2R09A

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Cytohesin-3
total genus 101
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r09A01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r09A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r09A03
2D9VA 4YONA 1Q67A 4K17A 5D3WA 4PNKA 2LG1A 1GG3A 2DHIA 3A8QA 5EFXA 2I5FA 1EGXA 1QC6A 2BCJA 4NSWA 4IAPA 1BAKA 4Y94A 3NSUA 5JHGA 2MFQA 3O96A 3PP2A 1U5DA 2LOZA 4HAXB 1I7AA 3ML4A 4CYEA 1R8QE 2QKLA 4MT7A 2W2WA 3LTLA 1H4RA 2EC1A 4KAXB 3DXCA 2J0JA 1MK7B 1FGZA 3FEHA 5DI9B 1XKEA 2ZPYA 4D7QA 4A4PA 1N3HA 2YT1A 5DHAB 2D9XA 2K2JA 1V5MA 3AU5A 3M1IB 2QKMA 4MK0A 4CHJA 2R0DA 3D8FA 2Z0QA 1J0WA 1ZSQA 4HB4B 2Y8GA 3U8ZA 5GOWB 3A8PA 3GYOA 1XX0A 2K2UA 1LW3A 2J0KA 1S9DE 3ULBA 1SGHA 2DKPA 3TCAA 4HB0B 2HTHB 2YVCA 3T06A 1PMSA 3VIAA 1X1FA 5JP4A 5D27A 1MIZB 2GJYA 4GPTB 1V5UA 2W2XC 4EJNA 4DBBA 2OTXA 1UNRA 4KVGB 3A98B 4F7GA 5CLQB 1I2HA 1OMWA 2MDXA 1DBHA 1NTVA 1XD4A 3QBVB 4HB3B 3DXEA 2RLOA 1V61A 3QWMA 1WGQA 3ODXA 1V88A 1E5WA 3GYPA 4WSFA 2DHJA 5C16A 2K00A 1XCGA 1XODA 2ELAA 1NU2A 4DX8A 4HAVB 1BTNA 2YSZA 1EVHA 5HE2A 2J0MA 5HE1A 4HAWB 4HHVA 3PZDA 3TFMA 2I1KA 2EJ8A 2VKIA 2D9WA 2KGXB 1MIXA 1FOEA 2DN6A 3ZVRA 2DLWA 3PSCA 1X1GA 4HATB 1AQCA 1J19A 2L2IA 5L81A 4WVFB 1W1HA 1KI1B 2RGNB 3DXDA 4A5KA 2DYNA 1W1GA 2D4QA 2GCLA 1GC6A 4K2OA 2LOXA 1WJ1A 4HAUB 4D0NB 2UVMA 4ZRJA 1B55A 4C0AA 1P3RA 4D7RA 5HE0A 1PBVA 2I5CA 1WI1A 4MY6A 3ODWA 1WJMA 2LYDA 4KHAA 1U5FA 3MPXA 4ZRIA 3BJIA 2HE7A 1UPQA 1EAZA 5D3XA 3RCPA 1U27A 3KY9A 3MDBC 5LONB 5D3VA 5KQ1A 2I1JA 2MWNB 2FJLA 3IVFA 5FI0A 4IFSA 1Y5OA 1GC7A 3TO1A 3PVLA 1SHCA 3D8DA 4YL8A 3X23A 4HB2B 1KZ7A 2VSZA 2G35A 4TKNA 2EMSA 1P6SA 3KRXA 1BTKA 4F7UP 2D11A 4GMVA 2KCJA 3HK0A 3FSSA 4XWXA 2COCA 1TJ6A 1M7RA 1RRPB 1MPHA 1UNPA 2D9YA 3U7DA 1H10A 5J3QA 4KHBB 3PVWA 2Y7BA 2GCJA 4A6HA 1Z87A 2RVBB 2CY5A 4WJ7A 1MAIA 1X11A 2N23A 1Y19B 2DTCA 3LJUX 5DH9B 1R8SE 2P0FA 3KZ1A 1PFJA 1OQNA 2CAYA 4JXHA 3D8EA 3SV1A 3N7CA 1V89A 2MKRA 2Q13A 4DX90 4F7HA 2LKOA 4L5MA 2P8VA 4GN1A 5JHHA 5DHFB 2NZ8B 1RE0B 1DDVA 1K5DB 4JMOA 4IOYX 3UZTA 2D2QA 2W2XD 1AWEA 3HW2B 1XSZA 3PVUA 2COFA 1ZM0A 1FHXA 4Z2MB 2ROVA 4A6KA 4DXAB 2AL6A 1BC9A 4JMIA 2DX5A 2D9ZA 2YS3A 1IRSA 5FI1A 1UEFA 1DDMA 5C5BA 3KSYA 1FB8A 4Z2NA 5HE3A 3FM8C 1RJ2A 3OANA 1FGYA 3G9WA 2YS5A 2LULA 4GZUA 5J3YA 3ULCA 2EMTA 2H7DA 3CIKA 2RUKB 2DFKA 1FAOA 4GMXB 2E2XA 4K2PA 5CLLB 4A6FA 2DA0A 1MKEA 1FHWA 1DYNA 2COAA 2YF0A 1NI2A 3VOQA 1XR0B 2DYQA 4CHMA 3CXBB 2H7EA 2P0DA 1U5EA 3SUZA 4H8SA 5JLJB 3SO6A 4K81A 2OQBA 1QQGA 4C7PA 5C79A 2DX1A 2YRYA 2ADZA 1XT0B 1EF1A 1BWNA 2ROZB 2YT0A 2DKQA 2JP2A 5DIFB 4PQ0A 2NMBA 2UZRA 1R8ME 2CRFA 2ELBA 4HDQA 3KRWA 3F5RA 3QIJA 3P7ZA 3PEGA 4P7IA 5D3YA 1NTYA 3ODOA 2N0YA 2J59M 4ZRKA 2PZ1A 2UZSA 3F0WA 1TXDA 2IYBA 2Z0OA 3HQCA 2DHKA 1UPRA 1V5PA 1M7EA 4HAYB 3P6AA 2Z0PA 4L6EA 1P5TA 5KCVA 1TQZA 1ZC3B 1K5GB 4HDOA 5C6RA 3BINA 1ISNA 2Y8FA 4NY0A 3WYFB 2GS0A 1W1DA 2M14A 4EMOA 1KZGA 3SWVA 1FHOA 2IFSA 1U5GA 1U29A 2KUPA 3WA0A 4A6FB 3L8NA 1U2BA 2R09A 1X05A 4OIYA 1ZVRA 2CODA 1OY2A 2YS1A 3AU4A 4BBKA 1X86A 1PLSA 2RSGA 2V76A 5J3TA 3PG7A 1WG7A 2D10A 1DDWA 2AEHA 4KHOA 1ZC4B 2L1CA 2VRWB 2M38A 5C5BB 3SNHA 2P0HA 3TW1A 1LB1A 4B6HA 4EKUA 1KU1A 1WVHA 1WGUA 4GXBA 3SYXA 2CY4A 1DROA 4TYZA 2XQNM 3ZDTA 4HAZB 4Z21A 3AJ4A 1UNQA 4JWLA 3TVVA 2RNRB 3V5WA 5KQ4A 1MK9B 5LOPB 2X18A
