3SWVA

Crystal structure of a domain of brefeldin a-inhibited guanine nucleotide-exchange protein 2 (brefeldin a-inhibited gep 2) from homo sapiens (human), northeast structural genomics consortium target id hr5562a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
188
Chain Sequence
FEVIKQQKEIIEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Brefeldin A-inhibited guanine nucleotide-exchange protein 2
publication title Crystal Structure of a domain of Brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BrefeldinA-inhibited GEP 2) from Homo sapiens (Human), Northeast Structural Genomics Consortium target id HR5562A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 188
sequence length 192
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3swvA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 3swvA02
1KU1A 4D7QA 3SWVA 1R8SE 4Z21A 4OIYA 4D7RA 1R8QE 4A4PA 2R0DA 4C7PA 2R09A 4JMIA 3L8NA 1XT0B 1S9DE 3LTLA 4C0AA 4JWLA 1BC9A 1R8ME 1PBVA 4JMOA 1RE0B 4JXHA 4L5MA 1XSZA
chains in the Genus database with same CATH superfamily
1R4AE 4OIYA 3USYA 1R8QE 1QC7A 4X9PA 1YCNA 1BCWA 1ANXA 2H0KA 2R0DA 2ZOCA 4EVHA 1BC1A 1W7BA 1A8BA 1XJLA 1S9DE 1ALAA 1BC3A 1BCYA 4FQ0C 4JWLA 1AVHA 2II2A 1YGMA 4KN7X 4JXHA 1C1KA 1YIIA 2VXGA 3ABOA 1YJ0A 2H0LA 4D7QA 3SWVA 3ANYA 4D7RA 1ANWA 3USWA 1AIIA 3ABSA 4C7PA 2ZHJA 1BO9A 1ANNA 3L8NA 1I4AA 2RANA 1XT0B 2IE6A 1Q8DA 2ZHIA 1DM5A 4Q2SA 4C0AA 1R8ME 1M9IA 4JMOA 1RE0B 3AO0A 1XSZA 2OY9A 2Q4CA 1A8AA 2IE7A 2XO3A 1AEIA 2HSNA 2IICA 4Z21A 1AXNA 4JK1X 4MDUA 1AOWA 3AJCA 1HVGA 2XO2A 4A4PA 2R09A 1MCXA 1HVFA 2H0MA 1N00A 2K6XA 1SAVA 1HVEA 1BC9A 1HM6A 1PBVA 2HYVA 4FHRB 1AVCA 4KMUX 4HREA 4MDVA 1N44A 4L5MA 1DK5A 1KU1A 1HAKA 2HYUA 1W45A 1R8SE 1W3WA 2QEZA 1UPTB 1AVRA 4JMIA 1BCZA 3HJLA 1LKVX 1N41A 3LTLA 1BC0A 1HVDA 1G5NA 3BRXA 4EVFA 3SOHB 2HYWA 1N42A 3ABRA 3ABQA 3TW5A 4KN4X
chains in the Genus database with same CATH topology
1KU1A 4D7QA 3SWVA 1R8SE 2HSNA 4Z21A 4OIYA 3USYA 4JK1X 4D7RA 1R8QE 1QC7A 3AJCA 4A4PA 2R0DA 3USWA 4C7PA 2R09A 4JMIA 3L8NA 1XT0B 2K6XA 1Q8DA 3HJLA 4KN4X 1LKVX 1S9DE 3LTLA 4C0AA 4FQ0C 4JWLA 1BC9A 1R8ME 1PBVA 4FHRB 1RE0B 4JMOA 4JXHA 4KMUX 4KN7X 3SOHB 3TW5A 4L5MA 1XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU1 A;  4D7Q A;  3SWV A;  1R8S E;  4Z21 A;  4OIY A;  4D7R A;  1R8Q E;  4A4P A;  2R0D A;  4C7P A;  2R09 A;  4JMI A;  3L8N A;  1XT0 B;  1S9D E;  3LTL A;  4C0A A;  4JWL A;  1BC9 A;  1R8M E;  1PBV A;  4JMO A;  1RE0 B;  4JXH A;  4L5M A;  1XSZ A; 
#chains in the Genus database with same CATH topology
 1R4A E;  4OIY A;  3USY A;  1R8Q E;  1QC7 A;  4X9P A;  1YCN A;  1BCW A;  1ANX A;  2H0K A;  2R0D A;  2ZOC A;  4EVH A;  1BC1 A;  1W7B A;  1A8B A;  1XJL A;  1S9D E;  1ALA A;  1BC3 A;  1BCY A;  4FQ0 C;  4JWL A;  1AVH A;  2II2 A;  1YGM A;  4KN7 X;  4JXH A;  1C1K A;  1YII A;  2VXG A;  3ABO A;  1YJ0 A;  2H0L A;  4D7Q A;  3SWV A;  3ANY A;  4D7R A;  1ANW A;  3USW A;  1AII A;  3ABS A;  4C7P A;  2ZHJ A;  1BO9 A;  1ANN A;  3L8N A;  1I4A A;  2RAN A;  1XT0 B;  2IE6 A;  1Q8D A;  2ZHI A;  1DM5 A;  4Q2S A;  4C0A A;  1R8M E;  1M9I A;  4JMO A;  1RE0 B;  3AO0 A;  1XSZ A;  2OY9 A;  2Q4C A;  1A8A A;  2IE7 A;  2XO3 A;  1AEI A;  2HSN A;  2IIC A;  4Z21 A;  1AXN A;  4JK1 X;  4MDU A;  1AOW A;  3AJC A;  1HVG A;  2XO2 A;  4A4P A;  2R09 A;  1MCX A;  1HVF A;  2H0M A;  1N00 A;  2K6X A;  1SAV A;  1HVE A;  1BC9 A;  1HM6 A;  1PBV A;  2HYV A;  4FHR B;  1AVC A;  4KMU X;  4HRE A;  4MDV A;  1N44 A;  4L5M A;  1DK5 A;  1KU1 A;  1HAK A;  2HYU A;  1W45 A;  1R8S E;  1W3W A;  2QEZ A;  1UPT B;  1AVR A;  4JMI A;  1BCZ A;  3HJL A;  1LKV X;  1N41 A;  3LTL A;  1BC0 A;  1HVD A;  1G5N A;  3BRX A;  4EVF A;  3SOH B;  2HYW A;  1N42 A;  3ABR A;  3ABQ A;  3TW5 A;  4KN4 X; 
#chains in the Genus database with same CATH homology
 1KU1 A;  4D7Q A;  3SWV A;  1R8S E;  2HSN A;  4Z21 A;  4OIY A;  3USY A;  4JK1 X;  4D7R A;  1R8Q E;  1QC7 A;  3AJC A;  4A4P A;  2R0D A;  3USW A;  4C7P A;  2R09 A;  4JMI A;  3L8N A;  1XT0 B;  2K6X A;  1Q8D A;  3HJL A;  4KN4 X;  1LKV X;  1S9D E;  3LTL A;  4C0A A;  4FQ0 C;  4JWL A;  1BC9 A;  1R8M E;  1PBV A;  4FHR B;  1RE0 B;  4JMO A;  4JXH A;  4KMU X;  4KN7 X;  3SOH B;  3TW5 A;  4L5M A;  1XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...