2R09A

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
total genus 101
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r09A01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r09A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r09A03
2Y8FA 3BINA 1V5MA 2DA0A 2J0KA 5J3QA 2RLOA 1MK9B 2XQNM 1X1GA 1TXDA 3KSYA 2VKIA 3AU4A 1PBVA 2AEHA 3PVUA 5JLJB 3P7ZA 2ELBA 1V5PA 2J0JA 2ROZB 2QKLA 1ZM0A 4KVGB 4D0NB 5HE1A 2N0YA 4GMVA 3ODOA 5KCVA 2RUKB 3UZTA 2H7DA 2LOZA 1EAZA 4L5MA 3M1IB 1LW3A 3HW2B 1ZC4B 4GMXB 1U5EA 4XWXA 2L2IA 4HAUB 3QIJA 1U2BA 2COFA 4IFSA 3TVVA 1X05A 2GCLA 3SV1A 1X86A 1X11A 3TO1A 2K2UA 1DROA 3TCAA 1FGYA 2D9ZA 2J0MA 1MK7B 1U5GA 4B6HA 3QBVB 3U8ZA 1QC6A 2OTXA 1J19A 4C7PA 2FJLA 1MAIA 4JWLA 4JXHA 1UNRA 1WG7A 5LONB 4HB3B 5C5BA 1QQGA 5FI0A 2ELAA 3O96A 1PLSA 1Y5OA 2K00A 2LULA 2YT0A 2YVCA 2W2WA 2DX5A 4HAWB 2CY5A 1UNQA 4F7GA 2DHKA 1P6SA 1SHCA 2UZSA 1PFJA 3WYFB 4KAXB 5JHGA 2IYBA 3MDBC 5C16A 2H7EA 5D3VA 1AWEA 1GG3A 3KRWA 3T06A 3DXEA 5C79A 2Y8GA 1DDMA 4ZRIA 5DHFB 2I1KA 2G35A 3OANA 1ISNA 4Y94A 3WA0A 3PVWA 1DDWA 2COAA 2DTCA 4HATB 3X23A 4A6FB 2M14A 1B55A 5DHAB 4D7RA 1DBHA 2Q13A 2I5FA 3A8QA 4EKUA 2ADZA 4K17A 2DN6A 1ZC3B 2ROVA 1UPRA 4DX90 2HE7A 3P6AA 2HTHB 2BCJA 2YSZA 1Q67A 4A4PA 3V5WA 4CHMA 1RJ2A 3F0WA 4WVFB 3NSUA 1H4RA 1ZSQA 2LYDA 2R09A 4HAYB 2KCJA 4F7UP 1WGUA 5D3XA 4A6HA 4GZUA 4K81A 1NI2A 1H10A 2CRFA 4PQ0A 3D8EA 3A98B 4HB4B 4EMOA 1FB8A 1FHOA 3TW1A 4YONA 1V89A 2DHIA 2L1CA 1M7RA 3A8PA 2N23A 1XCGA 1LB1A 1FHXA 2ZPYA 1K5GB 5D3YA 2P8VA 1IRSA 2I1JA 2Y7BA 1SGHA 5KQ4A 3LJUX 4GPTB 2P0FA 4IOYX 4HB0B 1U5FA 1R8ME 1I7AA 4WSFA 1U29A 1P3RA 3HQCA 2D11A 4EJNA 3U7DA 4HAVB 4MK0A 1RRPB 4DXAB 3ULCA 2CY4A 3F5RA 4JMIA 2MDXA 1WI1A 2I5CA 3BJIA 2DFKA 2PZ1A 1OY2A 4HHVA 3ULBA 5D27A 2YF0A 2EJ8A 5J3YA 2D2QA 1EGXA 4TYZA 2D9XA 4KHBB 2DX1A 1S9DE 3AJ4A 1BTKA 4CYEA 1OQNA 1P5TA 1NU2A 2Z0PA 4ZRKA 2EC1A 4HDQA 4JMOA 3SUZA 4A6KA 2YS5A 3PEGA 3SWVA 4GXBA 3ODXA 5CLLB 1BAKA 5DI9B 1K5DB 1KZGA 2GCJA 2DYNA 5CLQB 2E2XA 2DKQA 2NZ8B 2R0DA 4YL8A 1EF1A 2EMSA 4KHOA 2P0DA 5JHHA 1U5DA 2D9YA 2D10A 3FSSA 4OIYA 1MKEA 1DDVA 1W1HA 1UEFA 4K2OA 1W1GA 2W2XD 5J3TA 2NMBA 1V88A 4HAZB 3SNHA 1FOEA 2CODA 3DXCA 1E5WA 3D8DA 3CIKA 3PG7A 1R8QE 3SO6A 2YRYA 3KRXA 1WJ1A 1FHWA 4NY0A 2W2XC 2KUPA 1AQCA 3VIAA 4L6EA 4WJ7A 2LG1A 3PVLA 4MY6A 4NSWA 1FGZA 3GYPA 3KY9A 3D8FA 2EMTA 3SYXA 3RCPA 5L81A 4BBKA 5DIFB 1UPQA 1OMWA 4P7IA 4Z2MB 2YS1A 1GC6A 2DYQA 1DYNA 1N3HA 1KZ7A 2LKOA 3PP2A 3GYOA 1V5UA 1W1DA 4TKNA 1XKEA 1XR0B 1Y19B 2K2JA 3FEHA 1XD4A 3L8NA 4PNKA 4D7QA 3VOQA 5HE2A 3TFMA 4Z2NA 1TJ6A 1U27A 2OQBA 4A5KA 3LTLA 4HAXB 5KQ1A 4Z21A 1PMSA 1GC7A 3AU5A 1NTVA 4DX8A 4ZRJA 1J0WA 3FM8C 4K2PA 1ZVRA 4HB2B 1V61A 3CXBB 1KU1A 2D9VA 1MPHA 2P0HA 1WGQA 3ZDTA 1BTNA 1Z87A 3PZDA 2UZRA 2IFSA 3DXDA 4GN1A 2DKPA 5HE0A 2KGXB 1XT0B 5C5BB 2CAYA 1XX0A 5FI1A 2J59M 3PSCA 1RE0B 4A6FA 3HK0A 1WVHA 2COCA 5D3WA 2D4QA 5GOWB 2Z0QA 1NTYA 1KI1B 3ZVRA 2AL6A 5JP4A 4DBBA 2YT1A 2D9WA 3QWMA 3N7CA 2X18A 1TQZA 1X1FA 4KHAA 1XODA 2VSZA 1I2HA 2M38A 1M7EA 2DHJA 1XSZA 1WJMA 5DH9B 1MIZB 4CHJA 3ML4A 4HDOA 5C6RA 2RVBB 1UNPA 2YS3A 2UVMA 5EFXA 4C0AA 1R8SE 3G9WA 2GS0A 2JP2A 2GJYA 3ODWA 5HE3A 4F7HA 1BC9A 2MKRA 2MWNB 2QKMA 2VRWB 5LOPB 1FAOA 2DLWA 1EVHA 1BWNA 2Z0OA 3KZ1A 2LOXA 4IAPA 2MFQA 1MIXA 2RGNB 2V76A 2RNRB 4MT7A 3IVFA 4H8SA 2RSGA 3MPXA