chains in the Genus database with same CATH superfamily
2KUQA 4D6WA 3ABOA 2D9VA 4YONA 1Q67A 4K17A 5D3WA 4PNKA 2LG1A 1GG3A 4KN4X 2DHIA 1BCZA 1HM6A 3A8QA 4EVHA 5EFXA 2I5FA 1EGXA 1QC6A 2BCJA 1YCNA 4IAPA 4NSWA 1DM5A 1BAKA 4Y94A 3NSUA 3A58A 5JHGA 2MFQA 3O96A 1AVCA 3PP2A 1U5DA 2LOZA 2ZOCA 4HAXB 1I7AA 3ML4A 4CYEA 1AVRA 1R8QE 2QKLA 4MT7A 2W2WA 3LTLA 1H4RA 2EC1A 4KAXB 3DXCA 4Q2SA 2J0JA 1MK7B 1FGZA 4GOUA 2ZHJA 3FEHA 5DI9B 1XKEA 2ZPYA 4D7QA 4A4PA 1N3HA 2YT1A 1ZYIA 5DHAB 1HAKA 2D9XA 2K2JA 1V5MA 3AU5A 3M1IB 2QKMA 4MK0A 4CHJA 2R0DA 3D8FA 2KIEA 2HYUA 4QJ4B 2Z0QA 1J0WA 1ZSQA 2ZKMX 3ANYA 2Y8GA 4HB4B 3U8ZA 4X9PA 5GOWB 3A8PA 3GYOA 3HIEA 2XO3A 1XX0A 1G5NA 2K2UA 1LW3A 2J0KA 1S9DE 3ULBA 1SGHA 2DKPA 3TCAA 4HB0B 2HTHB 2YVCA 3T06A 1PMSA 3VIAA 1X1FA 5JP4A 5D27A 1MIZB 2GJYA 4GPTB 3AO0A 1V5UA 2W2XC 2HYWA 4EJNA 4DBBA 2OTXA 1W3WA 1UNRA 4KVGB 3A98B 4F7GA 5CLQB 1I2HA 1OMWA 2MDXA 1DBHA 1NTVA 5IRSA 1XD4A 3QBVB 1BC3A 4HB3B 1BC0A 2HYVA 3DXEA 5LG4B 2RLOA 1V61A 3QWMA 1WGQA 3HJLA 3ODXA 1YIIA 1V88A 1BCYA 1E5WA 3GYPA 4WSFA 3B77A 2DHJA 5C16A 2K00A 1XCGA 4MDVA 1XODA 3DCXA 2ELAA 1NU2A 4DX8A 4HAVB 1BTNA 4FQ0C 2YSZA 1QC7A 1EVHA 5HE2A 2J0MA 5HE1A 4HAWB 4HHVA 3PZDA 3TFMA 2I1KA 2EJ8A 2VKIA 2D9WA 3NWFA 1W45A 1MIXA 2KGXB 4FHRB 1FOEA 2DN6A 3ZVRA 2DLWA 3PSCA 1X1GA 4HATB 1AQCA 1YGMA 1J19A 2XO2A 4L1RA 2L2IA 5L81A 1BCWA 4WVFB 1W1HA 1KI1B 2RGNB 3DXDA 4A5KA 2DYNA 1HVFA 1W1GA 2D4QA 2GCLA 3U12A 1GC6A 4K2OA 2LOXA 1ALAA 1C1KA 1WJ1A 4HAUB 4D0NB 3NWAA 2UVMA 4ZRJA 1B55A 4C0AA 1P3RA 4D7RA 5HE0A 1W7BA 1PBVA 4JK1X 2I5CA 1WI1A 4MY6A 3ODWA 4MDUA 2KIGA 1WJMA 2LYDA 4KHAA 1U5FA 3MPXA 3NW8A 4ZRIA 3BJIA 2HE7A 1UPQA 1EAZA 5D3XA 1A8BA 1U27A 3KY9A 3RCPA 3MDBC 5LONB 5D3VA 3BRXA 5KQ1A 2OY9A 2II2A 2I1JA 2MWNB 2FJLA 3IVFA 5FI0A 4IFSA 1ANXA 1Y5OA 1GC7A 3TO1A 3PVLA 1SHCA 3D8DA 4YL8A 3X23A 4HB2B 1KZ7A 2VSZA 2G35A 4TKNA 2EMSA 1HVDA 1P6SA 1YJ0A 3KRXA 1BTKA 4F7UP 2D11A 2GUMA 4GMVA 2KCJA 1AVHA 2IE6A 3FSSA 3HK0A 2COCA 2Z4DA 4XWXA 1TJ6A 1M7RA 1RRPB 2RANA 1MPHA 2IICA 1UNPA 2D9YA 3U7DA 1H10A 2Z13A 2R2YA 1M9IA 5J3QA 4KHBB 3PVWA 2Y7BA 2IE7A 2Z14A 2K6XA 2GCJA 1Z87A 4A6HA 1UPTB 1BO9A 2CY5A 3ABQA 2RVBB 1MAIA 4WJ7A 1X11A 1HVGA 4DIXA 1ANWA 2N23A 1Y19B 2DTCA 3LJUX 5DH9B 1R8SE 2P0FA 4HREA 3KZ1A 1PFJA 1OQNA 2YT2A 2CAYA 4JXHA 3D8EA 3SV1A 3N7CA 1LKVX 1V89A 2MKRA 2Q13A 4DX90 4F7HA 4GNKB 2LKOA 1AXNA 4L5MA 2P8VA 4GN1A 5JHHA 5DHFB 2NZ8B 1RE0B 1DDVA 1K5DB 1AOWA 4JMOA 4IOYX 3UZTA 2D2QA 2W2XD 4CSQA 1AWEA 3HW2B 3ABSA 1XSZA 3PVUA 2COFA 1ZM0A 2K8EA 1ANNA 1FHXA 1BC1A 4Z2MB 2ROVA 4HSIA 4A6KA 4KMUX 4DXAB 2AL6A 2ZHIA 1BC9A 4JMIA 2DX5A 2D9ZA 2YS3A 1IRSA 5FI1A 1N00A 1UEFA 3OHMB 1DDMA 5C5BA 3KSYA 3USYA 1FB8A 4Z2NA 5HE3A 3FM8C 1R4AE 1RJ2A 3OANA 1N41A 3SOHB 1FGYA 3G9WA 4QJ5B 2YS5A 4QXAB 3AJCA 2LULA 4GZUA 5J3YA 3ULCA 2EMTA 2H7DA 3CIKA 2RUKB 2DFKA 3FVCA 1XJLA 1FAOA 4GMXB 2E2XA 4K2PA 5CLLB 4A6FA 2DA0A 1MKEA 1FHWA 1DYNA 2COAA 2YF0A 1NI2A 2Z59A 1XR0B 2DYQA 3VOQA 4CHMA 3CXBB 2H7EA 2P0DA 4QJ3B 1U5EA 3SUZA 4H8SA 5JLJB 3SO6A 4K81A 2OQBA 1QQGA 5I2MA 4C7PA 2KR0A 5C79A 2DX1A 2YRYA 4EVFA 2ADZA 1XT0B 1EF1A 1BWNA 2ROZB 2YT0A 2DKQA 2JP2A 1Q8DA 5DIFB 1HVEA 4PQ0A 2NMBA 2UZRA 1R8ME 2CRFA 2VXGA 2ELBA 2H0KA 4HDQA 3KRWA 3F5RA 