2R09A

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 101
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r09A01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r09A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r09A03
2UZSA 4L5MA 1U5GA 1X1FA 2MFQA 3AJ4A 1WVHA 1AQCA 2Z0QA 2YT0A 2RNRB 3LJUX 4DXAB 2DA0A 1UNQA 3DXDA 2DX5A 3DXEA 4A4PA 1WGUA 5JLJB 2P0HA 1UEFA 4YL8A 1J0WA 2DHKA 5GOWB 3KSYA 4ZRJA 5DH9B 4H8SA 1V89A 2LG1A 4CYEA 1I7AA 2I1JA 4F7UP 4D7QA 2DHIA 2COCA 5C6RA 1WI1A 3X23A 4A6KA 4HDOA 3A98B 1BC9A 1R8ME 5C16A 1XD4A 2MDXA 1QC6A 2GCLA 1H4RA 1U27A 2YT1A 4DX8A 1NU2A 5D3VA 4IAPA 1PFJA 3DXCA 2D9XA 2COAA 4YONA 1U5EA 1DDMA 5DIFB 1RJ2A 1R8SE 2LKOA 4D7RA 2LOZA 3ODXA 2Z0OA 2DTCA 1OY2A 4IFSA 4A5KA 2OTXA 1TJ6A 4GMXB 4Z21A 1ZVRA 1U2BA 2P0FA 1FGZA 3ULBA 3PZDA 5D3WA 4HB0B 5HE1A 5L81A 1ZC4B 3RCPA 2J0JA 4A6HA 4K2OA 1XCGA 2W2WA 4K2PA 1V61A 3A8QA 1B55A 4C0AA 1RE0B 1GC6A 2K2UA 4GMVA 1MK9B 4GXBA 1DBHA 2UZRA 2AEHA 1X1GA 1FAOA 1UNPA 1W1DA 2VSZA 2D9VA 1V88A 3P6AA 4K17A 4WSFA 5D27A 3CIKA 2W2XD 1ZC3B 1GG3A 1K5DB 2H7DA 2RGNB 2N0YA 1XR0B 4HAZB 1U29A 3ZDTA 4XWXA 2HE7A 2I5CA 3PSCA 5J3QA 2Y8FA 1FHWA 4DBBA 3KY9A 4KAXB 3OANA 4BBKA 3TCAA 3QWMA 2DN6A 1QQGA 2I1KA 1MK7B 1DYNA 2RVBB 5HE0A 1OMWA 3GYOA 1PBVA 1TQZA 1BTKA 2JP2A 5CLLB 1TXDA 1MIZB 2YS3A 2RUKB 2D4QA 3V5WA 4JWLA 1MIXA 1Y19B 5DHFB 1DDVA 3AU5A 1MAIA 1PMSA 1X11A 2M14A 2UVMA 3SWVA 2VKIA 4MY6A 2D11A 1V5MA 2KCJA 2EMTA 1DDWA 2RLOA 3M1IB 1Z87A 4GN1A 4P7IA 4MK0A 1R8QE 3WA0A 4CHJA 3ML4A 3SUZA 5JP4A 2ZPYA 3D8FA 1P5TA 4EMOA 3GYPA 3BINA 4JMIA 2YVCA 3KRXA 2MKRA 4HB2B 1J19A 5KQ1A 2K2JA 3U7DA 4KHAA 1SHCA 3MPXA 1FHXA 1H10A 5EFXA 2EMSA 1KZ7A 1BWNA 2ELBA 2XQNM 3SO6A 1FGYA 4PQ0A 1ZM0A 1U5DA 2YF0A 1MKEA 5KQ4A 1X86A 2DKQA 3FEHA 