chains in the Genus database with same CATH superfamily
1AXNA 2Y8FA 3BINA 1V5MA 2DA0A 2J0KA 5J3QA 2RLOA 1MK9B 2XQNM 1X1GA 3NW8A 1TXDA 4KMUX 3KSYA 2VKIA 3AU4A 1PBVA 2AEHA 3PVUA 5JLJB 3P7ZA 2ELBA 1V5PA 2J0JA 2K6XA 3ABSA 2ROZB 2QKLA 1ZM0A 4KVGB 4D0NB 5HE1A 1Q8DA 2N0YA 4GMVA 4FHRB 3ODOA 2HYWA 5KCVA 2RUKB 3UZTA 3SOHB 2H7DA 2RRFA 1BC0A 1EAZA 2LOZA 4L5MA 3M1IB 1LW3A 1C1KA 4KN4X 3HW2B 1ZC4B 1ZYIA 4GMXB 4GNKB 1G5NA 1U5EA 4XWXA 2L2IA 4HAUB 3QIJA 1U2BA 2COFA 4GOUA 4IFSA 3TVVA 1X05A 2GCLA 3ABOA 3SV1A 1X86A 1X11A 3TO1A 2K2UA 1DROA 3TCAA 2H0MA 1FGYA 2D9ZA 2J0MA 1MK7B 1U5GA 4B6HA 3QBVB 4CSQA 4JK1X 3U8ZA 1QC6A 2OTXA 1J19A 1MCXA 4C7PA 2FJLA 1MAIA 2IICA 4JWLA 4JXHA 1UNRA 1WG7A 2OY9A 5LONB 4HB3B 5C5BA 2RANA 1QQGA 5FI0A 2XO3A 1BC3A 2ELAA 3O96A 1PLSA 1Y5OA 2K00A 1AOWA 2QEZA 2LULA 2YT0A 2YVCA 2W2WA 2DX5A 4HAWB 2CY5A 1UNQA 4F7GA 2DHKA 1P6SA 1SHCA 2UZSA 1PFJA 3WYFB 3BRXA 1HVDA 4KAXB 5JHGA 2IYBA 3MDBC 5C16A 2H7EA 5D3VA 1AWEA 1GG3A 3KRWA 3T06A 3DXEA 4MDUA 5C79A 2Y8GA 1DDMA 4ZRIA 5DHFB 2I1KA 2G35A 3OANA 3AO0A 1ISNA 4Y94A 3WA0A 3PVWA 1W3WA 1DDWA 2COAA 2DTCA 1BCZA 4HATB 3X23A 3ABRA 1LKVX 2Z4DA 4A6FB 2M14A 3U12A 4OSNA 4QJ3B 1B55A 5DHAB 4D7RA 1MI1A 1DBHA 2Q13A 2Z13A 2I5FA 3A8QA 4EKUA 5IRSA 2ADZA 4K17A 2DN6A 4MDVA 2HYVA 3A58A 1ZC3B 2ROVA 1UPRA 4DX90 2HE7A 2ZOCA 3P6AA 2HTHB 1HM6A 2BCJA 2R2YA 2YSZA 1AVCA 4A4PA 1Q67A 1HAKA 3V5WA 1HVFA 4CHMA 1RJ2A 3F0WA 4WVFB 3NSUA 2IE6A 1H4RA 1ZSQA 4QXAB 2LYDA 2R09A 4HAYB 2KCJA 3HSAA 1WGUA 2GUMA 4F7UP 1N44A 5D3XA 4A6HA 4GZUA 4K81A 1N00A 1NI2A 1H10A 2XO2A 2CRFA 4PQ0A 3D8EA 3A98B 4HB4B 4EMOA 2YT2A 2Q4CA 1FB8A 1FHOA 3TW1A 4YONA 1V89A 2DHIA 2L1CA 2Z59A 1M7RA 3A8PA 1HVEA 2N23A 1XCGA 1LB1A 1W45A 1FHXA 2ZPYA 1K5GB 5D3YA 4D6WA 1AVHA 1ANWA 2P8VA 5LG4B 1IRSA 2I1JA 2Y7BA 1SGHA 5KQ4A 1ANXA 3LJUX 2P0FA 4GPTB 4IOYX 1ANNA 1U5FA 2KR0A 4HB0B 1R8ME 1I7AA 3NWFA 4WSFA 1U29A 4QJ4B 1P3RA 3HQCA 3NWDA 2D11A 4EJNA 3U7DA 4HAVB 4MK0A 1RRPB 3OHMB 4DXAB 3ULCA 2CY4A 3F5RA 4JMIA 2K8EA 2MDXA 1WI1A 2I5CA 3DCXA 1DK5A 3BJIA 2DFKA 2PZ1A 1OY2A 4HHVA 3ULBA 5D27A 2YF0A 1N41A 2EJ8A 1A8AA 5J3YA 4EVFA 2D2QA 1EGXA 4TYZA 2D9XA 4KN7X 4KHBB 2DX1A 1S9DE 4EVHA 3AJ4A 1W7BA 1BTKA 2ZHJA 4CYEA 1OQNA 1BC1A 1NU2A 1P5TA 2Z0PA 4ZRKA 2EC1A 4HDQA 2KIGA 4JMOA 3SUZA 4A6KA 4Q2SA 2YS5A 2H0LA 3PEGA 3SWVA 4GXBA 3HIEA 3ODXA 5CLLB 1BAKA 3USYA 3TW5A 5DI9B 1K5DB 1KZGA 2GCJA 2DYNA 5CLQB 1UPTB 4OT1A 2E2XA 2DKQA 2NZ8B 5M4YB 2R0DA 3FVCA 2ZHIA 4YL8A 1EF1A 2EMSA 1M9IA 4KHOA 2P0DA 5JHHA 1BCYA 1U5DA 2D9YA 2D10A 3FSSA 4DIXA 4OIYA 1MKEA 1DDVA 1W1HA 1UEFA 4HSIA 4K2OA 1W1GA 3HJLA 2W2XD 2KIEA 5J3TA 2NMBA 1V88A 4HAZB 3SNHA 1FOEA 2CODA 3DXCA 1E5WA 3D8DA 3CIKA 3PG7A 1R8QE 3SO6A 4FQ0C 2YRYA 3KRXA 1WJ1A 1FHWA 4NY0A 2W2XC 4QJ5B 1DM5A 2KUPA 5I2MA 1AQCA 3VIAA 4L6EA 4WJ7A 2LG1A 3PVLA 4MY6A 4NSWA 1FGZA 3GYPA 3KY9A 2FJUB 3D8FA 3USWA 2EMTA 1XJLA 3SYXA 1R4AE 3RCPA 5L81A 4BBKA 5DIFB 1YGMA 1UPQA 1OMWA 4P7IA 2Z14A 2YS1A 4Z2MB 1GC6A 2DYQA 1AEIA 1DYNA 1N3HA 1KZ7A 2II2A 2LKOA 3PP2A 3GYOA 1V5UA 1W1DA 4TKNA 1XKEA 2KUQA 1XR0B 1Y19B 1XD4A 2K2JA 3FEHA 3L8NA 4PNKA 4D7QA 3VOQA 5HE2A 3TFMA 4Z2NA 1TJ6A 1U27A 3AJCA 2OQBA 4A5KA 3LTLA 4HAXB 5KQ1A 4Z21A 1N42A 1PMSA 1GC7A 3AU5A 2VXGA 1QC7A 1NTVA 3B77A 4DX8A 