4C7PA

Crystal structure of legionella pneumophila ralf f255k mutant
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
347
structure length
347
Chain Sequence
SHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFKTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALF
publication title A Novel Membrane Sensor Controls the Localization and Arfgef Activity of Bacterial Ralf.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Signaling protein
total genus 119
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF18248 RalF_SCD RalF C-terminal Sec-7 capping domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4c7pA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 4c7pA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 4c7pA03
1BC9A 4A4PA 4C7PA 1S9DE 1R8SE 1R8QE 1R8ME 4JMIA 2R09A 1KU1A 4JWLA 4OIYA 3LTLA 4L5MA 1XSZA 4JMOA 4C0AA 1XT0B 4JXHA 3SWVA 1RE0B 4D7RA 2R0DA 4D7QA 4Z21A 1PBVA 3L8NA
chains in the Genus database with same CATH superfamily
2HYVA 1R4AE 1R8QE 2G30A 2Z8UA 1R8ME 4JMIA 1G5NA 2NOFA 4X9PA 3ABOA 3EAYA 1LKVX 3I0WA 1UT4A 2JPIA 5HSHA 2NOBA 3VN5A 1HM6A 1MPGA 2FUVA 3ENOC 1HU0A 2HL8A 2XO3A 4FQ0C 3CWTA 2ZOCA 3ANYA 3F0ZA 3OH9A 1W45A 1ANNA 4L5MA 1I4AA 4JMOA 3ABSA 1QN3A 4EJYA 3SWVA 1RE0B 3H1ZA 2R0DA 1AVRA 1VTLE 3CVTA 2HSNA 2IE6A 2HZMA 3OLPA 5AN4A 3TW5A 1CDWA 5JMVD 2QEZA 2QR1A 3ENCA 1BC3A 1V5SA 5BMPA 3LTLA 4Q2SA 3TE5A 2H5AX 1UPTB 3UW2A 4CFFA 1VOLB 2K6XA 5JN5A 1HVEA 2II2A 1AXNA 3USYA 1K2YX 3PMGA 4RODB 1QC7A 3BKQX 1HVDA 1VTOA 1QN7A 1J3MA 1KYFA 2MZ8A 1WJWA 2HKPA 2DKDA 1LWVA 1ALAA 1RM1A 3N89A 1YTBA 1N41A 1AEIA 3BRXA 4D7QA 1QTSA 4Z21A 1QTPA 1M9IA 1AOWA 3OCIA 1BC0A 1LWYA 2R09A 3D4VA 1N39A 1C4GA 2F7LA 5BMNA 1DIZA 1TUOA 2HYUA 1QN8A 1C1KA 1PBVA 3T4NA 1M3HA 4WX8A 1AISA 2HL9A 2I5WA 4ROEB 4KMUX 1A8AA 1ANWA 1JDYA 3EIKA 1YQRA 4DULA 1LWWA 1ANXA 3CWAA 1BCWA 1YTFA 2NOLA 3CWUA 2H0KA 5IYBP 1NGMA 1P5DX 1KO9A 1HVGA 1WQAA 1PZDA 3RSMA 1M3QA 2QRDA 1DM5A 1HVFA 1E42A 4EAGA 1KYUA 1BCYA 2OOYA 4KN4X 4TPSA 3SOHB 1M5Q1 4C7PA 3RPJA 3DPTA 4MDVA 1N3AA 3CW7A 4JWLA 1HAKA 4I8OA 1XT0B 2R5XA 2QREA 1PVSA 1XJLA 4ROCB 2VJ0A 1R4XA 1QNAA 1T6AA 1NH2A 2QLVA 4EVFA 1MP9A 1N00A 1YIIA 3HJLA 4WXAA 1QN9A 2LAEA 2VXGA 1Q8DA 1VOKA 2OOXA 2MJ7A 2NLVA 3CVSA 2D0AA 4HJHA 2Z0FA 2OY9A 3AO0A 4QG5A 4JXHA 1JFIC 1TBAB 5EPCA 1BC1A 2D0BA 2DKCA 1AIIA 1BC9A 2EHBD 1YJ0A 3I3WA 4A4PA 1YQKA 1VKLA 4MRQA 2JHNA 1KFQA 1AVHA 1UT7A 1KU1A 3OC3C 3SNSA 4EAKA 1TGHA 2QRCA 3IH7A 1B9KA 2V8QA 2D0CA 4EAJA 3D7QA 1QNEA 5F9CA 1W80A 1EBMA 2FKFA 2FKMX 3DPUA 1S9DE 1KYDA 2NOEA 3C04A 4EVHA 4IL8A 4OIYA 1K35A 4EALA 1W7BA 1C9BB 1SAVA 1QN6A 1PCZA 2Y8LA 3OSMA 4JK1X 