2R09A

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
b'GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-3
molecule tags Signaling protein
source organism Mus musculus
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
total genus 101
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r09A01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r09A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r09A03
4MT7A 3F5RA 2ZPYA 2ELBA 2LOZA 3AJ4A 3KSYA 4WJ7A 2ADZA 4HB4B 4K17A 1H10A 1K5GB 2J0KA 3ULCA 1TXDA 1KU1A 2J0MA 1LB1A 1WVHA 4GN1A 5CLLB 5JHHA 3ODWA 1E5WA 2YS3A 2QKMA 1MPHA 4JXHA 2Y7BA 4ZRJA 1U2BA 4GPTB 3OANA 1V5UA 3KRWA 2DX5A 4K81A 1FHXA 2W2XC 2D9YA 2PZ1A 1V61A 4HATB 2IYBA 2DHJA 1OMWA 3DXCA 2RUKB 1RE0B 4C0AA 2W2XD 3ODXA 3SYXA 4F7UP 4IFSA 4DBBA 2L2IA 4KAXB 4PNKA 1AQCA 1ZM0A 2DX1A 1NI2A 1U5FA 1UEFA 2GS0A 4KHBB 2AL6A 1B55A 1SGHA 2HTHB 4L5MA 2P0FA 2K00A 4GZUA 3WYFB 2D9ZA 5LOPB 2COFA 2EC1A 5JP4A 4BBKA 2P0DA 2P0HA 1SHCA 2D9XA 1DYNA 1XR0B 2COCA 2KUPA 2DTCA 5KCVA 5D3VA 1FGYA 3U8ZA 1Y5OA 1ISNA 1BTKA 2CY5A 1QQGA 1UPRA 4HAWB 3T06A 3HW2B 1NU2A 4HAYB 4HAUB 1UPQA 1XX0A 2L1CA 2RGNB 1XD4A 4D7RA 2LG1A 4A4PA 2DN6A 4HAXB 3PSCA 2G35A 5C5BB 3A8PA 3U7DA 5D27A 3PP2A 3X23A 4A6FB 1MK9B 3SO6A 4MK0A 2UZRA 2LULA 3KRXA 3IVFA 1BWNA 2Q13A 3NSUA 1V5MA 4XWXA 2D9VA 3UZTA 5HE3A 2RNRB 2K2UA 1QC6A 2QKLA 1GG3A 5J3QA 1MAIA 2EMSA 2MDXA 1MIZB 1WJ1A 2X18A 4HHVA 4OIYA 2GJYA 4GMVA 5D3YA 4K2OA 1WG7A 1PLSA 3SNHA 1FAOA 2EMTA 2I1JA 2CRFA 4DXAB 3D8FA 1DDMA 1V89A 3D8DA 5C79A 3TO1A 1V88A 2D2QA 5C16A 3KZ1A 5HE2A 3SWVA 4YL8A 1PFJA 1V5PA 2Z0QA 2CAYA 4JMIA 1WGQA 3N7CA 3ZDTA 3ML4A 4HAVB 2DKQA 2W2WA 4A5KA 1XT0B 2YVCA 3A8QA 4YONA 5DHAB 1WGUA 4H8SA 1UNRA 5GOWB 5FI0A 5J3YA 2Z0OA 1Q67A 1U5EA 1EF1A 1P5TA 4KHOA 1UNPA 1P6SA 2YS1A 1R8SE 3G9WA 4D0NB 1OQNA 1ZSQA 4HDQA 3PVLA 1M7EA 1MIXA 3HK0A 2RSGA 4Z2NA 3P7ZA 1DDVA 1FOEA 1W1GA 4NY0A 5C6RA 4CHMA 1W1DA 2R0DA 3F0WA 2KGXB 4GMXB 2RLOA 2FJLA 2DFKA 2VKIA 1NTYA 3O96A 1AWEA 4ZRIA 1R8QE 2VRWB 2YSZA 3TCAA 2COAA 4EKUA 1X11A 2I1KA 3CXBB 2BCJA 4CYEA 3A98B 2J0JA 2UZSA 3DXDA 5C5BA 4NSWA 4F7GA 2N0YA 2JP2A 4WSFA 1P3RA 4Z2MB 3BJIA 2YT1A 3M1IB 5KQ1A 2YF0A 3SV1A 5EFXA 4A6KA 2J59M 2YT0A 2K2JA 2Y8GA 1NTVA 1KI1B 5CLQB 4EJNA 3FM8C 4KHAA 4A6HA 2R09A 1GC6A 2DYQA 2ROVA 2KCJA 2GCLA 1M7RA 3QWMA 2D4QA 2OQBA 4JMOA 1ZC4B 2AEHA 1DDWA 2LOXA 3QIJA 1KZGA 1LW3A 1OY2A 1TJ6A 1W1HA 2V76A 3RCPA 3PEGA 4B6HA 1XSZA 1K5DB 4EMOA 1Y19B 3D8EA 1FHOA 4DX90 2D10A 2DHKA 5D3XA 2Z0PA 2CY4A 3TVVA 5JLJB 5J3TA 2Y8FA 2DHIA 2NZ8B 5DIFB 4HB0B 1XCGA 1GC7A 1U5GA 4JWLA 4IOYX 1J19A 5DH9B 2YS5A 2DYNA 2EJ8A 1EAZA 1U5DA 4P7IA 4D7QA 1MKEA 1TQZA 1X86A 2DKPA 2D9WA 2IFSA 2I5CA 1MK7B 4HB2B 1J0WA 3PZDA 1EGXA 2LYDA 2I5FA 3MDBC 1ZVRA 3ODOA 2RVBB 1R8ME 4MY6A 3PVUA 2VSZA 3FEHA 1DROA 1FGZA 1DBHA 1KZ7A 1Z87A 4TKNA 2M38A 1FHWA 3ZVRA 3WA0A 3HQCA 4Y94A 1N3HA 3GYOA 4C7PA 4ZRKA 3SUZA 2MKRA 1I7AA 3CIKA 4K2PA 2P8VA 1X05A 1PMSA 1X1FA 4Z21A 2GCJA 2UVMA 2HE7A 2XQNM 2OTXA 1U29A 5HE0A 3AU5A 3MPXA 4CHJA 4WVFB 4GXBA 3LTLA 4HAZB 2DLWA 5JHGA 2H7EA 2M14A 1XKEA 1UNQA 2H7DA 1RJ2A 1EVHA 4F7HA 2ROZB 3DXEA 3TW1A 5LONB 3LJUX 5FI1A 5L81A 2ELAA 1BC9A 5DI9B 1S9DE 4TYZA 4PQ0A 5DHFB 2D11A 2MWNB 5D3WA 1ZC3B 4IAPA 2LKOA 4HB3B 1WI1A 2DA0A 2YRYA 3P6AA 1U27A 4L6EA 2MFQA 3PG7A 4DX8A 3VIAA 3L8NA 2N23A 1IRSA 5KQ4A 3BINA 1H4RA 3ULBA 3VOQA 3PVWA 2NMBA 3QBVB 3KY9A 3TFMA 2E2XA 4KVGB 5HE1A 1BAKA 3V5WA 1XODA 1I2HA 3FSSA 3GYPA 1X1GA 1BTNA 3AU4A 2CODA 4A6FA 1RRPB 1WJMA 1PBVA 1FB8A 4HDOA