3TW5A 3QIJA 3P7ZA 3PEGA 4P7IA 5D3YA 1NTYA 3ODOA 2N0YA 2J59M 4ZRKA 2PZ1A 2UZSA 1SAVA 3F0WA 2HSNA 1MI1A 1TXDA 2IYBA 2Z0OA 3HQCA 2K49A 2DHKA 1UPRA 1V5PA 1M7EA 4HAYB 3P6AA 2Z0PA 4L6EA 1P5TA 5KCVA 1N42A 1TQZA 2FJUB 1ZC3B 1K5GB 4HDOA 5C6RA 5I2SA 1AIIA 3BINA 4OT1A 1ISNA 2Y8FA 4KHBA 4NY0A 3WYFB 2GS0A 1W1DA 2M14A 4EMOA 1KZGA 3SWVA 2H0LA 1AEIA 1I4AA 1FHOA 2IFSA 1U5GA 1U29A 1DK5A 1A8AA 2KUPA 3WA0A 4A6FB 3L8NA 1MCXA 1U2BA 2R09A 1X05A 4OIYA 1ZVRA 1N44A 2CODA 4KN7X 1T77A 2H0MA 3ABRA 1OY2A 2YS1A 3AU4A 4BBKA 1X86A 1PLSA 2NBVA 2RSGA 2QEZA 2V76A 5J3TA 3PG7A 1WG7A 3USWA 2D10A 1DDWA 2AEHA 3HSAA 1ZC4B 4KHOA 2L1CA 2VRWB 2M38A 5C5BB 3SNHA 4OSNA 3NWDA 2P0HA 3TW1A 1LB1A 4B6HA 4EKUA 1KU1A 1WVHA 1WGUA 4GXBA 2Q4CA 3SYXA 2CY4A 1DROA 4TYZA 2XQNM 3ZDTA 4HAZB 4Z21A 3AJ4A 5M4YB 1UNQA 4JWLA 3TVVA 2RNRB 3V5WA 5KQ4A 1MK9B 5LOPB 2X18A 2RRFA
chains in the Genus database with same CATH topology
2D9VA 4YONA 1Q67A 4K17A 5D3WA 4PNKA 2LG1A 1GG3A 4KN4X 2DHIA 3A8QA 5EFXA 2I5FA 1EGXA 1QC6A 2BCJA 4NSWA 4IAPA 1BAKA 4Y94A 3NSUA 5JHGA 2MFQA 3O96A 3PP2A 1U5DA 2LOZA 4HAXB 1I7AA 3ML4A 4CYEA 1R8QE 2QKLA 4MT7A 2W2WA 3LTLA 1H4RA 2EC1A 4KAXB 3DXCA 2J0JA 1MK7B 1FGZA 3FEHA 5DI9B 1XKEA 2ZPYA 4D7QA 4A4PA 1N3HA 2YT1A 5DHAB 2D9XA 2K2JA 1V5MA 3AU5A 3M1IB 2QKMA 4MK0A 4CHJA 2R0DA 3D8FA 2Z0QA 1J0WA 1ZSQA 4HB4B 2Y8GA 3U8ZA 5GOWB 3A8PA 3GYOA 1XX0A 2K2UA 1LW3A 2J0KA 1S9DE 3ULBA 1SGHA 2DKPA 3TCAA 4HB0B 2HTHB 2YVCA 3T06A 1PMSA 3VIAA 1X1FA 5JP4A 5D27A 1MIZB 2GJYA 4GPTB 1V5UA 2W2XC 4EJNA 4DBBA 2OTXA 1UNRA 4KVGB 3A98B 4F7GA 5CLQB 1I2HA 1OMWA 2MDXA 1DBHA 1NTVA 1XD4A 3QBVB 4HB3B 3DXEA 2RLOA 1V61A 3QWMA 1WGQA 3HJLA 3ODXA 1V88A 1E5WA 3GYPA 4WSFA 2DHJA 5C16A 2K00A 1XCGA 1XODA 2ELAA 1NU2A 4DX8A 4HAVB 1BTNA 4FQ0C 2YSZA 1QC7A 1EVHA 5HE2A 2J0MA 5HE1A 4HAWB 4HHVA 3PZDA 3TFMA 2I1KA 2EJ8A 2VKIA 2D9WA 2KGXB 1MIXA 4FHRB 1FOEA 2DN6A 3ZVRA 2DLWA 3PSCA 1X1GA 4HATB 1AQCA 1J19A 2L2IA 5L81A 4WVFB 1W1HA 1KI1B 2RGNB 3DXDA 4A5KA 2DYNA 1W1GA 2D4QA 2GCLA 1GC6A 4K2OA 2LOXA 1WJ1A 4HAUB 4D0NB 2UVMA 4ZRJA 1B55A 4C0AA 1P3RA 4D7RA 5HE0A 1PBVA 4JK1X 2I5CA 1WI1A 4MY6A 3ODWA 1WJMA 2LYDA 4KHAA 1U5FA 3MPXA 4ZRIA 3BJIA 2HE7A 1UPQA 1EAZA 5D3XA 3RCPA 1U27A 3KY9A 3MDBC 5LONB 5D3VA 5KQ1A 2I1JA 2MWNB 2FJLA 3IVFA 5FI0A 4IFSA 1Y5OA 1GC7A 3TO1A 3PVLA 1SHCA 3D8DA 4YL8A 3X23A 4HB2B 1KZ7A 2VSZA 2G35A 4TKNA 2EMSA 1P6SA 3KRXA 1BTKA 4F7UP 2D11A 4GMVA 2KCJA 3HK0A 3FSSA 4XWXA 2COCA 1TJ6A 1M7RA 1RRPB 1MPHA 1UNPA 2D9YA 3U7DA 1H10A 5J3QA 4KHBB 3PVWA 2Y7BA 2K6XA 2GCJA 1Z87A 4A6HA 2RVBB 2CY5A 4WJ7A 1MAIA 1X11A 2N23A 1Y19B 2DTCA 3LJUX 5DH9B 1R8SE 2P0FA 3KZ1A 1PFJA 1OQNA 2CAYA 4JXHA 3D8EA 3SV1A 3N7CA 1LKVX 1V89A 2MKRA 2Q13A 4DX90 4F7HA 2LKOA 4L5MA 2P8VA 4GN1A 5JHHA 5DHFB 2NZ8B 1RE0B 1DDVA 1K5DB 4JMOA 4IOYX 3UZTA 2D2QA 2W2XD 1AWEA 3HW2B 1XSZA 3PVUA 2COFA 1ZM0A 1FHXA 4Z2MB 2ROVA 4A6KA 4KMUX 4DXAB 2AL6A 1BC9A 4JMIA 2DX5A 2D9ZA 2YS3A 1IRSA 5FI1A 1UEFA 1DDMA 5C5BA 3KSYA 3USYA 1FB8A 4Z2NA 5HE3A 3FM8C 1RJ2A 3OANA 3SOHB 1FGYA 3G9WA 2YS5A 3AJCA 2LULA 4GZUA 5J3YA 3ULCA 2EMTA 2H7DA 3CIKA 2RUKB 2DFKA 1FAOA 4GMXB 2E2XA 4K2PA 5CLLB 4A6FA 2DA0A 1MKEA 1FHWA 1DYNA 2COAA 2YF0A 1NI2A 3VOQA 1XR0B 2DYQA 4CHMA 3CXBB 2H7EA 2P0DA 1U5EA 3SUZA 4H8SA 5JLJB 3SO6A 4K81A 2OQBA 1QQGA 4C7PA 5C79A 2DX1A 2YRYA 2ADZA 