2ZFDB 1EUVA 3HS8A 2JOIA 3OSTA 3ABQA 3KRMA 2H4LX 4EJZA 1C47A 1YQMA 1BCZA 1UL7A 1QNCA 4WZSD 2NOIA 2NOZA 1QN5A 1P5GX 1LXTA 5IYCP 3OH6A 3HS9A 3ASMA 2HZSA 2H0LA 5IYDP 3AJCA 1AVCA 2FGTA 1KFIA 1N42A 3OGDA 1YCNA 2H0MA 2V9JA 4PY5A 1FN7A 2XHIA 2YH5A 2JHJA 1NVPA 3F10A 2ZHJA 4B0AA 1N44A 4KN7X 3TDHA 3PDKA 4D7RA 2Q4CA 1PCJX 1MCXA 1TBPA 5KL0A 1D3UA 2O3OA 1DK5A 1W3WA 3L8NA 1BO9A 1QN4A 1R8SE 2IV8A 3ABRA 2V92A 1YGMA 2RANA 2Y8QA 3ULXA 3NA5A 3I0XA 2HYWA 1XSZA 3USWA 4C0AA 1KY6A 1KY7A 2IE7A 1PCMX 1A8BA 3KTUA 2IV9A 2YA3A 1N3CA 2XO2A 2ZHIA 3OSEA 4HREA 4MDUA 1QNBA 3CWSA 4EAIA 2NWVA 2IICA 1YQLA 4FHRB 1Q9UA 2NVMA 4Q11A 2NOHA 2DKAA 2PWWA 4BJUA
chains in the Genus database with same CATH topology
1BC9A 4KMUX 4A4PA 4C7PA 3USYA 1S9DE 1R8SE 4FQ0C 1R8QE 1QC7A 1R8ME 4JMIA 2R09A 1KU1A 4JWLA 4OIYA 3LTLA 4L5MA 1XSZA 4FHRB 4JMOA 3USWA 4C0AA 1LKVX 3HJLA 4KN7X 1XT0B 4JXHA 3SWVA 1RE0B 4D7RA 2R0DA 4KN4X 1Q8DA 4JK1X 3AJCA 3SOHB 2K6XA 4D7QA 4Z21A 2HSNA 1PBVA 3TW5A 3L8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BC9 A;  4A4P A;  4C7P A;  1S9D E;  1R8S E;  1R8Q E;  1R8M E;  4JMI A;  2R09 A;  1KU1 A;  4JWL A;  4OIY A;  3LTL A;  4L5M A;  1XSZ A;  4JMO A;  4C0A A;  1XT0 B;  4JXH A;  3SWV A;  1RE0 B;  4D7R A;  2R0D A;  4D7Q A;  4Z21 A;  1PBV A;  3L8N A; 
#chains in the Genus database with same CATH topology
 2HYV A;  1R4A E;  1R8Q E;  2G30 A;  2Z8U A;  1R8M E;  4JMI A;  1G5N A;  2NOF A;  4X9P A;  3ABO A;  3EAY A;  1LKV X;  3I0W A;  1UT4 A;  2JPI A;  5HSH A;  2NOB A;  3VN5 A;  1HM6 A;  1MPG A;  2FUV A;  3ENO C;  1HU0 A;  2HL8 A;  2XO3 A;  4FQ0 C;  3CWT A;  2ZOC A;  3ANY A;  3F0Z A;  3OH9 A;  1W45 A;  1ANN A;  4L5M A;  1I4A A;  4JMO A;  3ABS A;  1QN3 A;  4EJY A;  3SWV A;  1RE0 B;  3H1Z A;  2R0D A;  1AVR A;  1VTL E;  3CVT A;  2HSN A;  2IE6 A;  2HZM A;  3OLP A;  5AN4 A;  3TW5 A;  1CDW A;  5JMV D;  2QEZ A;  2QR1 A;  3ENC A;  1BC3 A;  1V5S A;  5BMP A;  3LTL A;  4Q2S A;  3TE5 A;  2H5A X;  1UPT B;  3UW2 A;  4CFF A;  1VOL B;  2K6X A;  5JN5 A;  1HVE A;  2II2 A;  1AXN A;  3USY A;  1K2Y X;  3PMG A;  4ROD B;  1QC7 A;  3BKQ X;  1HVD A;  1VTO A;  1QN7 A;  1J3M A;  1KYF A;  2MZ8 A;  1WJW A;  2HKP A;  2DKD A;  1LWV A;  1ALA A;  1RM1 A;  3N89 A;  1YTB A;  1N41 A;  1AEI A;  3BRX A;  4D7Q A;  1QTS A;  4Z21 A;  1QTP A;  1M9I A;  1AOW A;  3OCI A;  1BC0 A;  1LWY A;  2R09 A;  3D4V A;  1N39 A;  1C4G A;  2F7L A;  5BMN A;  1DIZ A;  1TUO A;  2HYU A;  1QN8 A;  1C1K A;  1PBV A;  3T4N A;  1M3H A;  4WX8 A;  1AIS A;  2HL9 A;  2I5W A;  4ROE B;  4KMU X;  1A8A A;  1ANW A;  1JDY A;  3EIK A;  1YQR A;  4DUL A;  1LWW A;  1ANX A;  3CWA A;  1BCW A;  1YTF A;  2NOL A;  