chains in the Genus database with same CATH superfamily
4MT7A 3F5RA 2ZPYA 2ELBA 2LOZA 2ZHIA 3AJ4A 1ANXA 3KSYA 4WJ7A 3USYA 2ADZA 4HB4B 4K17A 1H10A 1K5GB 2J0KA 3ULCA 1TXDA 1KU1A 2J0MA 1LB1A 1WVHA 4GN1A 5CLLB 5JHHA 4EVFA 3ODWA 1E5WA 2YS3A 2QKMA 1MPHA 4JXHA 2Y7BA 4ZRJA 1BCWA 1U2BA 4GPTB 5LG4B 3OANA 1V5UA 3KRWA 2DX5A 5I2MA 4K81A 1FHXA 2W2XC 2D9YA 2PZ1A 1V61A 4HATB 2IYBA 2DHJA 1UPTB 1N00A 1OMWA 3DXCA 2RUKB 1RE0B 4C0AA 2W2XD 3ODXA 3SYXA 2NBVA 2K6XA 4F7UP 4IFSA 4DBBA 3OHMB 2L2IA 4KAXB 2KR0A 4PNKA 1I4AA 1AQCA 2QEZA 1ZM0A 2DX1A 1NI2A 1U5FA 1UEFA 2GS0A 4KHBB 2AL6A 1B55A 1SGHA 2HTHB 4CSQA 4L5MA 2P0FA 1HVEA 2HSNA 2K00A 4GZUA 3WYFB 2D9ZA 5LOPB 2COFA 2EC1A 4HSIA 4BBKA 2P0DA 2P0HA 5JP4A 4HREA 1SHCA 4MDVA 2D9XA 1DYNA 1XR0B 2KUQA 2COCA 2KUPA 2DTCA 5KCVA 5D3VA 1FGYA 3U8ZA 1Y5OA 1ISNA 1BTKA 2CY5A 1QQGA 2YT2A 1UPRA 4HAWB 3T06A 3HW2B 1NU2A 4HAYB 2Z4DA 4HAUB 1UPQA 1XX0A 2L1CA 4JK1X 4L1RA 2RGNB 1XD4A 2XO3A 1N41A 4D7RA 2LG1A 4A4PA 2DN6A 4HAXB 3PSCA 2G35A 5C5BB 3A8PA 3U7DA 5D27A 3PP2A 3X23A 4A6FB 1MK9B 3SO6A 4MK0A 1ANWA 3FVCA 2Q4CA 2UZRA 2LULA 3KRXA 3IVFA 1QC7A 1BWNA 4GOUA 2FJUB 2Q13A 3NSUA 1V5MA 4XWXA 2D9VA 4QJ5B 3UZTA 5HE3A 1DK5A 2RNRB 2K2UA 1QC6A 1C1KA 2QKLA 1GG3A 3ABSA 5J3QA 1MAIA 2EMSA 2MDXA 1MIZB 1WJ1A 2X18A 4HHVA 4OIYA 2GJYA 4GMVA 5D3YA 4K2OA 1WG7A 1PLSA 3SNHA 1FAOA 2EMTA 2I1JA 2CRFA 4DXAB 3D8FA 1DDMA 1V89A 3D8DA 2ZHJA 5C79A 3AJCA 3TO1A 1V88A 2HYUA 2D2QA 5C16A 3KZ1A 5HE2A 3SWVA 4YL8A 2H0MA 1PFJA 2K8EA 1AXNA 1W7BA 1V5PA 1AOWA 2Z0QA 2RRFA 2CAYA 4JMIA 3BRXA 1Q8DA 1WGQA 3N7CA 3ZDTA 3B77A 3ML4A 4HAVB 2ZKMX 2DKQA 2W2WA 4A5KA 1XT0B 2YVCA 3A8QA 4YONA 5DHAB 1WGUA 4H8SA 1UNRA 5GOWB 5FI0A 5IRSA 5J3YA 2Z0OA 1Q67A 1U5EA 1T77A 1EF1A 1P5TA 1W3WA 4KHOA 1UNPA 1P6SA 2YS1A 1R8SE 3G9WA 4D0NB 1OQNA 1ZSQA 4HDQA 3PVLA 1M7EA 1MIXA 3HK0A 2RSGA 4Z2NA 1DDVA 1HM6A 1AVRA 1W1GA 1FOEA 2Z14A 3P7ZA 4NY0A 5C6RA 4CHMA 1W1DA 4KMUX 2R0DA 3F0WA 2KGXB 4GMXB 2RLOA 2FJLA 2DFKA 1BCYA 1DM5A 3NWFA 1A8AA 2Z13A 2VKIA 1NTYA 3O96A 1AWEA 4ZRIA 1LKVX 1R8QE 1BC3A 2VRWB 2IE6A 2YSZA 3TCAA 1MI1A 2COAA 4Q2SA 1N42A 1ALAA 4QXAB 4EKUA 2H0KA 1X11A 2I1KA 3CXBB 2BCJA 4CYEA 3A98B 2J0JA 1AIIA 2UZSA 3DXDA 5C5BA 4NSWA 4F7GA 2N0YA 2JP2A 4WSFA 1P3RA 4OSNA 4Z2MB 3BJIA 2YT1A 3M1IB 5KQ1A 2YF0A 4QJ3B 2XO2A 5I2SA 3SV1A 5EFXA 4A6KA 2J59M 2YT0A 2K2JA 2Y8GA 1NTVA 1KI1B 2R2YA 5CLQB 3DCXA 2IE7A 4EJNA 3FM8C 4KHAA 4A6HA 2R09A 1GC6A 2DYQA 2ROVA 2KCJA 2GCLA 1M7RA 3QWMA 2D4QA 4JMOA 1ZC4B 2AEHA 3AO0A 2OQBA 1DDWA 2LOXA 3QIJA 1A8BA 2IICA 1KZGA 1LW3A 1OY2A 1TJ6A 1W1HA 2V76A 3RCPA 3PEGA 1AVHA 3NWAA 4B6HA 1XSZA 1K5DB 4EMOA 1Y19B 3D8EA 1FHOA 4DX90 2K49A 3HJLA 2D10A 2DHKA 4D6WA 5D3XA 2Z0PA 2CY4A 1BC1A 3TVVA 5JLJB 5M4YB 5J3TA 2Y8FA 2DHIA 2NZ8B 5DIFB 4HB0B 1XCGA 1GC7A 1U5GA 4JWLA 4IOYX 1J19A 5DH9B 2YS5A 2DYNA 2EJ8A 1EAZA 3U12A 1U5DA 4P7IA 4D7QA 1MKEA 1TQZA 1X86A 2DKPA 2D9WA 2IFSA 2I5CA 4QJ4B 1MK7B 4HB2B 1W45A 2RANA 1YGMA 1YJ0A 1J0WA 3PZDA 3NW8A 1EGXA 2LYDA 3SOHB 2HYVA 1N44A 1R4AE 1BCZA 2H0LA 2I5FA 3MDBC 2HYWA 3ABRA 1ZVRA 3ODOA 2RVBB 4KN7X 1R8ME 4MY6A 4X9PA 3HIEA 1HVDA 3PVUA 