2DYQA 1V5UA 2CRFA 3IVFA 2OQBA 1SGHA 1Y5OA 1EVHA 2LYDA 2J59M 2RSGA 4HATB 3QBVB 1K5GB 3TFMA 1DROA 2DFKA 4CHMA 3D8DA 2IYBA 3LTLA 2LULA 2MWNB 2KUPA 2YSZA 5C5BA 2YRYA 4NY0A 4HB3B 2VRWB 3SV1A 3SYXA 2NZ8B 5J3YA 1P3RA 4HAWB 3NSUA 4HAVB 5FI0A 3F0WA 2J0KA 3PEGA 5JHGA 1M7EA 2R09A 1M7RA 3PVWA 4EJNA 1EAZA 2X18A 2YS1A 5CLQB 4IOYX 1UPRA 5FI1A 1BTNA 3T06A 5D3XA 5KCVA 2P8VA 2D9WA 1WJMA 1P6SA 1N3HA 2DX1A 1XSZA 1NTYA 2J0MA 2NMBA 1MPHA 4K81A 4HHVA 1PLSA 1XKEA 2D9ZA 3VIAA 2R0DA 2DYNA 4HDQA 1IRSA 1KU1A 1ISNA 3VOQA 4DX90 4OIYA 2Y7BA 1AWEA 5DHAB 3CXBB 1GC7A 5D3YA 4Z2NA 2QKLA 1UNRA 3FM8C 2CY4A 4Z2MB 2V76A 2YS5A 3PVUA 2COFA 4A6FA 5HE2A 4JMOA 4GZUA 2D2QA 2EJ8A 4KHBB 5DI9B 3ODWA 4HAXB 2DKPA 1FHOA 1U5FA 3FSSA 3KRWA 2I5FA 1ZSQA 2L2IA 1NI2A 2L1CA 2Z0PA 1LW3A 4TYZA 2FJLA 2GCJA 1Q67A 2ROVA 2D10A 1S9DE 2CODA 5LOPB 4EKUA 2LOXA 1WJ1A 3ULCA 3UZTA 3A8PA 3MDBC 4NSWA 1I2HA 1EGXA 5HE3A 1XT0B 5LONB 4C7PA 4L6EA 2HTHB 3SNHA 4WJ7A 4GPTB 3U8ZA 3ODOA 4Y94A 3TO1A 3TW1A 2ROZB 4JXHA 2G35A 5C5BB 4KHOA 4TKNA 2ADZA 3QIJA 4HAUB 2Q13A 3PG7A 1KZGA 1KI1B 5JHHA 2QKMA 3F5RA 1EF1A 2GS0A 2W2XC 4HAYB 3N7CA 2PZ1A 3P7ZA 2DLWA 2M38A 1NTVA 2P0DA 4PNKA 1WG7A 3TVVA 4F7HA 3PVLA 3BJIA 2KGXB 3O96A 3L8NA 1FOEA 3HQCA 3WYFB 5J3TA 1FB8A 4HB4B 1XODA 4D0NB 2Y8GA 3ZVRA 2D9YA 2AL6A 4MT7A 5C79A 3HW2B 3KZ1A 1WGQA 2CY5A 2H7EA 1XX0A 2N23A 1OQNA 4B6HA 2GJYA 4F7GA 1W1HA 3HK0A 1W1GA 3PP2A 4A6FB 1UPQA 4KVGB 1RRPB 3G9WA 3D8EA 1E5WA 2BCJA 1BAKA 1V5PA 2DHJA 4WVFB 2EC1A 3AU4A 2K00A 2E2XA 2IFSA 2CAYA 1X05A 4ZRIA 4ZRKA 2ELAA 1LB1A
chains in the Genus database with same CATH superfamily