1XT0B 1EF1A 1BWNA 2ROZB 2YT0A 2DKQA 2JP2A 1Q8DA 5DIFB 4PQ0A 2NMBA 2UZRA 1R8ME 2CRFA 2ELBA 4HDQA 3KRWA 3F5RA 3TW5A 3QIJA 3P7ZA 3PEGA 4P7IA 5D3YA 1NTYA 3ODOA 2N0YA 2J59M 4ZRKA 2PZ1A 2UZSA 3F0WA 2HSNA 1TXDA 2IYBA 2Z0OA 3HQCA 2DHKA 1UPRA 1V5PA 1M7EA 4HAYB 3P6AA 2Z0PA 4L6EA 1P5TA 5KCVA 1TQZA 1ZC3B 1K5GB 4HDOA 5C6RA 3BINA 1ISNA 2Y8FA 4NY0A 3WYFB 2GS0A 1W1DA 2M14A 4EMOA 1KZGA 3SWVA 1FHOA 2IFSA 1U5GA 1U29A 2KUPA 3WA0A 4A6FB 3L8NA 1U2BA 2R09A 1X05A 4OIYA 1ZVRA 2CODA 4KN7X 1OY2A 2YS1A 3AU4A 4BBKA 1X86A 1PLSA 2RSGA 2V76A 5J3TA 3PG7A 1WG7A 3USWA 2D10A 1DDWA 2AEHA 4KHOA 1ZC4B 2L1CA 2VRWB 2M38A 5C5BB 3SNHA 2P0HA 3TW1A 1LB1A 4B6HA 4EKUA 1KU1A 1WVHA 1WGUA 4GXBA 3SYXA 2CY4A 1DROA 4TYZA 2XQNM 3ZDTA 4HAZB 4Z21A 3AJ4A 1UNQA 4JWLA 3TVVA 2RNRB 3V5WA 5KQ4A 1MK9B 5LOPB 2X18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9V A;  4YON A;  1Q67 A;  4K17 A;  5D3W A;  4PNK A;  2LG1 A;  1GG3 A;  2DHI A;  3A8Q A;  5EFX A;  2I5F A;  1EGX A;  1QC6 A;  2BCJ A;  4NSW A;  4IAP A;  1BAK A;  4Y94 A;  3NSU A;  5JHG A;  2MFQ A;  3O96 A;  3PP2 A;  1U5D A;  2LOZ A;  4HAX B;  1I7A A;  3ML4 A;  4CYE A;  1R8Q E;  2QKL A;  4MT7 A;  2W2W A;  3LTL A;  1H4R A;  2EC1 A;  4KAX B;  3DXC A;  2J0J A;  1MK7 B;  1FGZ A;  3FEH A;  5DI9 B;  1XKE A;  2ZPY A;  4D7Q A;  4A4P A;  1N3H A;  2YT1 A;  5DHA B;  2D9X A;  2K2J A;  1V5M A;  3AU5 A;  3M1I B;  2QKM A;  4MK0 A;  4CHJ A;  2R0D A;  3D8F A;  2Z0Q A;  1J0W A;  1ZSQ A;  4HB4 B;  2Y8G A;  3U8Z A;  5GOW B;  3A8P A;  3GYO A;  1XX0 A;  2K2U A;  1LW3 A;  2J0K A;  1S9D E;  3ULB A;  1SGH A;  2DKP A;  3TCA A;  4HB0 B;  2HTH B;  2YVC A;  3T06 A;  1PMS A;  3VIA A;  1X1F A;  5JP4 A;  5D27 A;  1MIZ B;  2GJY A;  4GPT B;  1V5U A;  2W2X C;  4EJN A;  4DBB A;  2OTX A;  1UNR A;  4KVG B;  3A98 B;  4F7G A;  5CLQ B;  1I2H A;  1OMW A;  2MDX A;  1DBH A;  1NTV A;  1XD4 A;  3QBV B;  4HB3 B;  3DXE A;  2RLO A;  1V61 A;  3QWM A;  1WGQ A;  3ODX A;  1V88 A;  1E5W A;  3GYP A;  4WSF A;  2DHJ A;  5C16 A;  2K00 A;  1XCG A;  1XOD A;  2ELA A;  1NU2 A;  4DX8 A;  4HAV B;  1BTN A;  2YSZ A;  1EVH A;  5HE2 A;  2J0M A;  5HE1 A;  4HAW B;  4HHV A;  3PZD A;  3TFM A;  2I1K A;  2EJ8 A;  2VKI A;  2D9W A;  2KGX B;  1MIX A;  1FOE A;  2DN6 A;  3ZVR A;  2DLW A;  3PSC A;  1X1G A;  4HAT B;  1AQC A;  1J19 A;  2L2I A;  5L81 A;  4WVF B;  1W1H A;  1KI1 B;  2RGN B;  3DXD A;  4A5K A;  2DYN A;  1W1G A;  2D4Q A;  2GCL A;  1GC6 A;  4K2O A;  2LOX A;  1WJ1 A;  4HAU B;  4D0N B;  2UVM A;  4ZRJ A;  1B55 A;  4C0A A;  1P3R A;  4D7R A;  5HE0 A;  1PBV A;  2I5C A;  1WI1 A;  4MY6 A;  3ODW A;  1WJM A;  2LYD A;  4KHA A;  1U5F A;  3MPX A;  4ZRI A;  3BJI A;  2HE7 A;  1UPQ A;  1EAZ A;  5D3X A;  3RCP A;  1U27 A;  3KY9 A;  3MDB C;  5LON B;  5D3V A;  5KQ1 A;  2I1J A;  2MWN B;  2FJL A;  3IVF A;  5FI0 A;  4IFS A;  1Y5O A;  1GC7 A;  3TO1 A;  3PVL A;  1SHC A;  3D8D A;  4YL8 A;  3X23 A;  4HB2 B;  1KZ7 A;  2VSZ A;  2G35 A;  4TKN A;  2EMS A;  1P6S A;  3KRX A;  1BTK A;  4F7U P;  2D11 A;  4GMV A;  2KCJ A;  3HK0 A;  3FSS A;  4XWX A;  2COC A;  1TJ6 A;  1M7R A;  1RRP B;  1MPH A;  1UNP A;  2D9Y A;  3U7D A;  1H10 A;  5J3Q A;  4KHB B;  3PVW A;  2Y7B A;  2GCJ A;  4A6H A;  1Z87 A;  2RVB B;  2CY5 A;  4WJ7 A;  1MAI A;  1X11 A;  2N23 A;  1Y19 B;  