  3PDK A;  1PZD A;  1QN4 A;  1DM5 A;  1QNC A;  5EPC A;  3IH7 A;  2IIC A;  4D7Q A;  2DKA A;  1YTF A;  3C04 A;  2H0M A;  1QNB A; 
#chains in the Genus database with same CATH homology
 1R8S E;  3LTL A;  4KN4 X;  2R0D A;  3HJL A;  3USW A;  4FHR B;  2K6X A;  4KMU X;  4OIY A;  2HSN A;  3AJC A;  4KN7 X;  3L8N A;  3TW5 A;  1R8M E;  4JWL A;  2R09 A;  4A4P A;  4JXH A;  3SWV A;  4Z21 A;  1KU1 A;  1R8Q E;  1RE0 B;  4L5M A;  3SOH B;  1Q8D A;  1S9D E;  4FQ0 C;  4JMO A;  1BC9 A;  1XT0 B;  4C7P A;  4D7Q A;  1PBV A;  1QC7 A;  1XSZ A;  4JK1 X;  4JMI A;  1LKV X;  4D7R A;  4C0A A;  3USY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...