2UZSA 4L5MA 1U5GA 1X1FA 1HM6A 2MFQA 1WVHA 1AQCA 3AJ4A 2Z0QA 2YT0A 2RNRB 3LJUX 4DXAB 2DA0A 1YCNA 1UNQA 2Z59A 3DXDA 2DX5A 3DXEA 4A4PA 1WGUA 5JLJB 2HYUA 1UEFA 2P0HA 4YL8A 1BC0A 1J0WA 2DHKA 3HSAA 5GOWB 3KSYA 4ZRJA 5DH9B 1HVDA 1V89A 4H8SA 2LG1A 4CYEA 1I7AA 2I1JA 4F7UP 4D7QA 1YIIA 2DHIA 2COCA 5C6RA 2Q4CA 1WI1A 3X23A 1A8BA 4A6KA 4HDOA 3A98B 1BC9A 1R8ME 5C16A 1N00A 4HREA 1XD4A 1YJ0A 1QC6A 2MDXA 5I2MA 2GCLA 1H4RA 1U27A 2YT1A 4DX8A 1NU2A 5D3VA 2K49A 4QJ3B 1I4AA 2QEZA 1PFJA 4IAPA 3DXCA 2D9XA 2COAA 2ZHIA 4YONA 1U5EA 3BRXA 1DDMA 5DIFB 1RJ2A 1R8SE 2LKOA 4D7RA 2LOZA 3ODXA 2Z0OA 3AO0A 2DTCA 1OY2A 3U12A 4L1RA 4IFSA 4A5KA 2OTXA 1TJ6A 4GMXB 2ZKMX 4Z21A 1ZVRA 1U2BA 2P0FA 1FGZA 3ULBA 4KN7X 3PZDA 5D3WA 4HB0B 5HE1A 5L81A 2ZHJA 1ZC4B 1HAKA 3RCPA 2J0JA 4A6HA 4K2OA 1XCGA 2W2WA 2Z14A 4K2PA 1V61A 3A8QA 1B55A 1ANXA 4C0AA 4CSQA 1RE0B 1N42A 1GC6A 2K2UA 4GMVA 1MK9B 3HIEA 4GXBA 1DBHA 2RRFA 1BC1A 2UZRA 2AEHA 4KN4X 1X1GA 1FAOA 1UNPA 1W1DA 2VSZA 4MDVA 2D9VA 1V88A 3P6AA 4K17A 1M9IA 4WSFA 3ANYA 5D27A 3CIKA 2W2XD 1ZC3B 1GG3A 1K5DB 2R2YA 2H7DA 2RGNB 2N0YA 2IE6A 1XR0B 1U29A 4HAZB 3ZDTA 4XWXA 2HE7A 2I5CA 1BO9A 3PSCA 5J3QA 2Y8FA 1FHWA 4DBBA 2YT2A 3KY9A 4KAXB 3OANA 4BBKA 3TCAA 1DK5A 3TW5A 3QWMA 2DN6A 1QQGA 2I1KA 1MK7B 1DYNA 2HYVA 2RVBB 5HE0A 1OMWA 3AJCA 3GYOA 4GNKB 1PBVA 1TQZA 1BTKA 2JP2A 5CLLB 1TXDA 1MIZB 2YS3A 2RUKB 5IRSA 3ABSA 2D4QA 3V5WA 4QJ4B 4JWLA 1MIXA 1Y19B 2KIGA 5DHFB 1DDVA 3AU5A 1MAIA 1PMSA 1X11A 1C1KA 2M14A 2UVMA 1AEIA 4DIXA 3SWVA 2VKIA 4MY6A 1HVGA 2D11A 1V5MA 2KCJA 2EMTA 1DDWA 2RLOA 3M1IB 4QXAB 1Z87A 4GN1A 4P7IA 4MK0A 1R8QE 3WA0A 4CHJA 3ML4A 3SUZA 5JP4A 2ZPYA 3D8FA 1LKVX 1P5TA 4EMOA 3GYPA 3BINA 3ABRA 4JMIA 2YVCA 3KRXA 2MKRA 4HB2B 1J19A 5KQ1A 1N41A 4FQ0C 2K2JA 3U7DA 4Q2SA 4KHAA 3DCXA 1SHCA 3MPXA 1FHXA 1ANWA 1H10A 2Z13A 1DM5A 5EFXA 2EMSA 4EVFA 1KZ7A 1BWNA 2ELBA 2IICA 3ABQA 3NWDA 2XQNM 4KHBA 3SO6A 1FGYA 2RANA 4PQ0A 1ZM0A 2KR0A 1G5NA 