2DTC A;  3LJU X;  5DH9 B;  1R8S E;  2P0F A;  3KZ1 A;  1PFJ A;  1OQN A;  2CAY A;  4JXH A;  3D8E A;  3SV1 A;  3N7C A;  1V89 A;  2MKR A;  2Q13 A;  4DX9 0;  4F7H A;  2LKO A;  4L5M A;  2P8V A;  4GN1 A;  5JHH A;  5DHF B;  2NZ8 B;  1RE0 B;  1DDV A;  1K5D B;  4JMO A;  4IOY X;  3UZT A;  2D2Q A;  2W2X D;  1AWE A;  3HW2 B;  1XSZ A;  3PVU A;  2COF A;  1ZM0 A;  1FHX A;  4Z2M B;  2ROV A;  4A6K A;  4DXA B;  2AL6 A;  1BC9 A;  4JMI A;  2DX5 A;  2D9Z A;  2YS3 A;  1IRS A;  5FI1 A;  1UEF A;  1DDM A;  5C5B A;  3KSY A;  1FB8 A;  4Z2N A;  5HE3 A;  3FM8 C;  1RJ2 A;  3OAN A;  1FGY A;  3G9W A;  2YS5 A;  2LUL A;  4GZU A;  5J3Y A;  3ULC A;  2EMT A;  2H7D A;  3CIK A;  2RUK B;  2DFK A;  1FAO A;  4GMX B;  2E2X A;  4K2P A;  5CLL B;  4A6F A;  2DA0 A;  1MKE A;  1FHW A;  1DYN A;  2COA A;  2YF0 A;  1NI2 A;  3VOQ A;  1XR0 B;  2DYQ A;  4CHM A;  3CXB B;  2H7E A;  2P0D A;  1U5E A;  3SUZ A;  4H8S A;  5JLJ B;  3SO6 A;  4K81 A;  2OQB A;  1QQG A;  4C7P A;  5C79 A;  2DX1 A;  2YRY A;  2ADZ A;  1XT0 B;  1EF1 A;  1BWN A;  2ROZ B;  2YT0 A;  2DKQ A;  2JP2 A;  5DIF B;  4PQ0 A;  2NMB A;  2UZR A;  1R8M E;  2CRF A;  2ELB A;  4HDQ A;  3KRW A;  3F5R A;  3QIJ A;  3P7Z A;  3PEG A;  4P7I A;  5D3Y A;  1NTY A;  3ODO A;  2N0Y A;  2J59 M;  4ZRK A;  2PZ1 A;  2UZS A;  3F0W A;  1TXD A;  2IYB A;  2Z0O A;  3HQC A;  2DHK A;  1UPR A;  1V5P A;  1M7E A;  4HAY B;  3P6A A;  2Z0P A;  4L6E A;  1P5T A;  5KCV A;  1TQZ A;  1ZC3 B;  1K5G B;  4HDO A;  5C6R A;  3BIN A;  1ISN A;  2Y8F A;  4NY0 A;  3WYF B;  2GS0 A;  1W1D A;  2M14 A;  4EMO A;  1KZG A;  3SWV A;  1FHO A;  2IFS A;  1U5G A;  1U29 A;  2KUP A;  3WA0 A;  4A6F B;  3L8N A;  1U2B A;  2R09 A;  1X05 A;  4OIY A;  1ZVR A;  2COD A;  1OY2 A;  2YS1 A;  3AU4 A;  4BBK A;  1X86 A;  1PLS A;  2RSG A;  2V76 A;  5J3T A;  3PG7 A;  1WG7 A;  2D10 A;  1DDW A;  2AEH A;  4KHO A;  1ZC4 B;  2L1C A;  2VRW B;  2M38 A;  5C5B B;  3SNH A;  2P0H A;  3TW1 A;  1LB1 A;  4B6H A;  4EKU A;  1KU1 A;  1WVH A;  1WGU A;  4GXB A;  3SYX A;  2CY4 A;  1DRO A;  4TYZ A;  2XQN M;  3ZDT A;  4HAZ B;  4Z21 A;  3AJ4 A;  1UNQ A;  4JWL A;  3TVV A;  2RNR B;  3V5W A;  5KQ4 A;  1MK9 B;  5LOP B;  2X18 A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  4D6W A;  3ABO A;  2D9V A;  4YON A;  1Q67 A;  4K17 A;  5D3W A;  4PNK A;  2LG1 A;  1GG3 A;  4KN4 X;  2DHI A;  1BCZ A;  1HM6 A;  3A8Q A;  4EVH A;  5EFX A;  2I5F A;  1EGX A;  1QC6 A;  2BCJ A;  1YCN A;  4IAP A;  4NSW A;  1DM5 A;  1BAK A;  4Y94 A;  3NSU A;  3A58 A;  5JHG A;  2MFQ A;  3O96 A;  1AVC A;  3PP2 A;  1U5D A;  2LOZ A;  2ZOC A;  4HAX B;  1I7A A;  3ML4 A;  4CYE A;  1AVR A;  1R8Q E;  2QKL A;  4MT7 A;  2W2W A;  3LTL A;  1H4R A;  2EC1 A;  4KAX B;  3DXC A;  4Q2S A;  2J0J A;  1MK7 B;  1FGZ A;  4GOU A;  2ZHJ A;  3FEH A;  5DI9 B;  1XKE A;  2ZPY A;  4D7Q A;  4A4P A;  1N3H A;  2YT1 A;  1ZYI A;  5DHA B;  1HAK A;  2D9X A;  2K2J A;  1V5M A;  3AU5 A;  3M1I B;  2QKM A;  4MK0 A;  4CHJ A;  2R0D A;  3D8F A;  2KIE A;  2HYU A;  4QJ4 B;  2Z0Q A;  1J0W A;  1ZSQ A;  2ZKM X;  3ANY A;  2Y8G A;  4HB4 B;  3U8Z A;  4X9P A;  5GOW B;  3A8P A;  3GYO A;  3HIE A;  2XO3 A;  1XX0 A;  1G5N A;  2K2U A;  1LW3 A;  2J0K A;  1S9D E;  3ULB A;  1SGH A;  2DKP A;  3TCA A;  4HB0 B;  2HTH B;  2YVC A;  3T06 A;  1PMS A;  