3ABQA 2VSZA 4GNKB 3FEHA 1HVFA 1DROA 1FGZA 1DBHA 1YIIA 1KZ7A 1Z87A 4TKNA 2M38A 2KIEA 1FHWA 3ZVRA 3USWA 3WA0A 1AEIA 1BO9A 3HQCA 1M9IA 4OT1A 4Y94A 1N3HA 3GYOA 4C7PA 4ZRKA 3SUZA 2MKRA 1I7AA 1MCXA 4MDUA 3CIKA 4K2PA 2P8VA 1X05A 1PMSA 1X1FA 4Z21A 2GCJA 2UVMA 2HE7A 2XQNM 2OTXA 1U29A 5HE0A 4KN4X 3AU5A 3MPXA 4CHJA 4WVFB 4GXBA 3HSAA 4EVHA 3LTLA 4HAZB 3NWDA 2DLWA 5JHGA 2H7EA 2M14A 3A58A 1XKEA 1UNQA 2H7DA 1RJ2A 1EVHA 4F7HA 2KIGA 2ROZB 3DXEA 3TW1A 5LONB 3LJUX 5FI1A 5L81A 2ELAA 2II2A 1BC9A 5DI9B 2Z59A 2OY9A 1S9DE 4TYZA 4DIXA 4PQ0A 5DHFB 4KHBA 2D11A 2MWNB 5D3WA 1BC0A 1ZC3B 4IAPA 1HVGA 2LKOA 4HB3B 4FHRB 1WI1A 2DA0A 2YRYA 3P6AA 1XJLA 1U27A 4L6EA 2MFQA 3PG7A 4DX8A 3VIAA 1SAVA 3L8NA 4FQ0C 2N23A 1IRSA 5KQ4A 3BINA 1H4RA 3ULBA 3VOQA 3ANYA 1AVCA 1YCNA 3PVWA 2GUMA 3TW5A 1ZYIA 2NMBA 3QBVB 3KY9A 3TFMA 2E2XA 4KVGB 5HE1A 1BAKA 2ZOCA 3V5WA 1XODA 1I2HA 1ANNA 3FSSA 3GYPA 2VXGA 1X1GA 3ABOA 1BTNA 3AU4A 2CODA 4A6FA 1G5NA 1RRPB 1WJMA 1HAKA 1PBVA 1FB8A 4HDOA
chains in the Genus database with same CATH topology
4MT7A 3F5RA 2ZPYA 2ELBA 2LOZA 3AJ4A 3KSYA 4WJ7A 3USYA 2ADZA 4HB4B 4K17A 1H10A 1K5GB 2J0KA 3ULCA 1TXDA 1KU1A 2J0MA 1LB1A 1WVHA 4GN1A 5CLLB 5JHHA 3ODWA 1E5WA 2YS3A 2QKMA 1MPHA 4JXHA 2Y7BA 4ZRJA 1U2BA 4GPTB 3OANA 1V5UA 3KRWA 2DX5A 4K81A 1FHXA 2W2XC 2D9YA 2PZ1A 1V61A 4HATB 2IYBA 2DHJA 1OMWA 3DXCA 2RUKB 1RE0B 4C0AA 2W2XD 3ODXA 3SYXA 2K6XA 4F7UP 4IFSA 4DBBA 2L2IA 4KAXB 4PNKA 1AQCA 1ZM0A 2DX1A 1NI2A 1U5FA 1UEFA 2GS0A 4KHBB 2AL6A 1B55A 1SGHA 2HTHB 4L5MA 2P0FA 2K00A 2HSNA 4GZUA 3WYFB 2D9ZA 5LOPB 2COFA 2EC1A 5JP4A 4BBKA 2P0DA 2P0HA 1SHCA 2D9XA 1DYNA 1XR0B 2COCA 2KUPA 2DTCA 5KCVA 5D3VA 1FGYA 3U8ZA 1Y5OA 1ISNA 1BTKA 2CY5A 1QQGA 1UPRA 4HAWB 3T06A 3HW2B 1NU2A 4HAYB 4HAUB 1UPQA 1XX0A 2L1CA 4JK1X 2RGNB 1XD4A 4D7RA 2LG1A 4A4PA 2DN6A 4HAXB 3PSCA 2G35A 5C5BB 3A8PA 3U7DA 5D27A 3PP2A 3X23A 4A6FB 1MK9B 3SO6A 4MK0A 2UZRA 2LULA 3KRXA 3IVFA 1QC7A 1BWNA 2Q13A 3NSUA 1V5MA 4XWXA 2D9VA 3UZTA 5HE3A 2RNRB 2K2UA 1QC6A 2QKLA 1GG3A 5J3QA 1MAIA 2EMSA 2MDXA 1MIZB 1WJ1A 2X18A 4HHVA 4OIYA 2GJYA 4GMVA 5D3YA 4K2OA 1WG7A 1PLSA 3SNHA 1FAOA 2EMTA 2I1JA 2CRFA 4DXAB 3D8FA 1DDMA 1V89A 3D8DA 5C79A 3AJCA 3TO1A 1V88A 2D2QA 5C16A 3KZ1A 5HE2A 3SWVA 4YL8A 1PFJA 1V5PA 2Z0QA 2CAYA 4JMIA 1Q8DA 1WGQA 3N7CA 3ZDTA 3ML4A 4HAVB 2DKQA 2W2WA 4A5KA 1XT0B 2YVCA 3A8QA 4YONA 5DHAB 1WGUA 4H8SA 1UNRA 5GOWB 5FI0A 5J3YA 2Z0OA 1Q67A 1U5EA 1EF1A 1P5TA 4KHOA 1UNPA 1P6SA 2YS1A 1R8SE 3G9WA 4D0NB 1OQNA 1ZSQA 4HDQA 3PVLA 1M7EA 1MIXA 3HK0A 2RSGA 4Z2NA 1DDVA 3P7ZA 1FOEA 1W1GA 4NY0A 5C6RA 4CHMA 1W1DA 4KMUX 2R0DA 3F0WA 2KGXB 4GMXB 2RLOA 2FJLA 2DFKA 2VKIA 1NTYA 3O96A 1AWEA 4ZRIA 1LKVX 1R8QE 2VRWB 2YSZA 3TCAA 2COAA 4EKUA 1X11A 2I1KA 3CXBB 2BCJA 4CYEA 3A98B 2J0JA 2UZSA 3DXDA 5C5BA 4NSWA 4F7GA 2N0YA 2JP2A 4WSFA 1P3RA 4Z2MB 3BJIA 2YT1A 3M1IB 5KQ1A 2YF0A 3SV1A 5EFXA 4A6KA 2J59M 2YT0A 2K2JA 2Y8GA 1NTVA 1KI1B 5CLQB 4EJNA 3FM8C 4KHAA 4A6HA 2R09A 1GC6A 2DYQA 2ROVA 2KCJA 2GCLA 1M7RA 3QWMA 2D4QA 2OQBA 4JMOA 1ZC4B 2AEHA 1DDWA 2LOXA 3QIJA 1KZGA 1LW3A 1OY2A 1TJ6A 1W1HA 2V76A 3RCPA 3PEGA 4B6HA 1XSZA 1K5DB 4EMOA 1Y19B 3D8EA 1FHOA 4DX90 3HJLA 2D10A 2DHKA 5D3XA 2Z0PA 2CY4A 3TVVA 5JLJB 5J3TA 2Y8FA 2DHIA 2NZ8B 5DIFB 4HB0B 1XCGA 1GC7A 1U5GA 4JWLA 4IOYX 1J19A 5DH9B 2YS5A 2DYNA 2EJ8A 1EAZA 1U5DA 4P7IA 