2ZKMX 4KHBA 1BCWA 4ZRJA 1J0WA 3ABQA 3FM8C 3ANYA 4K2PA 1ZVRA 4HB2B 1V61A 3CXBB 1KU1A 1YCNA 2D9VA 1MPHA 2P0HA 1WGQA 3ZDTA 1BTNA 1Z87A 3PZDA 1I4AA 2HYUA 2UZRA 2IFSA 2IE7A 1BO9A 3DXDA 4GN1A 2DKPA 5HE0A 2KGXB 1XT0B 5C5BB 4L1RA 2CAYA 1XX0A 4HREA 5FI1A 2J59M 3PSCA 1RE0B 4A6FA 3HK0A 1WVHA 2COCA 5D3WA 2D4QA 5GOWB 2Z0QA 1SAVA 1NTYA 3NWAA 1KI1B 3ZVRA 2AL6A 1A8BA 2K49A 5JP4A 4DBBA 2YT1A 2D9WA 2NBVA 3QWMA 3N7CA 2X18A 1TQZA 1X1FA 1ALAA 4KHAA 1XODA 2VSZA 1I2HA 2M38A 1M7EA 2DHJA 1XSZA 1WJMA 5DH9B 1MIZB 4CHJA 3ML4A 1AVRA 4HDOA 5C6RA 2RVBB 1UNPA 2YS3A 2UVMA 5EFXA 4C0AA 1R8SE 3G9WA 2GS0A 2JP2A 2GJYA 3ODWA 5HE3A 4F7HA 1BC9A 2MKRA 2MWNB 1YJ0A 1AIIA 2QKMA 1YIIA 2VRWB 2HSNA 5LOPB 1FAOA 2DLWA 1EVHA 1BWNA 1T77A 2Z0OA 3KZ1A 2LOXA 1HVGA 4IAPA 2H0KA 2MFQA 1MIXA 2RGNB 4X9PA 2V76A 2RNRB 4MT7A 5I2SA 3IVFA 4H8SA 2RSGA 3MPXA
chains in the Genus database with same CATH topology
2Y8FA 3BINA 1V5MA 2DA0A 2J0KA 5J3QA 2RLOA 1MK9B 2XQNM 1X1GA 1TXDA 4KMUX 3KSYA 2VKIA 3AU4A 1PBVA 2AEHA 3PVUA 5JLJB 3P7ZA 2ELBA 1V5PA 2J0JA 2K6XA 2ROZB 2QKLA 1ZM0A 4KVGB 4D0NB 5HE1A 1Q8DA 2N0YA 4GMVA 4FHRB 3ODOA 5KCVA 2RUKB 3UZTA 3SOHB 2H7DA 2LOZA 1EAZA 4L5MA 3M1IB 1LW3A 4KN4X 3HW2B 1ZC4B 4GMXB 1U5EA 4XWXA 2L2IA 4HAUB 3QIJA 1U2BA 2COFA 4IFSA 3TVVA 1X05A 2GCLA 3SV1A 1X86A 1X11A 3TO1A 2K2UA 1DROA 3TCAA 1FGYA 2D9ZA 2J0MA 1MK7B 1U5GA 4B6HA 3QBVB 4JK1X 3U8ZA 1QC6A 2OTXA 1J19A 4C7PA 2FJLA 1MAIA 4JWLA 4JXHA 1UNRA 1WG7A 5LONB 4HB3B 5C5BA 1QQGA 5FI0A 2ELAA 3O96A 1PLSA 1Y5OA 2K00A 2LULA 2YT0A 2YVCA 2W2WA 2DX5A 4HAWB 2CY5A 1UNQA 4F7GA 2DHKA 1P6SA 1SHCA 2UZSA 1PFJA 3WYFB 4KAXB 5JHGA 2IYBA 3MDBC 5C16A 2H7EA 5D3VA 1AWEA 1GG3A 3KRWA 3T06A 3DXEA 5C79A 2Y8GA 1DDMA 4ZRIA 5DHFB 2I1KA 2G35A 3OANA 1ISNA 4Y94A 3WA0A 3PVWA 1DDWA 2COAA 2DTCA 4HATB 3X23A 1LKVX 4A6FB 2M14A 1B55A 5DHAB 4D7RA 1DBHA 2Q13A 2I5FA 3A8QA 4EKUA 2ADZA 4K17A 2DN6A 1ZC3B 2ROVA 1UPRA 4DX90 2HE7A 3P6AA 2HTHB 2BCJA 2YSZA 1Q67A 4A4PA 3V5WA 4CHMA 1RJ2A 3F0WA 4WVFB 3NSUA 1H4RA 1ZSQA 2LYDA 2R09A 4HAYB 2KCJA 4F7UP 1WGUA 5D3XA 4A6HA 4GZUA 4K81A 1NI2A 1H10A 2CRFA 4PQ0A 3D8EA 3A98B 4HB4B 4EMOA 1FB8A 1FHOA 3TW1A 4YONA 1V89A 2DHIA 2L1CA 1M7RA 3A8PA 2N23A 1XCGA 1LB1A 1FHXA 2ZPYA 1K5GB 5D3YA 2P8VA 1IRSA 2I1JA 2Y7BA 1SGHA 5KQ4A 3LJUX 4GPTB 2P0FA 4IOYX 4HB0B 1U5FA 1R8ME 1I7AA 4WSFA 1U29A 1P3RA 3HQCA 2D11A 4EJNA 3U7DA 4HAVB 4MK0A 1RRPB 4DXAB 3ULCA 2CY4A 3F5RA 4JMIA 2MDXA 1WI1A 2I5CA 3BJIA 2DFKA 2PZ1A 1OY2A 4HHVA 3ULBA 5D27A 2YF0A 2EJ8A 5J3YA 2D2QA 1EGXA 4TYZA 2D9XA 4KN7X 4KHBB 2DX1A 1S9DE 3AJ4A 1BTKA 4CYEA 1OQNA 1P5TA 1NU2A 2Z0PA 4ZRKA 2EC1A 4HDQA 4JMOA 3SUZA 4A6KA 2YS5A 3PEGA 3SWVA 4GXBA 3ODXA 5CLLB 1BAKA 3USYA 3TW5A 5DI9B 1K5DB 1KZGA 2GCJA 2DYNA 5CLQB 2E2XA 2DKQA 2NZ8B 2R0DA 4YL8A 1EF1A 2EMSA 4KHOA 2P0DA 5JHHA 1U5DA 2D9YA 2D10A 3FSSA 4OIYA 1MKEA 1DDVA 1W1HA 1UEFA 4K2OA 1W1GA 3HJLA 2W2XD 5J3TA 2NMBA 1V88A 4HAZB 3SNHA 1FOEA 2CODA 3DXCA 1E5WA 3D8DA 3CIKA 3PG7A 1R8QE 3SO6A 4FQ0C 2YRYA 3KRXA 1WJ1A 1FHWA 4NY0A 2W2XC 2KUPA 1AQCA 3VIAA 4L6EA 4WJ7A 2LG1A 3PVLA 4MY6A 4NSWA 1FGZA 3GYPA 3KY9A 3D8FA 3USWA 2EMTA 3SYXA 3RCPA 5L81A 4BBKA 5DIFB 1UPQA 1OMWA 4P7IA 4Z2MB 2YS1A 1GC6A 2DYQA 1DYNA 1N3HA 1KZ7A 2LKOA 3PP2A 3GYOA 1V5UA 1W1DA 4TKNA 1XKEA 1XR0B 1Y19B 2K2JA 1XD4A 3FEHA 3L8NA 4PNKA 4D7QA 