3VIA A;  1X1F A;  5JP4 A;  5D27 A;  1MIZ B;  2GJY A;  4GPT B;  3AO0 A;  1V5U A;  2W2X C;  2HYW A;  4EJN A;  4DBB A;  2OTX A;  1W3W A;  1UNR A;  4KVG B;  3A98 B;  4F7G A;  5CLQ B;  1I2H A;  1OMW A;  2MDX A;  1DBH A;  1NTV A;  5IRS A;  1XD4 A;  3QBV B;  1BC3 A;  4HB3 B;  1BC0 A;  2HYV A;  3DXE A;  5LG4 B;  2RLO A;  1V61 A;  3QWM A;  1WGQ A;  3HJL A;  3ODX A;  1YII A;  1V88 A;  1BCY A;  1E5W A;  3GYP A;  4WSF A;  3B77 A;  2DHJ A;  5C16 A;  2K00 A;  1XCG A;  4MDV A;  1XOD A;  3DCX A;  2ELA A;  1NU2 A;  4DX8 A;  4HAV B;  1BTN A;  4FQ0 C;  2YSZ A;  1QC7 A;  1EVH A;  5HE2 A;  2J0M A;  5HE1 A;  4HAW B;  4HHV A;  3PZD A;  3TFM A;  2I1K A;  2EJ8 A;  2VKI A;  2D9W A;  3NWF A;  1W45 A;  1MIX A;  2KGX B;  4FHR B;  1FOE A;  2DN6 A;  3ZVR A;  2DLW A;  3PSC A;  1X1G A;  4HAT B;  1AQC A;  1YGM A;  1J19 A;  2XO2 A;  4L1R A;  2L2I A;  5L81 A;  1BCW A;  4WVF B;  1W1H A;  1KI1 B;  2RGN B;  3DXD A;  4A5K A;  2DYN A;  1HVF A;  1W1G A;  2D4Q A;  2GCL A;  3U12 A;  1GC6 A;  4K2O A;  2LOX A;  1ALA A;  1C1K A;  1WJ1 A;  4HAU B;  4D0N B;  3NWA A;  2UVM A;  4ZRJ A;  1B55 A;  4C0A A;  1P3R A;  4D7R A;  5HE0 A;  1W7B A;  1PBV A;  4JK1 X;  2I5C A;  1WI1 A;  4MY6 A;  3ODW A;  4MDU A;  2KIG A;  1WJM A;  2LYD A;  4KHA A;  1U5F A;  3MPX A;  3NW8 A;  4ZRI A;  3BJI A;  2HE7 A;  1UPQ A;  1EAZ A;  5D3X A;  1A8B A;  1U27 A;  3KY9 A;  3RCP A;  3MDB C;  5LON B;  5D3V A;  3BRX A;  5KQ1 A;  2OY9 A;  2II2 A;  2I1J A;  2MWN B;  2FJL A;  3IVF A;  5FI0 A;  4IFS A;  1ANX A;  1Y5O A;  1GC7 A;  3TO1 A;  3PVL A;  1SHC A;  3D8D A;  4YL8 A;  3X23 A;  4HB2 B;  1KZ7 A;  2VSZ A;  2G35 A;  4TKN A;  2EMS A;  1HVD A;  1P6S A;  1YJ0 A;  3KRX A;  1BTK A;  4F7U P;  2D11 A;  2GUM A;  4GMV A;  2KCJ A;  1AVH A;  2IE6 A;  3FSS A;  3HK0 A;  2COC A;  2Z4D A;  4XWX A;  1TJ6 A;  1M7R A;  1RRP B;  2RAN A;  1MPH A;  2IIC A;  1UNP A;  2D9Y A;  3U7D A;  1H10 A;  2Z13 A;  2R2Y A;  1M9I A;  5J3Q A;  4KHB B;  3PVW A;  2Y7B A;  2IE7 A;  2Z14 A;  2K6X A;  2GCJ A;  1Z87 A;  4A6H A;  1UPT B;  1BO9 A;  2CY5 A;  3ABQ A;  2RVB B;  1MAI A;  4WJ7 A;  1X11 A;  1HVG A;  4DIX A;  1ANW A;  2N23 A;  1Y19 B;  2DTC A;  3LJU X;  5DH9 B;  1R8S E;  2P0F A;  4HRE A;  3KZ1 A;  1PFJ A;  1OQN A;  2YT2 A;  2CAY A;  4JXH A;  3D8E A;  3SV1 A;  3N7C A;  1LKV X;  1V89 A;  2MKR A;  2Q13 A;  4DX9 0;  4F7H A;  4GNK B;  2LKO A;  1AXN A;  4L5M A;  2P8V A;  4GN1 A;  5JHH A;  5DHF B;  2NZ8 B;  1RE0 B;  1DDV A;  1K5D B;  1AOW A;  4JMO A;  4IOY X;  3UZT A;  2D2Q A;  2W2X D;  4CSQ A;  1AWE A;  3HW2 B;  3ABS A;  1XSZ A;  3PVU A;  2COF A;  1ZM0 A;  2K8E A;  1ANN A;  1FHX A;  1BC1 A;  4Z2M B;  2ROV A;  4HSI A;  4A6K A;  4KMU X;  4DXA B;  2AL6 A;  2ZHI A;  1BC9 A;  4JMI A;  2DX5 A;  2D9Z A;  2YS3 A;  1IRS A;  5FI1 A;  1N00 A;  1UEF A;  3OHM B;  1DDM A;  5C5B A;  3KSY A;  3USY A;  1FB8 A;  4Z2N A;  5HE3 A;  3FM8 C;  1R4A E;  1RJ2 A;  3OAN A;  1N41 A;  3SOH B;  1FGY A;  3G9W A;  4QJ5 B;  2YS5 A;  4QXA B;  3AJC A;  2LUL A;  4GZU A;  5J3Y A;  3ULC A;  2EMT A;  2H7D A;  3CIK A;  2RUK B;  2DFK A;  3FVC A;  1XJL A;  1FAO A;  4GMX B;  2E2X A;  4K2P A;  5CLL B;  4A6F A;  2DA0 A;  1MKE A;  1FHW A;  1DYN A;  2COA A;  2YF0 A;  1NI2 A;  2Z59 A;  1XR0 B;  2DYQ A;  3VOQ A;  4CHM