4D7QA 1MKEA 1TQZA 1X86A 2DKPA 2D9WA 2IFSA 2I5CA 1MK7B 4HB2B 1J0WA 3PZDA 1EGXA 2LYDA 3SOHB 2I5FA 3MDBC 1ZVRA 3ODOA 2RVBB 4KN7X 1R8ME 4MY6A 3PVUA 2VSZA 3FEHA 1DROA 1FGZA 1DBHA 1KZ7A 1Z87A 4TKNA 2M38A 1FHWA 3ZVRA 3USWA 3WA0A 3HQCA 4Y94A 1N3HA 3GYOA 4C7PA 4ZRKA 3SUZA 2MKRA 1I7AA 3CIKA 4K2PA 2P8VA 1X05A 1PMSA 1X1FA 4Z21A 2GCJA 2UVMA 2HE7A 2XQNM 2OTXA 1U29A 5HE0A 4KN4X 3AU5A 3MPXA 4CHJA 4WVFB 4GXBA 3LTLA 4HAZB 2DLWA 5JHGA 2H7EA 2M14A 1XKEA 1UNQA 2H7DA 1RJ2A 1EVHA 4F7HA 2ROZB 3DXEA 3TW1A 5LONB 3LJUX 5FI1A 5L81A 2ELAA 1BC9A 5DI9B 1S9DE 4TYZA 4PQ0A 5DHFB 2D11A 2MWNB 5D3WA 1ZC3B 4IAPA 2LKOA 4HB3B 4FHRB 1WI1A 2DA0A 2YRYA 3P6AA 1U27A 4L6EA 2MFQA 3PG7A 4DX8A 3VIAA 3L8NA 4FQ0C 2N23A 1IRSA 5KQ4A 3BINA 1H4RA 3ULBA 3VOQA 3PVWA 3TW5A 2NMBA 3QBVB 3KY9A 3TFMA 2E2XA 4KVGB 5HE1A 1BAKA 3V5WA 1XODA 1I2HA 3FSSA 3GYPA 1X1GA 1BTNA 3AU4A 2CODA 4A6FA 1RRPB 1WJMA 1PBVA 1FB8A 4HDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT7 A;  3F5R A;  2ZPY A;  2ELB A;  2LOZ A;  3AJ4 A;  3KSY A;  4WJ7 A;  2ADZ A;  4HB4 B;  4K17 A;  1H10 A;  1K5G B;  2J0K A;  3ULC A;  1TXD A;  1KU1 A;  2J0M A;  1LB1 A;  1WVH A;  4GN1 A;  5CLL B;  5JHH A;  3ODW A;  1E5W A;  2YS3 A;  2QKM A;  1MPH A;  4JXH A;  2Y7B A;  4ZRJ A;  1U2B A;  4GPT B;  3OAN A;  1V5U A;  3KRW A;  2DX5 A;  4K81 A;  1FHX A;  2W2X C;  2D9Y A;  2PZ1 A;  1V61 A;  4HAT B;  2IYB A;  2DHJ A;  1OMW A;  3DXC A;  2RUK B;  1RE0 B;  4C0A A;  2W2X D;  3ODX A;  3SYX A;  4F7U P;  4IFS A;  4DBB A;  2L2I A;  4KAX B;  4PNK A;  1AQC A;  1ZM0 A;  2DX1 A;  1NI2 A;  1U5F A;  1UEF A;  2GS0 A;  4KHB B;  2AL6 A;  1B55 A;  1SGH A;  2HTH B;  4L5M A;  2P0F A;  2K00 A;  4GZU A;  3WYF B;  2D9Z A;  5LOP B;  2COF A;  2EC1 A;  5JP4 A;  4BBK A;  2P0D A;  2P0H A;  1SHC A;  2D9X A;  1DYN A;  1XR0 B;  2COC A;  2KUP A;  2DTC A;  5KCV A;  5D3V A;  1FGY A;  3U8Z A;  1Y5O A;  1ISN A;  1BTK A;  2CY5 A;  1QQG A;  1UPR A;  4HAW B;  3T06 A;  3HW2 B;  1NU2 A;  4HAY B;  4HAU B;  1UPQ A;  1XX0 A;  2L1C A;  2RGN B;  1XD4 A;  4D7R A;  2LG1 A;  4A4P A;  2DN6 A;  4HAX B;  3PSC A;  2G35 A;  5C5B B;  3A8P A;  3U7D A;  5D27 A;  3PP2 A;  3X23 A;  4A6F B;  1MK9 B;  3SO6 A;  4MK0 A;  2UZR A;  2LUL A;  3KRX A;  3IVF A;  1BWN A;  2Q13 A;  3NSU A;  1V5M A;  4XWX A;  2D9V A;  3UZT A;  5HE3 A;  2RNR B;  2K2U A;  1QC6 A;  2QKL A;  1GG3 A;  5J3Q A;  1MAI A;  2EMS A;  2MDX A;  1MIZ B;  1WJ1 A;  2X18 A;  4HHV A;  4OIY A;  2GJY A;  4GMV A;  5D3Y A;  4K2O A;  1WG7 A;  1PLS A;  3SNH A;  1FAO A;  2EMT A;  2I1J A;  2CRF A;  4DXA B;  3D8F A;  1DDM A;  1V89 A;  3D8D A;  5C79 A;  3TO1 A;  1V88 A;  2D2Q A;  5C16 A;  3KZ1 A;  5HE2 A;  3SWV A;  4YL8 A;  1PFJ A;  1V5P A;  2Z0Q A;  2CAY A;  4JMI A;  1WGQ A;  3N7C A;  3ZDT A;  3ML4 A;  4HAV B;  2DKQ A;  2W2W A;  4A5K A;  1XT0 B;  2YVC A;  3A8Q A;  4YON A;  5DHA B;  1WGU A;  4H8S A;  1UNR A;  5GOW B;  5FI0 A;  5J3Y A;  2Z0O A;  1Q67 A;  1U5E A;  1EF1 A;  1P5T A;  4KHO A;  1UNP A;  1P6S A;  2YS1 A;  1R8S E;  3G9W A;  4D0N B;  1OQN A;  1ZSQ A;  4HDQ A;  3PVL A;  1M7E A;  1MIX A;  3HK0 A;  2RSG A;  4Z2N A;  3P7Z A;  1DDV A;  1FOE A;  1W1G A;  4NY0 A;  5C6R A;  4CHM A;  1W1D A;  2R0D A;  3F0W A;  2KGX B;  4GMX B;  2RLO A;  2FJL A;  2DFK A;  2VKI A;  1NTY A;  3O96 A;  1AWE A;  4ZRI