3VOQA 5HE2A 3TFMA 4Z2NA 1TJ6A 1U27A 3AJCA 2OQBA 4A5KA 3LTLA 4HAXB 5KQ1A 4Z21A 1PMSA 1GC7A 3AU5A 1QC7A 1NTVA 4DX8A 4ZRJA 1J0WA 3FM8C 4K2PA 1ZVRA 4HB2B 1V61A 3CXBB 1KU1A 2D9VA 1MPHA 2P0HA 1WGQA 3ZDTA 1BTNA 1Z87A 3PZDA 2UZRA 2IFSA 3DXDA 4GN1A 2DKPA 5HE0A 2KGXB 1XT0B 5C5BB 2CAYA 1XX0A 5FI1A 2J59M 3PSCA 1RE0B 4A6FA 3HK0A 1WVHA 2COCA 5D3WA 2D4QA 5GOWB 2Z0QA 1NTYA 1KI1B 3ZVRA 2AL6A 5JP4A 4DBBA 2YT1A 2D9WA 3QWMA 3N7CA 2X18A 1TQZA 1X1FA 4KHAA 1XODA 2VSZA 1I2HA 2M38A 1M7EA 2DHJA 1XSZA 1WJMA 5DH9B 1MIZB 4CHJA 3ML4A 4HDOA 5C6RA 2RVBB 1UNPA 2YS3A 2UVMA 5EFXA 4C0AA 1R8SE 3G9WA 2GS0A 2JP2A 2GJYA 3ODWA 5HE3A 4F7HA 1BC9A 2MKRA 2MWNB 2QKMA 2VRWB 2HSNA 5LOPB 1FAOA 2DLWA 1EVHA 1BWNA 2Z0OA 3KZ1A 2LOXA 4IAPA 2MFQA 1MIXA 2RGNB 2V76A 2RNRB 4MT7A 3IVFA 4H8SA 2RSGA 3MPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8F A;  3BIN A;  1V5M A;  2DA0 A;  2J0K A;  5J3Q A;  2RLO A;  1MK9 B;  2XQN M;  1X1G A;  1TXD A;  3KSY A;  2VKI A;  3AU4 A;  1PBV A;  2AEH A;  3PVU A;  5JLJ B;  3P7Z A;  2ELB A;  1V5P A;  2J0J A;  2ROZ B;  2QKL A;  1ZM0 A;  4KVG B;  4D0N B;  5HE1 A;  2N0Y A;  4GMV A;  3ODO A;  5KCV A;  2RUK B;  3UZT A;  2H7D A;  2LOZ A;  1EAZ A;  4L5M A;  3M1I B;  1LW3 A;  3HW2 B;  1ZC4 B;  4GMX B;  1U5E A;  4XWX A;  2L2I A;  4HAU B;  3QIJ A;  1U2B A;  2COF A;  4IFS A;  3TVV A;  1X05 A;  2GCL A;  3SV1 A;  1X86 A;  1X11 A;  3TO1 A;  2K2U A;  1DRO A;  3TCA A;  1FGY A;  2D9Z A;  2J0M A;  1MK7 B;  1U5G A;  4B6H A;  3QBV B;  3U8Z A;  1QC6 A;  2OTX A;  1J19 A;  4C7P A;  2FJL A;  1MAI A;  4JWL A;  4JXH A;  1UNR A;  1WG7 A;  5LON B;  4HB3 B;  5C5B A;  1QQG A;  5FI0 A;  2ELA A;  3O96 A;  1PLS A;  1Y5O A;  2K00 A;  2LUL A;  2YT0 A;  2YVC A;  2W2W A;  2DX5 A;  4HAW B;  2CY5 A;  1UNQ A;  4F7G A;  2DHK A;  1P6S A;  1SHC A;  2UZS A;  1PFJ A;  3WYF B;  4KAX B;  5JHG A;  2IYB A;  3MDB C;  5C16 A;  2H7E A;  5D3V A;  1AWE A;  1GG3 A;  3KRW A;  3T06 A;  3DXE A;  5C79 A;  2Y8G A;  1DDM A;  4ZRI A;  5DHF B;  2I1K A;  2G35 A;  3OAN A;  1ISN A;  4Y94 A;  3WA0 A;  3PVW A;  1DDW A;  2COA A;  2DTC A;  4HAT B;  3X23 A;  4A6F B;  2M14 A;  1B55 A;  5DHA B;  4D7R A;  1DBH A;  2Q13 A;  2I5F A;  3A8Q A;  4EKU A;  2ADZ A;  4K17 A;  2DN6 A;  1ZC3 B;  2ROV A;  1UPR A;  4DX9 0;  2HE7 A;  3P6A A;  2HTH B;  2BCJ A;  2YSZ A;  1Q67 A;  4A4P A;  3V5W A;  4CHM A;  1RJ2 A;  3F0W A;  4WVF B;  3NSU A;  1H4R A;  1ZSQ A;  2LYD A;  2R09 A;  4HAY B;  2KCJ A;  4F7U P;  1WGU A;  5D3X A;  4A6H A;  4GZU A;  4K81 A;  1NI2 A;  1H10 A;  2CRF A;  4PQ0 A;  3D8E A;  3A98 B;  4HB4 B;  4EMO A;  1FB8 A;  1FHO A;  3TW1 A;  4YON A;  1V89 A;  2DHI A;  2L1C A;  1M7R A;  3A8P A;  2N23 A;  1XCG A;  1LB1 A;  1FHX A;  2ZPY A;  1K5G B;  5D3Y A;  2P8V A;  1IRS A;  2I1J A;  2Y7B A;  1SGH A;  5KQ4 A;  3LJU X;  4GPT B;  2P0F A;  4IOY X;  4HB0 B;  1U5F A;  1R8M E;  1I7A A;  4WSF A;  1U29 A;  1P3R A;  3HQC A;  2D11 A;  4EJN A;  3U7D A;  4HAV B;  4MK0 A;  1RRP B;  4DXA B;  3ULC A;  2CY4 A;  3F5R A;  4JMI A;  2MDX A;  1WI1 A;  2I5C A;  3BJI A;  2DFK A;  2PZ1 A;  1OY2 A;  4HHV A;  3ULB A;  5D27 A;  2YF0 A;  2EJ8 A;  5J3Y A;  2D2Q A;  1EGX A;  4TYZ A;  2D9X A;  4KHB B;  2DX1 A;  1S9D E;  3AJ4 A;  1BTK A;  4CYE A;  1OQN A;  1P5T A;  1NU2 A;  2Z0P A;  4ZRK