A;  3CXB B;  2H7E A;  2P0D A;  4QJ3 B;  1U5E A;  3SUZ A;  4H8S A;  5JLJ B;  3SO6 A;  4K81 A;  2OQB A;  1QQG A;  5I2M A;  4C7P A;  2KR0 A;  5C79 A;  2DX1 A;  2YRY A;  4EVF A;  2ADZ A;  1XT0 B;  1EF1 A;  1BWN A;  2ROZ B;  2YT0 A;  2DKQ A;  2JP2 A;  1Q8D A;  5DIF B;  1HVE A;  4PQ0 A;  2NMB A;  2UZR A;  1R8M E;  2CRF A;  2VXG A;  2ELB A;  2H0K A;  4HDQ A;  3KRW A;  3F5R A;  3TW5 A;  3QIJ A;  3P7Z A;  3PEG A;  4P7I A;  5D3Y A;  1NTY A;  3ODO A;  2N0Y A;  2J59 M;  4ZRK A;  2PZ1 A;  2UZS A;  1SAV A;  3F0W A;  2HSN A;  1MI1 A;  1TXD A;  2IYB A;  2Z0O A;  3HQC A;  2K49 A;  2DHK A;  1UPR A;  1V5P A;  1M7E A;  4HAY B;  3P6A A;  2Z0P A;  4L6E A;  1P5T A;  5KCV A;  1N42 A;  1TQZ A;  2FJU B;  1ZC3 B;  1K5G B;  4HDO A;  5C6R A;  5I2S A;  1AII A;  3BIN A;  4OT1 A;  1ISN A;  2Y8F A;  4KHB A;  4NY0 A;  3WYF B;  2GS0 A;  1W1D A;  2M14 A;  4EMO A;  1KZG A;  3SWV A;  2H0L A;  1AEI A;  1I4A A;  1FHO A;  2IFS A;  1U5G A;  1U29 A;  1DK5 A;  1A8A A;  2KUP A;  3WA0 A;  4A6F B;  3L8N A;  1MCX A;  1U2B A;  2R09 A;  1X05 A;  4OIY A;  1ZVR A;  1N44 A;  2COD A;  4KN7 X;  1T77 A;  2H0M A;  3ABR A;  1OY2 A;  2YS1 A;  3AU4 A;  4BBK A;  1X86 A;  1PLS A;  2NBV A;  2RSG A;  2QEZ A;  2V76 A;  5J3T A;  3PG7 A;  1WG7 A;  3USW A;  2D10 A;  1DDW A;  2AEH A;  3HSA A;  1ZC4 B;  4KHO A;  2L1C A;  2VRW B;  2M38 A;  5C5B B;  3SNH A;  4OSN A;  3NWD A;  2P0H A;  3TW1 A;  1LB1 A;  4B6H A;  4EKU A;  1KU1 A;  1WVH A;  1WGU A;  4GXB A;  2Q4C A;  3SYX A;  2CY4 A;  1DRO A;  4TYZ A;  2XQN M;  3ZDT A;  4HAZ B;  4Z21 A;  3AJ4 A;  5M4Y B;  1UNQ A;  4JWL A;  3TVV A;  2RNR B;  3V5W A;  5KQ4 A;  1MK9 B;  5LOP B;  2X18 A;  2RRF A; 
#chains in the Genus database with same CATH homology
 2D9V A;  4YON A;  1Q67 A;  4K17 A;  5D3W A;  4PNK A;  2LG1 A;  1GG3 A;  4KN4 X;  2DHI A;  3A8Q A;  5EFX A;  2I5F A;  1EGX A;  1QC6 A;  2BCJ A;  4NSW A;  4IAP A;  1BAK A;  4Y94 A;  3NSU A;  5JHG A;  2MFQ A;  3O96 A;  3PP2 A;  1U5D A;  2LOZ A;  4HAX B;  1I7A A;  3ML4 A;  4CYE A;  1R8Q E;  2QKL A;  4MT7 A;  2W2W A;  3LTL A;  1H4R A;  2EC1 A;  4KAX B;  3DXC A;  2J0J A;  1MK7 B;  1FGZ A;  3FEH A;  5DI9 B;  1XKE A;  2ZPY A;  4D7Q A;  4A4P A;  1N3H A;  2YT1 A;  5DHA B;  2D9X A;  2K2J A;  1V5M A;  3AU5 A;  3M1I B;  2QKM A;  4MK0 A;  4CHJ A;  2R0D A;  3D8F A;  2Z0Q A;  1J0W A;  1ZSQ A;  4HB4 B;  2Y8G A;  3U8Z A;  5GOW B;  3A8P A;  3GYO A;  1XX0 A;  2K2U A;  1LW3 A;  2J0K A;  1S9D E;  3ULB A;  1SGH A;  2DKP A;  3TCA A;  4HB0 B;  2HTH B;  2YVC A;  3T06 A;  1PMS A;  3VIA A;  1X1F A;  5JP4 A;  5D27 A;  1MIZ B;  2GJY A;  4GPT B;  1V5U A;  2W2X C;  4EJN A;  4DBB A;  2OTX A;  1UNR A;  4KVG B;  3A98 B;  4F7G A;  5CLQ B;  1I2H A;  1OMW A;  2MDX A;  1DBH A;  1NTV A;  1XD4 A;  3QBV B;  4HB3 B;  3DXE A;  2RLO A;  1V61 A;  3QWM A;  1WGQ A;  3HJL A;  3ODX A;  1V88 A;  1E5W A;  3GYP A;  4WSF A;  2DHJ A;  5C16 A;  2K00 A;  1XCG A;  1XOD A;  2ELA A;  1NU2 A;  4DX8 A;  4HAV B;  1BTN A;  4FQ0 C;  2YSZ A;  1QC7 A;  1EVH A;  5HE2 A;  2J0M A;  5HE1 A;  4HAW B;  4HHV A;  3PZD A;  3TFM A;  2I1K A;  2EJ8 A;  2VKI A;  2D9W A;  2KGX B;  1MIX A;  4FHR B;  1FOE A;  2DN6 A;  3ZVR A;  2DLW A;  3PSC A;  1X1G A;  4HAT B;  1AQC A;  1J19 A;  2L2I A;  5L81 A;  4WVF B;  