A;  1R8Q E;  2VRW B;  2YSZ A;  3TCA A;  2COA A;  4EKU A;  1X11 A;  2I1K A;  3CXB B;  2BCJ A;  4CYE A;  3A98 B;  2J0J A;  2UZS A;  3DXD A;  5C5B A;  4NSW A;  4F7G A;  2N0Y A;  2JP2 A;  4WSF A;  1P3R A;  4Z2M B;  3BJI A;  2YT1 A;  3M1I B;  5KQ1 A;  2YF0 A;  3SV1 A;  5EFX A;  4A6K A;  2J59 M;  2YT0 A;  2K2J A;  2Y8G A;  1NTV A;  1KI1 B;  5CLQ B;  4EJN A;  3FM8 C;  4KHA A;  4A6H A;  2R09 A;  1GC6 A;  2DYQ A;  2ROV A;  2KCJ A;  2GCL A;  1M7R A;  3QWM A;  2D4Q A;  2OQB A;  4JMO A;  1ZC4 B;  2AEH A;  1DDW A;  2LOX A;  3QIJ A;  1KZG A;  1LW3 A;  1OY2 A;  1TJ6 A;  1W1H A;  2V76 A;  3RCP A;  3PEG A;  4B6H A;  1XSZ A;  1K5D B;  4EMO A;  1Y19 B;  3D8E A;  1FHO A;  4DX9 0;  2D10 A;  2DHK A;  5D3X A;  2Z0P A;  2CY4 A;  3TVV A;  5JLJ B;  5J3T A;  2Y8F A;  2DHI A;  2NZ8 B;  5DIF B;  4HB0 B;  1XCG A;  1GC7 A;  1U5G A;  4JWL A;  4IOY X;  1J19 A;  5DH9 B;  2YS5 A;  2DYN A;  2EJ8 A;  1EAZ A;  1U5D A;  4P7I A;  4D7Q A;  1MKE A;  1TQZ A;  1X86 A;  2DKP A;  2D9W A;  2IFS A;  2I5C A;  1MK7 B;  4HB2 B;  1J0W A;  3PZD A;  1EGX A;  2LYD A;  2I5F A;  3MDB C;  1ZVR A;  3ODO A;  2RVB B;  1R8M E;  4MY6 A;  3PVU A;  2VSZ A;  3FEH A;  1DRO A;  1FGZ A;  1DBH A;  1KZ7 A;  1Z87 A;  4TKN A;  2M38 A;  1FHW A;  3ZVR A;  3WA0 A;  3HQC A;  4Y94 A;  1N3H A;  3GYO A;  4C7P A;  4ZRK A;  3SUZ A;  2MKR A;  1I7A A;  3CIK A;  4K2P A;  2P8V A;  1X05 A;  1PMS A;  1X1F A;  4Z21 A;  2GCJ A;  2UVM A;  2HE7 A;  2XQN M;  2OTX A;  1U29 A;  5HE0 A;  3AU5 A;  3MPX A;  4CHJ A;  4WVF B;  4GXB A;  3LTL A;  4HAZ B;  2DLW A;  5JHG A;  2H7E A;  2M14 A;  1XKE A;  1UNQ A;  2H7D A;  1RJ2 A;  1EVH A;  4F7H A;  2ROZ B;  3DXE A;  3TW1 A;  5LON B;  3LJU X;  5FI1 A;  5L81 A;  2ELA A;  1BC9 A;  5DI9 B;  1S9D E;  4TYZ A;  4PQ0 A;  5DHF B;  2D11 A;  2MWN B;  5D3W A;  1ZC3 B;  4IAP A;  2LKO A;  4HB3 B;  1WI1 A;  2DA0 A;  2YRY A;  3P6A A;  1U27 A;  4L6E A;  2MFQ A;  3PG7 A;  4DX8 A;  3VIA A;  3L8N A;  2N23 A;  1IRS A;  5KQ4 A;  3BIN A;  1H4R A;  3ULB A;  3VOQ A;  3PVW A;  2NMB A;  3QBV B;  3KY9 A;  3TFM A;  2E2X A;  4KVG B;  5HE1 A;  1BAK A;  3V5W A;  1XOD A;  1I2H A;  3FSS A;  3GYP A;  1X1G A;  1BTN A;  3AU4 A;  2COD A;  4A6F A;  1RRP B;  1WJM A;  1PBV A;  1FB8 A;  4HDO A; 
#chains in the Genus database with same CATH topology
 4MT7 A;  3F5R A;  2ZPY A;  2ELB A;  2LOZ A;  2ZHI A;  3AJ4 A;  1ANX A;  3KSY A;  4WJ7 A;  3USY A;  2ADZ A;  4HB4 B;  4K17 A;  1H10 A;  1K5G B;  2J0K A;  3ULC A;  1TXD A;  1KU1 A;  2J0M A;  1LB1 A;  1WVH A;  4GN1 A;  5CLL B;  5JHH A;  4EVF A;  3ODW A;  1E5W A;  2YS3 A;  2QKM A;  1MPH A;  4JXH A;  2Y7B A;  4ZRJ A;  1BCW A;  1U2B A;  4GPT B;  5LG4 B;  3OAN A;  1V5U A;  3KRW A;  2DX5 A;  5I2M A;  4K81 A;  1FHX A;  2W2X C;  2D9Y A;  2PZ1 A;  1V61 A;  4HAT B;  2IYB A;  2DHJ A;  1UPT B;  1N00 A;  1OMW A;  3DXC A;  2RUK B;  1RE0 B;  4C0A A;  2W2X D;  3ODX A;  3SYX A;  2NBV A;  2K6X A;  4F7U P;  4IFS A;  4DBB A;  3OHM B;  2L2I A;  4KAX B;  2KR0 A;  4PNK A;  1I4A A;  1AQC A;  2QEZ A;  1ZM0 A;  2DX1 A;  1NI2 A;  1U5F A;  1UEF A;  2GS0 A;  4KHB B;  2AL6 A;  1B55 A;  1SGH A;  2HTH B;  4CSQ A;  4L5M A;  2P0F A;  1HVE A;  2HSN A;  2K00 A;  4GZU A;  3WYF B;  2D9Z A;  5LOP B;  2COF A;  2EC1 A;  4HSI A;  4BBK A;  2P0D A;  2P0H A;  5JP4 A;  4HRE A;  1SHC A;  4MDV A;  2D9X A;  1DYN A;  1XR0 B;  2KUQ A;  2COC A;  2KUP A;  2DTC A;  5KCV A;  5D3V A;  1FGY A;  3U8Z A;  1Y5O A;  1ISN A;  1BTK A;  2CY5 A;  1QQG A;  2YT2 A;  1UPR A;  4HAW B;  3T06 A;  3HW2 B;  1NU2 A;  4HAY B;  2Z4D A;  4HAU B;  1UPQ A;  1XX0 A;  2L1C A;  4JK1 X;  4L1R A;  2RGN B;  1XD4 A;  2XO3 A;  1N41 A;  4D7R A;  2LG1 A;  4A4P A;  2DN6 A;  4HAX B;  3PSC A;  2G35 A;  5C5B B;  3A8P A;  3U7D A;  5D27 A;  3PP2 A;  3X23 A;  4A6F B;  1MK9 B;  3SO6 A;  4MK0 A;  1ANW A;  3FVC A;  2Q4C A;  2UZR A;  2LUL A;  3KRX A;  3IVF A;  1QC7 A;  1BWN A;  4GOU A;  2FJU B;  2Q13 A;  3NSU A;  1V5M A;  4XWX A;  2D9V A;  4QJ5 B;  3UZT A;  5HE3 A;  1DK5 A;  2RNR B;  2K2U A;  1QC6 A;  1C1K A;  2QKL A;  1GG3 A;  3ABS A;  5J3Q A;  1MAI A;  2EMS A;  2MDX A;  1MIZ B;  1WJ1 A;  2X18 A;  4HHV A;  4OIY A;  2GJY A;  4GMV A;  5D3Y A;  4K2O A;  1WG7 A;  1PLS A;  3SNH A;  1FAO A;  2EMT A;  2I1J A;  2CRF A;  4DXA B;  3D8F A;  1DDM A;  1V89 A;  3D8D A;  2ZHJ A;  5C79 A;  3AJC A;  3TO1 A;  1V88 A;  2HYU A;  2D2Q A;  5C16 A;  3KZ1 A;  5HE2 A;  3SWV A;  4YL8 A;  2H0M A;  1PFJ A;  2K8E A;  1AXN A;  1W7B A;  1V5P A;  1AOW A;  2Z0Q A;  2RRF A;  2CAY A;  4JMI A;  3BRX A;  1Q8D A;  1WGQ A;  3N7C A;  3ZDT A;  3B77 A;  3ML4 A;  4HAV B;  2ZKM X;  2DKQ A;  2W2W A;  4A5K A;  1XT0 B;  2YVC A;  3A8Q A;  4YON A;  5DHA B;  1WGU A;  4H8S A;  1UNR A;  5GOW B;  5FI0 A;  5IRS A;  5J3Y A;  2Z0O A;  1Q67 A;  1U5E A;  1T77 A;  1EF1 A;  1P5T A;  1W3W A;  4KHO A;  1UNP A;  1P6S A;  2YS1 A;  1R8S E;  3G9W A;  4D0N B;  1OQN A;  1ZSQ A;  4HDQ A;  3PVL A;  1M7E A;  1MIX A;  3HK0 A;  2RSG A;  4Z2N A;  1DDV A;  1HM6 A;  1AVR A;  1W1G A;  1FOE A;  2Z14 A;  3P7Z A;  4NY0 A;  5C6R A;  4CHM A;  1W1D A;  4KMU X;  2R0D A;  3F0W A;  2KGX B;  4GMX B;  2RLO A;  2FJL A;  2DFK A;  1BCY A;  1DM5 A;  3NWF A;  1A8A A;  2Z13 A;  2VKI A;  1NTY A;  3O96 A;  1AWE A;  4ZRI A;  1LKV X;  1R8Q E;  1BC3 A;  2VRW B;  2IE6 A;  2YSZ A;  3TCA A;  1MI1 A;  2COA A;  4Q2S A;  1N42 A;  1ALA A;  4QXA B;  4EKU A;  2H0K A;  1X11 A;  2I1K A;  3CXB B;  2BCJ A;  4CYE A;  3A98 B;  2J0J A;  1AII A;  2UZS A;  3DXD A;  5C5B A;  4NSW A;  4F7G A;  2N0Y A;  2JP2 A;  4WSF A;  1P3R A;  4OSN A;  4Z2M B;  3BJI A;  2YT1 A;  3M1I B;  5KQ1 A;  2YF0 A;  4QJ3 B;  2XO2 A;  5I2S A;  3SV1 A;  5EFX A;  4A6K A;  2J59 M;  2YT0 A;  2K2J A;  2Y8G A;  1NTV A;  1KI1 B;  2R2Y A;  5CLQ B;  3DCX A;  2IE7 A;  4EJN A;  3FM8 C;  4KHA A;  4A6H A;  2R09 A;  1GC6 A;  2DYQ A;  2ROV A;  2KCJ A;  2GCL A;  1M7R A;  3QWM A;  2D4Q A;  4JMO A;  1ZC4 B;  2AEH A;  3AO0 A;  2OQB A;  1DDW A;  2LOX A;  3QIJ A;  1A8B A;  2IIC A;  1KZG A;  1LW3 A;  1OY2 A;  1TJ6 A;  1W1H A;  2V76 A;  3RCP A;  3PEG A;  1AVH A;  3NWA A;  4B6H A;  1XSZ A;  1K5D B;  4EMO A;  1Y19 B;  3D8E A;  1FHO A;  4DX9 0;  2K49 A;  3HJL A;  2D10 A;  2DHK A;  4D6W A;  5D3X A;  2Z0P A;  2CY4 A;  1BC1 A;  3TVV A;  5JLJ B;  5M4Y B;  5J3T A;  2Y8F A;  2DHI A;  2NZ8 B;  5DIF B;  4HB0 B;  1XCG A;  1GC7 A;  1U5G A;  4JWL A;  4IOY X;  1J19 A;  5DH9 B;  2YS5 A;  2DYN A;  2EJ8 A;  1EAZ A;  3U12 A;  1U5D A;  4P7I A;  4D7Q A;  1MKE A;  1TQZ A;  1X86 A;  2DKP A;  2D9W A;  2IFS A;  2I5C A;  4QJ4 B;  1MK7 B;  4HB2 B;  1W45 A;  2RAN A;  1YGM