A;  2EC1 A;  4HDQ A;  4JMO A;  3SUZ A;  4A6K A;  2YS5 A;  3PEG A;  3SWV A;  4GXB A;  3ODX A;  5CLL B;  1BAK A;  5DI9 B;  1K5D B;  1KZG A;  2GCJ A;  2DYN A;  5CLQ B;  2E2X A;  2DKQ A;  2NZ8 B;  2R0D A;  4YL8 A;  1EF1 A;  2EMS A;  4KHO A;  2P0D A;  5JHH A;  1U5D A;  2D9Y A;  2D10 A;  3FSS A;  4OIY A;  1MKE A;  1DDV A;  1W1H A;  1UEF A;  4K2O A;  1W1G A;  2W2X D;  5J3T A;  2NMB A;  1V88 A;  4HAZ B;  3SNH A;  1FOE A;  2COD A;  3DXC A;  1E5W A;  3D8D A;  3CIK A;  3PG7 A;  1R8Q E;  3SO6 A;  2YRY A;  3KRX A;  1WJ1 A;  1FHW A;  4NY0 A;  2W2X C;  2KUP A;  1AQC A;  3VIA A;  4L6E A;  4WJ7 A;  2LG1 A;  3PVL A;  4MY6 A;  4NSW A;  1FGZ A;  3GYP A;  3KY9 A;  3D8F A;  2EMT A;  3SYX A;  3RCP A;  5L81 A;  4BBK A;  5DIF B;  1UPQ A;  1OMW A;  4P7I A;  4Z2M B;  2YS1 A;  1GC6 A;  2DYQ A;  1DYN A;  1N3H A;  1KZ7 A;  2LKO A;  3PP2 A;  3GYO A;  1V5U A;  1W1D A;  4TKN A;  1XKE A;  1XR0 B;  1Y19 B;  2K2J A;  3FEH A;  1XD4 A;  3L8N A;  4PNK A;  4D7Q A;  3VOQ A;  5HE2 A;  3TFM A;  4Z2N A;  1TJ6 A;  1U27 A;  2OQB A;  4A5K A;  3LTL A;  4HAX B;  5KQ1 A;  4Z21 A;  1PMS A;  1GC7 A;  3AU5 A;  1NTV A;  4DX8 A;  4ZRJ A;  1J0W A;  3FM8 C;  4K2P A;  1ZVR A;  4HB2 B;  1V61 A;  3CXB B;  1KU1 A;  2D9V A;  1MPH A;  2P0H A;  1WGQ A;  3ZDT A;  1BTN A;  1Z87 A;  3PZD A;  2UZR A;  2IFS A;  3DXD A;  4GN1 A;  2DKP A;  5HE0 A;  2KGX B;  1XT0 B;  5C5B B;  2CAY A;  1XX0 A;  5FI1 A;  2J59 M;  3PSC A;  1RE0 B;  4A6F A;  3HK0 A;  1WVH A;  2COC A;  5D3W A;  2D4Q A;  5GOW B;  2Z0Q A;  1NTY A;  1KI1 B;  3ZVR A;  2AL6 A;  5JP4 A;  4DBB A;  2YT1 A;  2D9W A;  3QWM A;  3N7C A;  2X18 A;  1TQZ A;  1X1F A;  4KHA A;  1XOD A;  2VSZ A;  1I2H A;  2M38 A;  1M7E A;  2DHJ A;  1XSZ A;  1WJM A;  5DH9 B;  1MIZ B;  4CHJ A;  3ML4 A;  4HDO A;  5C6R A;  2RVB B;  1UNP A;  2YS3 A;  2UVM A;  5EFX A;  4C0A A;  1R8S E;  3G9W A;  2GS0 A;  2JP2 A;  2GJY A;  3ODW A;  5HE3 A;  4F7H A;  1BC9 A;  2MKR A;  2MWN B;  2QKM A;  2VRW B;  5LOP B;  1FAO A;  2DLW A;  1EVH A;  1BWN A;  2Z0O A;  3KZ1 A;  2LOX A;  4IAP A;  2MFQ A;  1MIX A;  2RGN B;  2V76 A;  2RNR B;  4MT7 A;  3IVF A;  4H8S A;  2RSG A;  3MPX A; 
#chains in the Genus database with same CATH topology
 1AXN A;  2Y8F A;  3BIN A;  1V5M A;  2DA0 A;  2J0K A;  5J3Q A;  2RLO A;  1MK9 B;  2XQN M;  1X1G A;  3NW8 A;  1TXD A;  4KMU X;  3KSY A;  2VKI A;  3AU4 A;  1PBV A;  2AEH A;  3PVU A;  5JLJ B;  3P7Z A;  2ELB A;  1V5P A;  2J0J A;  2K6X A;  3ABS A;  2ROZ B;  2QKL A;  1ZM0 A;  4KVG B;  4D0N B;  5HE1 A;  1Q8D A;  2N0Y A;  4GMV A;  4FHR B;  3ODO A;  2HYW A;  5KCV A;  2RUK B;  3UZT A;  3SOH B;  2H7D A;  2RRF A;  1BC0 A;  1EAZ A;  2LOZ A;  4L5M A;  3M1I B;  1LW3 A;  1C1K A;  4KN4 X;  3HW2 B;  1ZC4 B;  1ZYI A;  4GMX B;  4GNK B;  1G5N A;  1U5E A;  4XWX A;  2L2I A;  4HAU B;  3QIJ A;  1U2B A;  2COF A;  4GOU A;  4IFS A;  3TVV A;  1X05 A;  2GCL A;  3ABO A;  3SV1 A;  1X86 A;  1X11 A;  3TO1 A;  2K2U A;  1DRO A;  3TCA A;  2H0M A;  1FGY A;  2D9Z A;  2J0M A;  1MK7 B;  1U5G A;  4B6H A;  3QBV B;  4CSQ A;  4JK1 X;  3U8Z A;  1QC6 A;  2OTX A;  1J19 A;  1MCX A;  4C7P A;  2FJL A;  1MAI A;  2IIC A;  4JWL A;  4JXH A;  1UNR A;  1WG7 A;  2OY9 A;  5LON B;  4HB3 B;  5C5B A;  2RAN A;  1QQG A;  5FI0 A;  2XO3 A;  1BC3 A;  