3CWU A;  2H0K A;  5IYB P;  1NGM A;  1P5D X;  1KO9 A;  1HVG A;  1WQA A;  1PZD A;  3RSM A;  1M3Q A;  2QRD A;  1DM5 A;  1HVF A;  1E42 A;  4EAG A;  1KYU A;  1BCY A;  2OOY A;  4KN4 X;  4TPS A;  3SOH B;  1M5Q 1;  4C7P A;  3RPJ A;  3DPT A;  4MDV A;  1N3A A;  3CW7 A;  4JWL A;  1HAK A;  4I8O A;  1XT0 B;  2R5X A;  2QRE A;  1PVS A;  1XJL A;  4ROC B;  2VJ0 A;  1R4X A;  1QNA A;  1T6A A;  1NH2 A;  2QLV A;  4EVF A;  1MP9 A;  1N00 A;  1YII A;  3HJL A;  4WXA A;  1QN9 A;  2LAE A;  2VXG A;  1Q8D A;  1VOK A;  2OOX A;  2MJ7 A;  2NLV A;  3CVS A;  2D0A A;  4HJH A;  2Z0F A;  2OY9 A;  3AO0 A;  4QG5 A;  4JXH A;  1JFI C;  1TBA B;  5EPC A;  1BC1 A;  2D0B A;  2DKC A;  1AII A;  1BC9 A;  2EHB D;  1YJ0 A;  3I3W A;  4A4P A;  1YQK A;  1VKL A;  4MRQ A;  2JHN A;  1KFQ A;  1AVH A;  1UT7 A;  1KU1 A;  3OC3 C;  3SNS A;  4EAK A;  1TGH A;  2QRC A;  3IH7 A;  1B9K A;  2V8Q A;  2D0C A;  4EAJ A;  3D7Q A;  1QNE A;  5F9C A;  1W80 A;  1EBM A;  2FKF A;  2FKM X;  3DPU A;  1S9D E;  1KYD A;  2NOE A;  3C04 A;  4EVH A;  4IL8 A;  4OIY A;  1K35 A;  4EAL A;  1W7B A;  1C9B B;  1SAV A;  1QN6 A;  1PCZ A;  2Y8L A;  3OSM A;  4JK1 X;  2ZFD B;  1EUV A;  3HS8 A;  2JOI A;  3OST A;  3ABQ A;  3KRM A;  2H4L X;  4EJZ A;  1C47 A;  1YQM A;  1BCZ A;  1UL7 A;  1QNC A;  4WZS D;  2NOI A;  2NOZ A;  1QN5 A;  1P5G X;  1LXT A;  5IYC P;  3OH6 A;  3HS9 A;  3ASM A;  2HZS A;  2H0L A;  5IYD P;  3AJC A;  1AVC A;  2FGT A;  1KFI A;  1N42 A;  3OGD A;  1YCN A;  2H0M A;  2V9J A;  4PY5 A;  1FN7 A;  2XHI A;  2YH5 A;  2JHJ A;  1NVP A;  3F10 A;  2ZHJ A;  4B0A A;  1N44 A;  4KN7 X;  3TDH A;  3PDK A;  4D7R A;  2Q4C A;  1PCJ X;  1MCX A;  1TBP A;  5KL0 A;  1D3U A;  2O3O A;  1DK5 A;  1W3W A;  3L8N A;  1BO9 A;  1QN4 A;  1R8S E;  2IV8 A;  3ABR A;  2V92 A;  1YGM A;  2RAN A;  2Y8Q A;  3ULX A;  3NA5 A;  3I0X A;  2HYW A;  1XSZ A;  3USW A;  4C0A A;  1KY6 A;  1KY7 A;  2IE7 A;  1PCM X;  1A8B A;  3KTU A;  2IV9 A;  2YA3 A;  1N3C A;  2XO2 A;  2ZHI A;  3OSE A;  4HRE A;  4MDU A;  1QNB A;  3CWS A;  4EAI A;  2NWV A;  2IIC A;  1YQL A;  4FHR B;  1Q9U A;  2NVM A;  4Q11 A;  2NOH A;  2DKA A;  2PWW A;  4BJU A; 
#chains in the Genus database with same CATH homology
 1BC9 A;  4KMU X;  4A4P A;  4C7P A;  3USY A;  1S9D E;  1R8S E;  4FQ0 C;  1R8Q E;  1QC7 A;  1R8M E;  4JMI A;  2R09 A;  1KU1 A;  4JWL A;  4OIY A;  3LTL A;  4L5M A;  1XSZ A;  4FHR B;  4JMO A;  3USW A;  4C0A A;  1LKV X;  3HJL A;  4KN7 X;  1XT0 B;  4JXH A;  3SWV A;  1RE0 B;  4D7R A;  2R0D A;  4KN4 X;  1Q8D A;  4JK1 X;  3AJC A;  3SOH B;  2K6X A;  4D7Q A;  4Z21 A;  2HSN A;  1PBV A;  3TW5 A;  3L8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...