A;  1YJ0 A;  1J0W A;  3PZD A;  3NW8 A;  1EGX A;  2LYD A;  3SOH B;  2HYV A;  1N44 A;  1R4A E;  1BCZ A;  2H0L A;  2I5F A;  3MDB C;  2HYW A;  3ABR A;  1ZVR A;  3ODO A;  2RVB B;  4KN7 X;  1R8M E;  4MY6 A;  4X9P A;  3HIE A;  1HVD A;  3PVU A;  3ABQ A;  2VSZ A;  4GNK B;  3FEH A;  1HVF A;  1DRO A;  1FGZ A;  1DBH A;  1YII A;  1KZ7 A;  1Z87 A;  4TKN A;  2M38 A;  2KIE A;  1FHW A;  3ZVR A;  3USW A;  3WA0 A;  1AEI A;  1BO9 A;  3HQC A;  1M9I A;  4OT1 A;  4Y94 A;  1N3H A;  3GYO A;  4C7P A;  4ZRK A;  3SUZ A;  2MKR A;  1I7A A;  1MCX A;  4MDU A;  3CIK A;  4K2P A;  2P8V A;  1X05 A;  1PMS A;  1X1F A;  4Z21 A;  2GCJ A;  2UVM A;  2HE7 A;  2XQN M;  2OTX A;  1U29 A;  5HE0 A;  4KN4 X;  3AU5 A;  3MPX A;  4CHJ A;  4WVF B;  4GXB A;  3HSA A;  4EVH A;  3LTL A;  4HAZ B;  3NWD A;  2DLW A;  5JHG A;  2H7E A;  2M14 A;  3A58 A;  1XKE A;  1UNQ A;  2H7D A;  1RJ2 A;  1EVH A;  4F7H A;  2KIG A;  2ROZ B;  3DXE A;  3TW1 A;  5LON B;  3LJU X;  5FI1 A;  5L81 A;  2ELA A;  2II2 A;  1BC9 A;  5DI9 B;  2Z59 A;  2OY9 A;  1S9D E;  4TYZ A;  4DIX A;  4PQ0 A;  5DHF B;  4KHB A;  2D11 A;  2MWN B;  5D3W A;  1BC0 A;  1ZC3 B;  4IAP A;  1HVG A;  2LKO A;  4HB3 B;  4FHR B;  1WI1 A;  2DA0 A;  2YRY A;  3P6A A;  1XJL A;  1U27 A;  4L6E A;  2MFQ A;  3PG7 A;  4DX8 A;  3VIA A;  1SAV A;  3L8N A;  4FQ0 C;  2N23 A;  1IRS A;  5KQ4 A;  3BIN A;  1H4R A;  3ULB A;  3VOQ A;  3ANY A;  1AVC A;  1YCN A;  3PVW A;  2GUM A;  3TW5 A;  1ZYI A;  2NMB A;  3QBV B;  3KY9 A;  3TFM A;  2E2X A;  4KVG B;  5HE1 A;  1BAK A;  2ZOC A;  3V5W A;  1XOD A;  1I2H A;  1ANN A;  3FSS A;  3GYP A;  2VXG A;  1X1G A;  3ABO A;  1BTN A;  3AU4 A;  2COD A;  4A6F A;  1G5N A;  1RRP B;  1WJM A;  1HAK A;  1PBV A;  1FB8 A;  4HDO A; 
#chains in the Genus database with same CATH homology
 4MT7 A;  3F5R A;  2ZPY A;  2ELB A;  2LOZ A;  3AJ4 A;  3KSY A;  4WJ7 A;  3USY A;  2ADZ A;  4HB4 B;  4K17 A;  1H10 A;  1K5G B;  2J0K A;  3ULC A;  1TXD A;  1KU1 A;  2J0M A;  1LB1 A;  1WVH A;  4GN1 A;  5CLL B;  5JHH A;  3ODW A;  1E5W A;  2YS3 A;  2QKM A;  1MPH A;  4JXH A;  2Y7B A;  4ZRJ A;  1U2B A;  4GPT B;  3OAN A;  1V5U A;  3KRW A;  2DX5 A;  4K81 A;  1FHX A;  2W2X C;  2D9Y A;  2PZ1 A;  1V61 A;  4HAT B;  2IYB A;  2DHJ A;  1OMW A;  3DXC A;  2RUK B;  1RE0 B;  4C0A A;  2W2X D;  3ODX A;  3SYX A;  2K6X A;  4F7U P;  4IFS A;  4DBB A;  2L2I A;  4KAX B;  4PNK A;  1AQC A;  1ZM0 A;  2DX1 A;  1NI2 A;  1U5F A;  1UEF A;  2GS0 A;  4KHB B;  2AL6 A;  1B55 A;  1SGH A;  2HTH B;  4L5M A;  2P0F A;  2K00 A;  2HSN A;  4GZU A;  3WYF B;  2D9Z A;  5LOP B;  2COF A;  2EC1 A;  5JP4 A;  4BBK A;  2P0D A;  2P0H A;  1SHC A;  2D9X A;  1DYN A;  1XR0 B;  2COC A;  2KUP A;  2DTC A;  5KCV A;  5D3V A;  1FGY A;  3U8Z A;  1Y5O A;  1ISN A;  1BTK A;  2CY5 A;  1QQG A;  1UPR A;  4HAW B;  3T06 A;  3HW2 B;  1NU2 A;  4HAY B;  4HAU B;  1UPQ A;  1XX0 A;  2L1C A;  4JK1 X;  2RGN B;  1XD4 A;  4D7R A;  2LG1 A;  4A4P A;  2DN6 A;  4HAX B;  3PSC A;  2G35 A;  5C5B B;  3A8P A;  3U7D A;  5D27 A;  3PP2 A;  3X23 A;  4A6F B;  1MK9 B;  3SO6 A;  4MK0 A;  2UZR A;  2LUL A;  3KRX A;  3IVF A;  1QC7 A;  1BWN A;  2Q13 A;  3NSU A;  1V5M A;  4XWX A;  2D9V A;  3UZT A;  5HE3 A;  2RNR B;  2K2U A;  1QC6 A;  2QKL A;  1GG3 A;  5J3Q A;  1MAI A;  2EMS A;  2MDX A;  1MIZ B;  1WJ1 A;  2X18 