2ELA A;  3O96 A;  1PLS A;  1Y5O A;  2K00 A;  1AOW A;  2QEZ A;  2LUL A;  2YT0 A;  2YVC A;  2W2W A;  2DX5 A;  4HAW B;  2CY5 A;  1UNQ A;  4F7G A;  2DHK A;  1P6S A;  1SHC A;  2UZS A;  1PFJ A;  3WYF B;  3BRX A;  1HVD A;  4KAX B;  5JHG A;  2IYB A;  3MDB C;  5C16 A;  2H7E A;  5D3V A;  1AWE A;  1GG3 A;  3KRW A;  3T06 A;  3DXE A;  4MDU A;  5C79 A;  2Y8G A;  1DDM A;  4ZRI A;  5DHF B;  2I1K A;  2G35 A;  3OAN A;  3AO0 A;  1ISN A;  4Y94 A;  3WA0 A;  3PVW A;  1W3W A;  1DDW A;  2COA A;  2DTC A;  1BCZ A;  4HAT B;  3X23 A;  3ABR A;  1LKV X;  2Z4D A;  4A6F B;  2M14 A;  3U12 A;  4OSN A;  4QJ3 B;  1B55 A;  5DHA B;  4D7R A;  1MI1 A;  1DBH A;  2Q13 A;  2Z13 A;  2I5F A;  3A8Q A;  4EKU A;  5IRS A;  2ADZ A;  4K17 A;  2DN6 A;  4MDV A;  2HYV A;  3A58 A;  1ZC3 B;  2ROV A;  1UPR A;  4DX9 0;  2HE7 A;  2ZOC A;  3P6A A;  2HTH B;  1HM6 A;  2BCJ A;  2R2Y A;  2YSZ A;  1AVC A;  4A4P A;  1Q67 A;  1HAK A;  3V5W A;  1HVF A;  4CHM A;  1RJ2 A;  3F0W A;  4WVF B;  3NSU A;  2IE6 A;  1H4R A;  1ZSQ A;  4QXA B;  2LYD A;  2R09 A;  4HAY B;  2KCJ A;  3HSA A;  1WGU A;  2GUM A;  4F7U P;  1N44 A;  5D3X A;  4A6H A;  4GZU A;  4K81 A;  1N00 A;  1NI2 A;  1H10 A;  2XO2 A;  2CRF A;  4PQ0 A;  3D8E A;  3A98 B;  4HB4 B;  4EMO A;  2YT2 A;  2Q4C A;  1FB8 A;  1FHO A;  3TW1 A;  4YON A;  1V89 A;  2DHI A;  2L1C A;  2Z59 A;  1M7R A;  3A8P A;  1HVE A;  2N23 A;  1XCG A;  1LB1 A;  1W45 A;  1FHX A;  2ZPY A;  1K5G B;  5D3Y A;  4D6W A;  1AVH A;  1ANW A;  2P8V A;  5LG4 B;  1IRS A;  2I1J A;  2Y7B A;  1SGH A;  5KQ4 A;  1ANX A;  3LJU X;  2P0F A;  4GPT B;  4IOY X;  1ANN A;  1U5F A;  2KR0 A;  4HB0 B;  1R8M E;  1I7A A;  3NWF A;  4WSF A;  1U29 A;  4QJ4 B;  1P3R A;  3HQC A;  3NWD A;  2D11 A;  4EJN A;  3U7D A;  4HAV B;  4MK0 A;  1RRP B;  3OHM B;  4DXA B;  3ULC A;  2CY4 A;  3F5R A;  4JMI A;  2K8E A;  2MDX A;  1WI1 A;  2I5C A;  3DCX A;  1DK5 A;  3BJI A;  2DFK A;  2PZ1 A;  1OY2 A;  4HHV A;  3ULB A;  5D27 A;  2YF0 A;  1N41 A;  2EJ8 A;  1A8A A;  5J3Y A;  4EVF A;  2D2Q A;  1EGX A;  4TYZ A;  2D9X A;  4KN7 X;  4KHB B;  2DX1 A;  1S9D E;  4EVH A;  3AJ4 A;  1W7B A;  1BTK A;  2ZHJ A;  4CYE A;  1OQN A;  1BC1 A;  1NU2 A;  1P5T A;  2Z0P A;  4ZRK A;  2EC1 A;  4HDQ A;  2KIG A;  4JMO A;  3SUZ A;  4A6K A;  4Q2S A;  2YS5 A;  2H0L A;  3PEG A;  3SWV A;  4GXB A;  3HIE A;  3ODX A;  5CLL B;  1BAK A;  3USY A;  3TW5 A;  5DI9 B;  1K5D B;  1KZG A;  2GCJ A;  2DYN A;  5CLQ B;  1UPT B;  4OT1 A;  2E2X A;  2DKQ A;  2NZ8 B;  5M4Y B;  2R0D A;  3FVC A;  2ZHI A;  4YL8 A;  1EF1 A;  2EMS A;  1M9I A;  4KHO A;  2P0D A;  5JHH A;  1BCY A;  1U5D A;  2D9Y A;  2D10 A;  3FSS A;  4DIX A;  4OIY A;  1MKE A;  1DDV A;  1W1H A;  1UEF A;  4HSI A;  4K2O A;  1W1G A;  3HJL A;  2W2X D;  2KIE A;  5J3T A;  2NMB A;  1V88 A;  4HAZ B;  3SNH A;  1FOE A;  2COD A;  3DXC A;  1E5W A;  3D8D A;  3CIK A;  3PG7 A;  1R8Q E;  3SO6 A;  4FQ0 C;  2YRY A;  3KRX A;  1WJ1 A;  1FHW A;  4NY0 A;  2W2X C;  4QJ5 B;  1DM5 A;  2KUP A;  5I2M A;  1AQC A;  3VIA A;  4L6E A;  4WJ7 A;  2LG1 A;  3PVL A;  4MY6 A;  4NSW A;  1FGZ A;  3GYP A;  3KY9 A;  2FJU B;  3D8F A;  3USW A;  2EMT A;  1XJL A;  3SYX A;  1R4A E;  3RCP A;  5L81 A;  4BBK A;  5DIF B;  1YGM A;  1UPQ A;  1OMW A;  4P7I A;  2Z14 A;  2YS1 A;  4Z2M B;  1GC6 A;  2DYQ A;  1AEI A;  1DYN A;  1N3H A;  1KZ7 A;  2II2 A;  2LKO A;  3PP2 A;  3GYO A;  1V5U A;  1W1D A;  4TKN A;  1XKE A;  2KUQ A;  1XR0 B;  1Y19 B;  1XD4 A;  2K2J A;  3FEH A;  3L8N A;  4PNK A;  4D7Q A;  3VOQ A;  5HE2 A;  3TFM A;  4Z2N A;  1TJ6 A;  1U27 A;  3AJC A;  2OQB A;  4A5K A;  3LTL A;  4HAX B;  5KQ1 A;  4Z21 A;  1N42 A;  1PMS A;  1GC7 A;  3AU5 A;  2VXG A;  1QC7 A;  1NTV A;  3B77 A;  4DX8 A;  2ZKM X;  4KHB A;  1BCW A;  4ZRJ A;  1J0W A;  3ABQ A;  3FM8 C;  3ANY A;  4K2P A;  1ZVR A;  4HB2 B;  1V61 A;  3CXB B;  1KU1 A;  1YCN A;  2D9V A;  1MPH A;  2P0H A;  1WGQ A;  3ZDT A;  1BTN A;  1Z87 A;  3PZD A;  1I4A A;  2HYU A;  2UZR A;  2IFS A;  2IE7 A;  1BO9 A;  3DXD A;  4GN1 A;  2DKP A;  5HE0 A;  2KGX B;  1XT0 B;  5C5B B;  4L1R A;  2CAY A;  1XX0 A;  4HRE A;  5FI1 A;  2J59 M;  3PSC A;  1RE0 B;  4A6F A;  3HK0 A;  1WVH A;  2COC A;  5D3W A;  2D4Q A;  5GOW B;  2Z0Q A;  1SAV A;  1NTY A;  3NWA A;  1KI1 B;  3ZVR A;  2AL6 A;  1A8B A;  2K49 A;  5JP4 A;  4DBB A;  2YT1 A;  2D9W A;  2NBV A;  3QWM A;  3N7C A;  2X18 A;  1TQZ A;  1X1F A;  1ALA A;  4KHA A;  1XOD A;  2VSZ A;  1I2H A;  2M38 A;  1M7E A;  2DHJ A;  1XSZ A;  1WJM A;  5DH9 B;  1MIZ B;  4CHJ A;  3ML4 A;  1AVR A;  4HDO A;  5C6R A;  2RVB B;  1UNP A;  2YS3 A;  2UVM A;  5EFX A;  4C0A A;  1R8S E;  3G9W A;  2GS0 A;  2JP2 A;  2GJY A;  3ODW A;  5HE3 A;  4F7H A;  1BC9 A;  2MKR A;  2MWN B;  1YJ0 A;  1AII A;  2QKM A;  1YII A;  2VRW B;  2HSN A;  5LOP B;  1FAO A;  2DLW A;  1EVH A;  1BWN A;  1T77 A;  2Z0O A;  3KZ1 A;  2LOX A;  1HVG A;  4IAP A;  2H0K A;  2MFQ A;  1MIX A;  2RGN B;  4X9P A;  2V76 A;  2RNR B;  4MT7 A;  5I2S A;  3IVF A;  4H8S A;  2RSG A;  3MPX A; 
#chains in the Genus database with same CATH homology
 2Y8F A;  3BIN A;  1V5M A;  2DA0 A;  2J0K A;  5J3Q A;  2RLO A;  1MK9 B;  2XQN M;  1X1G A;  1TXD A;  4KMU X;  3KSY A;  2VKI A;  3AU4 A;  1PBV A;  2AEH A;  3PVU A;  5JLJ B;  3P7Z A;  2ELB A;  1V5P A;  2J0J A;  2K6X A;  2ROZ B;  2QKL A;  1ZM0 A;  4KVG B;  4D0N B;  5HE1 A;  1Q8D A;  2N0Y A;  4GMV A;  4FHR B;  3ODO A;  5KCV A;  2RUK B;  3UZT A;  3SOH B;  2H7D A;  2LOZ A;  1EAZ A;  4L5M A;  3M1I B;  1LW3 A;  4KN4 X;  3HW2 B;  1ZC4 B;  4GMX B;  1U5E A;  4XWX A;  2L2I A;  4HAU B;  3QIJ A;  1U2B A;  2COF A;  4IFS A;  3TVV A;  1X05 A;  2GCL A;  3SV1 A;  1X86 A;  1X11 A;  3TO1 A;  2K2U A;  1DRO A;  3TCA A;  1FGY A;  2D9Z A;  2J0M A;  1MK7 B;  1U5G A;  4B6H A;  3QBV B;  4JK1 X;  3U8Z A;  1QC6 A;  2OTX A;  1J19 A;  4C7P A;  2FJL A;  1MAI A;  4JWL A;  4JXH A;  1UNR A;  1WG7 A;  5LON B;  4HB3 B;  5C5B A;  1QQG A;  5FI0 A;  2ELA A;  3O96 A;  1PLS A;  1Y5O A;  2K00 A;  2LUL A;  2YT0 A;  2YVC A;  2W2W A;  2DX5 A;  4HAW B;  2CY5 A;  1UNQ A;  4F7G A;  2DHK A;  1P6S A;  1SHC A;  2UZS A;  1PFJ A;  3WYF B;  4KAX B;  5JHG A;  2IYB A;  3MDB C;  5C16 A;  2H7E A;  5D3V A;  1AWE A;  1GG3 A;  3KRW A;  3T06 A;  3DXE A;  5C79 A;  2Y8G A;  1DDM A;  4ZRI A;  5DHF B;  2I1K A;  2G35 A;  3OAN A;  1ISN A;  4Y94 A;  3WA0 A;  3PVW A;  1DDW A;  2COA A;  2DTC A;  4HAT B;  3X23 A;  1LKV X;  4A6F B;  2M14 A;  1B55 A;  5DHA B;  4D7R A;  1DBH A;  2Q13 A;  2I5F A;  3A8Q A;  4EKU A;  2ADZ A;  4K17 A;  2DN6 A;  1ZC3 B;  2ROV A;  1UPR A;  4DX9 0;  2HE7 A;  3P6A A;  2HTH B;  