1W1H A;  1KI1 B;  2RGN B;  3DXD A;  4A5K A;  2DYN A;  1W1G A;  2D4Q A;  2GCL A;  1GC6 A;  4K2O A;  2LOX A;  1WJ1 A;  4HAU B;  4D0N B;  2UVM A;  4ZRJ A;  1B55 A;  4C0A A;  1P3R A;  4D7R A;  5HE0 A;  1PBV A;  4JK1 X;  2I5C A;  1WI1 A;  4MY6 A;  3ODW A;  1WJM A;  2LYD A;  4KHA A;  1U5F A;  3MPX A;  4ZRI A;  3BJI A;  2HE7 A;  1UPQ A;  1EAZ A;  5D3X A;  3RCP A;  1U27 A;  3KY9 A;  3MDB C;  5LON B;  5D3V A;  5KQ1 A;  2I1J A;  2MWN B;  2FJL A;  3IVF A;  5FI0 A;  4IFS A;  1Y5O A;  1GC7 A;  3TO1 A;  3PVL A;  1SHC A;  3D8D A;  4YL8 A;  3X23 A;  4HB2 B;  1KZ7 A;  2VSZ A;  2G35 A;  4TKN A;  2EMS A;  1P6S A;  3KRX A;  1BTK A;  4F7U P;  2D11 A;  4GMV A;  2KCJ A;  3HK0 A;  3FSS A;  4XWX A;  2COC A;  1TJ6 A;  1M7R A;  1RRP B;  1MPH A;  1UNP A;  2D9Y A;  3U7D A;  1H10 A;  5J3Q A;  4KHB B;  3PVW A;  2Y7B A;  2K6X A;  2GCJ A;  1Z87 A;  4A6H A;  2RVB B;  2CY5 A;  4WJ7 A;  1MAI A;  1X11 A;  2N23 A;  1Y19 B;  2DTC A;  3LJU X;  5DH9 B;  1R8S E;  2P0F A;  3KZ1 A;  1PFJ A;  1OQN A;  2CAY A;  4JXH A;  3D8E A;  3SV1 A;  3N7C A;  1LKV X;  1V89 A;  2MKR A;  2Q13 A;  4DX9 0;  4F7H A;  2LKO A;  4L5M A;  2P8V A;  4GN1 A;  5JHH A;  5DHF B;  2NZ8 B;  1RE0 B;  1DDV A;  1K5D B;  4JMO A;  4IOY X;  3UZT A;  2D2Q A;  2W2X D;  1AWE A;  3HW2 B;  1XSZ A;  3PVU A;  2COF A;  1ZM0 A;  1FHX A;  4Z2M B;  2ROV A;  4A6K A;  4KMU X;  4DXA B;  2AL6 A;  1BC9 A;  4JMI A;  2DX5 A;  2D9Z A;  2YS3 A;  1IRS A;  5FI1 A;  1UEF A;  1DDM A;  5C5B A;  3KSY A;  3USY A;  1FB8 A;  4Z2N A;  5HE3 A;  3FM8 C;  1RJ2 A;  3OAN A;  3SOH B;  1FGY A;  3G9W A;  2YS5 A;  3AJC A;  2LUL A;  4GZU A;  5J3Y A;  3ULC A;  2EMT A;  2H7D A;  3CIK A;  2RUK B;  2DFK A;  1FAO A;  4GMX B;  2E2X A;  4K2P A;  5CLL B;  4A6F A;  2DA0 A;  1MKE A;  1FHW A;  1DYN A;  2COA A;  2YF0 A;  1NI2 A;  3VOQ A;  1XR0 B;  2DYQ A;  4CHM A;  3CXB B;  2H7E A;  2P0D A;  1U5E A;  3SUZ A;  4H8S A;  5JLJ B;  3SO6 A;  4K81 A;  2OQB A;  1QQG A;  4C7P A;  5C79 A;  2DX1 A;  2YRY A;  2ADZ A;  1XT0 B;  1EF1 A;  1BWN A;  2ROZ B;  2YT0 A;  2DKQ A;  2JP2 A;  1Q8D A;  5DIF B;  4PQ0 A;  2NMB A;  2UZR A;  1R8M E;  2CRF A;  2ELB A;  4HDQ A;  3KRW A;  3F5R A;  3TW5 A;  3QIJ A;  3P7Z A;  3PEG A;  4P7I A;  5D3Y A;  1NTY A;  3ODO A;  2N0Y A;  2J59 M;  4ZRK A;  2PZ1 A;  2UZS A;  3F0W A;  2HSN A;  1TXD A;  2IYB A;  2Z0O A;  3HQC A;  2DHK A;  1UPR A;  1V5P A;  1M7E A;  4HAY B;  3P6A A;  2Z0P A;  4L6E A;  1P5T A;  5KCV A;  1TQZ A;  1ZC3 B;  1K5G B;  4HDO A;  5C6R A;  3BIN A;  1ISN A;  2Y8F A;  4NY0 A;  3WYF B;  2GS0 A;  1W1D A;  2M14 A;  4EMO A;  1KZG A;  3SWV A;  1FHO A;  2IFS A;  1U5G A;  1U29 A;  2KUP A;  3WA0 A;  4A6F B;  3L8N A;  1U2B A;  2R09 A;  1X05 A;  4OIY A;  1ZVR A;  2COD A;  4KN7 X;  1OY2 A;  2YS1 A;  3AU4 A;  4BBK A;  1X86 A;  1PLS A;  2RSG A;  2V76 A;  5J3T A;  3PG7 A;  1WG7 A;  3USW A;  2D10 A;  1DDW A;  2AEH A;  4KHO A;  1ZC4 B;  2L1C A;  2VRW B;  2M38 A;  5C5B B;  3SNH A;  2P0H A;  3TW1 A;  1LB1 A;  4B6H A;  4EKU A;  1KU1 A;  1WVH A;  1WGU A;  4GXB A;  3SYX A;  2CY4 A;  1DRO A;  4TYZ A;  2XQN M;  3ZDT A;  4HAZ B;  4Z21 A;  3AJ4 A;  1UNQ A;  4JWL A;  3TVV A;  2RNR B;  3V5W A;  5KQ4 A;  1MK9 B;  5LOP B;  2X18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...