A;  4HHV A;  4OIY A;  2GJY A;  4GMV A;  5D3Y A;  4K2O A;  1WG7 A;  1PLS A;  3SNH A;  1FAO A;  2EMT A;  2I1J A;  2CRF A;  4DXA B;  3D8F A;  1DDM A;  1V89 A;  3D8D A;  5C79 A;  3AJC A;  3TO1 A;  1V88 A;  2D2Q A;  5C16 A;  3KZ1 A;  5HE2 A;  3SWV A;  4YL8 A;  1PFJ A;  1V5P A;  2Z0Q A;  2CAY A;  4JMI A;  1Q8D A;  1WGQ A;  3N7C A;  3ZDT A;  3ML4 A;  4HAV B;  2DKQ A;  2W2W A;  4A5K A;  1XT0 B;  2YVC A;  3A8Q A;  4YON A;  5DHA B;  1WGU A;  4H8S A;  1UNR A;  5GOW B;  5FI0 A;  5J3Y A;  2Z0O A;  1Q67 A;  1U5E A;  1EF1 A;  1P5T A;  4KHO A;  1UNP A;  1P6S A;  2YS1 A;  1R8S E;  3G9W A;  4D0N B;  1OQN A;  1ZSQ A;  4HDQ A;  3PVL A;  1M7E A;  1MIX A;  3HK0 A;  2RSG A;  4Z2N A;  1DDV A;  3P7Z A;  1FOE A;  1W1G A;  4NY0 A;  5C6R A;  4CHM A;  1W1D A;  4KMU X;  2R0D A;  3F0W A;  2KGX B;  4GMX B;  2RLO A;  2FJL A;  2DFK A;  2VKI A;  1NTY A;  3O96 A;  1AWE A;  4ZRI A;  1LKV X;  1R8Q E;  2VRW B;  2YSZ A;  3TCA A;  2COA A;  4EKU A;  1X11 A;  2I1K A;  3CXB B;  2BCJ A;  4CYE A;  3A98 B;  2J0J A;  2UZS A;  3DXD A;  5C5B A;  4NSW A;  4F7G A;  2N0Y A;  2JP2 A;  4WSF A;  1P3R A;  4Z2M B;  3BJI A;  2YT1 A;  3M1I B;  5KQ1 A;  2YF0 A;  3SV1 A;  5EFX A;  4A6K A;  2J59 M;  2YT0 A;  2K2J A;  2Y8G A;  1NTV A;  1KI1 B;  5CLQ B;  4EJN A;  3FM8 C;  4KHA A;  4A6H A;  2R09 A;  1GC6 A;  2DYQ A;  2ROV A;  2KCJ A;  2GCL A;  1M7R A;  3QWM A;  2D4Q A;  2OQB A;  4JMO A;  1ZC4 B;  2AEH A;  1DDW A;  2LOX A;  3QIJ A;  1KZG A;  1LW3 A;  1OY2 A;  1TJ6 A;  1W1H A;  2V76 A;  3RCP A;  3PEG A;  4B6H A;  1XSZ A;  1K5D B;  4EMO A;  1Y19 B;  3D8E A;  1FHO A;  4DX9 0;  3HJL A;  2D10 A;  2DHK A;  5D3X A;  2Z0P A;  2CY4 A;  3TVV A;  5JLJ B;  5J3T A;  2Y8F A;  2DHI A;  2NZ8 B;  5DIF B;  4HB0 B;  1XCG A;  1GC7 A;  1U5G A;  4JWL A;  4IOY X;  1J19 A;  5DH9 B;  2YS5 A;  2DYN A;  2EJ8 A;  1EAZ A;  1U5D A;  4P7I A;  4D7Q A;  1MKE A;  1TQZ A;  1X86 A;  2DKP A;  2D9W A;  2IFS A;  2I5C A;  1MK7 B;  4HB2 B;  1J0W A;  3PZD A;  1EGX A;  2LYD A;  3SOH B;  2I5F A;  3MDB C;  1ZVR A;  3ODO A;  2RVB B;  4KN7 X;  1R8M E;  4MY6 A;  3PVU A;  2VSZ A;  3FEH A;  1DRO A;  1FGZ A;  1DBH A;  1KZ7 A;  1Z87 A;  4TKN A;  2M38 A;  1FHW A;  3ZVR A;  3USW A;  3WA0 A;  3HQC A;  4Y94 A;  1N3H A;  3GYO A;  4C7P A;  4ZRK A;  3SUZ A;  2MKR A;  1I7A A;  3CIK A;  4K2P A;  2P8V A;  1X05 A;  1PMS A;  1X1F A;  4Z21 A;  2GCJ A;  2UVM A;  2HE7 A;  2XQN M;  2OTX A;  1U29 A;  5HE0 A;  4KN4 X;  3AU5 A;  3MPX A;  4CHJ A;  4WVF B;  4GXB A;  3LTL A;  4HAZ B;  2DLW A;  5JHG A;  2H7E A;  2M14 A;  1XKE A;  1UNQ A;  2H7D A;  1RJ2 A;  1EVH A;  4F7H A;  2ROZ B;  3DXE A;  3TW1 A;  5LON B;  3LJU X;  5FI1 A;  5L81 A;  2ELA A;  1BC9 A;  5DI9 B;  1S9D E;  4TYZ A;  4PQ0 A;  5DHF B;  2D11 A;  2MWN B;  5D3W A;  1ZC3 B;  4IAP A;  2LKO A;  4HB3 B;  4FHR B;  1WI1 A;  2DA0 A;  2YRY A;  3P6A A;  1U27 A;  4L6E A;  2MFQ A;  3PG7 A;  4DX8 A;  3VIA A;  3L8N A;  4FQ0 C;  2N23 A;  1IRS A;  5KQ4 A;  3BIN A;  1H4R A;  3ULB A;  3VOQ A;  3PVW A;  3TW5 A;  2NMB A;  3QBV B;  3KY9 A;  3TFM A;  2E2X A;  4KVG B;  5HE1 A;  1BAK A;  3V5W A;  1XOD A;  1I2H A;  3FSS A;  3GYP A;  1X1G A;  1BTN A;  3AU4 A;  2COD A;  4A6F A;  1RRP B;  1WJM A;  1PBV A;  1FB8 A;  4HDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...