2BCJ A;  2YSZ A;  1Q67 A;  4A4P A;  3V5W A;  4CHM A;  1RJ2 A;  3F0W A;  4WVF B;  3NSU A;  1H4R A;  1ZSQ A;  2LYD A;  2R09 A;  4HAY B;  2KCJ A;  4F7U P;  1WGU A;  5D3X A;  4A6H A;  4GZU A;  4K81 A;  1NI2 A;  1H10 A;  2CRF A;  4PQ0 A;  3D8E A;  3A98 B;  4HB4 B;  4EMO A;  1FB8 A;  1FHO A;  3TW1 A;  4YON A;  1V89 A;  2DHI A;  2L1C A;  1M7R A;  3A8P A;  2N23 A;  1XCG A;  1LB1 A;  1FHX A;  2ZPY A;  1K5G B;  5D3Y A;  2P8V A;  1IRS A;  2I1J A;  2Y7B A;  1SGH A;  5KQ4 A;  3LJU X;  4GPT B;  2P0F A;  4IOY X;  4HB0 B;  1U5F A;  1R8M E;  1I7A A;  4WSF A;  1U29 A;  1P3R A;  3HQC A;  2D11 A;  4EJN A;  3U7D A;  4HAV B;  4MK0 A;  1RRP B;  4DXA B;  3ULC A;  2CY4 A;  3F5R A;  4JMI A;  2MDX A;  1WI1 A;  2I5C A;  3BJI A;  2DFK A;  2PZ1 A;  1OY2 A;  4HHV A;  3ULB A;  5D27 A;  2YF0 A;  2EJ8 A;  5J3Y A;  2D2Q A;  1EGX A;  4TYZ A;  2D9X A;  4KN7 X;  4KHB B;  2DX1 A;  1S9D E;  3AJ4 A;  1BTK A;  4CYE A;  1OQN A;  1P5T A;  1NU2 A;  2Z0P A;  4ZRK A;  2EC1 A;  4HDQ A;  4JMO A;  3SUZ A;  4A6K A;  2YS5 A;  3PEG A;  3SWV A;  4GXB A;  3ODX A;  5CLL B;  1BAK A;  3USY A;  3TW5 A;  5DI9 B;  1K5D B;  1KZG A;  2GCJ A;  2DYN A;  5CLQ B;  2E2X A;  2DKQ A;  2NZ8 B;  2R0D A;  4YL8 A;  1EF1 A;  2EMS A;  4KHO A;  2P0D A;  5JHH A;  1U5D A;  2D9Y A;  2D10 A;  3FSS A;  4OIY A;  1MKE A;  1DDV A;  1W1H A;  1UEF A;  4K2O A;  1W1G A;  3HJL A;  2W2X D;  5J3T A;  2NMB A;  1V88 A;  4HAZ B;  3SNH A;  1FOE A;  2COD A;  3DXC A;  1E5W A;  3D8D A;  3CIK A;  3PG7 A;  1R8Q E;  3SO6 A;  4FQ0 C;  2YRY A;  3KRX A;  1WJ1 A;  1FHW A;  4NY0 A;  2W2X C;  2KUP A;  1AQC A;  3VIA A;  4L6E A;  4WJ7 A;  2LG1 A;  3PVL A;  4MY6 A;  4NSW A;  1FGZ A;  3GYP A;  3KY9 A;  3D8F A;  3USW A;  2EMT A;  3SYX A;  3RCP A;  5L81 A;  4BBK A;  5DIF B;  1UPQ A;  1OMW A;  4P7I A;  4Z2M B;  2YS1 A;  1GC6 A;  2DYQ A;  1DYN A;  1N3H A;  1KZ7 A;  2LKO A;  3PP2 A;  3GYO A;  1V5U A;  1W1D A;  4TKN A;  1XKE A;  1XR0 B;  1Y19 B;  2K2J A;  1XD4 A;  3FEH A;  3L8N A;  4PNK A;  4D7Q A;  3VOQ A;  5HE2 A;  3TFM A;  4Z2N A;  1TJ6 A;  1U27 A;  3AJC A;  2OQB A;  4A5K A;  3LTL A;  4HAX B;  5KQ1 A;  4Z21 A;  1PMS A;  1GC7 A;  3AU5 A;  1QC7 A;  1NTV A;  4DX8 A;  4ZRJ A;  1J0W A;  3FM8 C;  4K2P A;  1ZVR A;  4HB2 B;  1V61 A;  3CXB B;  1KU1 A;  2D9V A;  1MPH A;  2P0H A;  1WGQ A;  3ZDT A;  1BTN A;  1Z87 A;  3PZD A;  2UZR A;  2IFS A;  3DXD A;  4GN1 A;  2DKP A;  5HE0 A;  2KGX B;  1XT0 B;  5C5B B;  2CAY A;  1XX0 A;  5FI1 A;  2J59 M;  3PSC A;  1RE0 B;  4A6F A;  3HK0 A;  1WVH A;  2COC A;  5D3W A;  2D4Q A;  5GOW B;  2Z0Q A;  1NTY A;  1KI1 B;  3ZVR A;  2AL6 A;  5JP4 A;  4DBB A;  2YT1 A;  2D9W A;  3QWM A;  3N7C A;  2X18 A;  1TQZ A;  1X1F A;  4KHA A;  1XOD A;  2VSZ A;  1I2H A;  2M38 A;  1M7E A;  2DHJ A;  1XSZ A;  1WJM A;  5DH9 B;  1MIZ B;  4CHJ A;  3ML4 A;  4HDO A;  5C6R A;  2RVB B;  1UNP A;  2YS3 A;  2UVM A;  5EFX A;  4C0A A;  1R8S E;  3G9W A;  2GS0 A;  2JP2 A;  2GJY A;  3ODW A;  5HE3 A;  4F7H A;  1BC9 A;  2MKR A;  2MWN B;  2QKM A;  2VRW B;  2HSN A;  5LOP B;  1FAO A;  2DLW A;  1EVH A;  1BWN A;  2Z0O A;  3KZ1 A;  2LOX A;  4IAP A;  2MFQ A;  1MIX A;  2RGN B;  2V76 A;  2RNR B;  4MT7 A;  3IVF A;  4H8S A;  2RSG A;  3MPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...