1U5DA 2FJUB 2YF0A 2XO3A 1MKEA 2NBVA 5KQ4A 1X86A 2DKQA 3FEHA 2DYQA 1BCZA 1W7BA 2KUQA 1V5UA 2CRFA 2HYWA 3IVFA 2OQBA 1ZYIA 1SGHA 2II2A 2H0LA 1Y5OA 2ZOCA 1HVFA 1EVHA 5M4YB 2LYDA 1Q8DA 2J59M 2RSGA 4HATB 1QC7A 3OHMB 3QBVB 4JK1X 1SAVA 1K5GB 3TFMA 1DROA 2DFKA 4CHMA 3D8DA 2IYBA 3LTLA 2LULA 2MWNB 2KUPA 2YSZA 5C5BA 2YRYA 4NY0A 4HB3B 2VRWB 1AXNA 3SV1A 3SYXA 2NZ8B 5J3YA 2K6XA 1P3RA 4HAWB 3NSUA 4HAVB 2IE7A 2H0MA 5FI0A 3F0WA 2J0KA 3PEGA 5JHGA 1M7EA 1BCYA 3A58A 2R09A 1M7RA 3PVWA 4EJNA 1EAZA 2X18A 2YS1A 5CLQB 4IOYX 1AVCA 1UPRA 5FI1A 1BTNA 3T06A 5D3XA 5KCVA 2P8VA 2D9WA 1WJMA 1P6SA 1N3HA 2DX1A 1N44A 1XSZA 1NTYA 2J0MA 2Z4DA 2NMBA 1MPHA 1UPTB 4K81A 2K8EA 4HHVA 1PLSA 1XKEA 2D9ZA 3VIAA 2R0DA 2DYNA 4HDQA 1IRSA 1KU1A 1T77A 1ISNA 3NW8A 3VOQA 3NWAA 4DX90 4OIYA 2Y7BA 1AWEA 4OSNA 3CXBB 5DHAB 1GC7A 5D3YA 4Z2NA 2QKLA 1UNRA 3FM8C 4GOUA 2CY4A 4Z2MB 1MCXA 2V76A 2YS5A 3PVUA 2COFA 4A6FA 4FHRB 5HE2A 4JMOA 2GUMA 4GZUA 1AVRA 2D2QA 2EJ8A 3FVCA 4KHBB 5DI9B 3ODWA 4HAXB 1BCWA 2DKPA 1FHOA 1U5FA 3B77A 3FSSA 3KRWA 1W3WA 2I5FA 3HJLA 1ZSQA 1W45A 2L2IA 1NI2A 2L1CA 2Z0PA 1LW3A 2HSNA 4TYZA 2FJLA 2GCJA 1Q67A 2ROVA 2XO2A 2D10A 1S9DE 2CODA 5LOPB 4EKUA 2LOXA 1WJ1A 3ULCA 3UZTA 3A8PA 3MDBC 1ALAA 1I2HA 4NSWA 1EGXA 5HE3A 1XT0B 5LONB 4C7PA 4L6EA 2HTHB 3SNHA 4WJ7A 4GPTB 3U8ZA 3ODOA 4KMUX 4X9PA 4Y94A 3TO1A 3TW1A 2ROZB 4JXHA 2G35A 5C5BB 4KHOA 4TKNA 2ADZA 3QIJA 1R4AE 4HAUB 4MDUA 2Q13A 3PG7A 1KZGA 1KI1B 5JHHA 2QKMA 3F5RA 1EF1A 2GS0A 2W2XC 4HAYB 3N7CA 2PZ1A 3P7ZA 4D6WA 2DLWA 2M38A 1NTVA 3SOHB 2P0DA 4PNKA 1WG7A 3TVVA 4F7HA 3PVLA 1AOWA 5LG4B 3BJIA 2KGXB 3O96A 3L8NA 1FOEA 3HQCA 4OT1A 3WYFB 5J3TA 1FB8A 4HB4B 1XODA 4D0NB 2OY9A 2Y8GA 3ZVRA 1YGMA 2D9YA 2AL6A 4HSIA 4MT7A 5C79A 3HW2B 3USYA 3KZ1A 1WGQA 2CY5A 2H7EA 1XX0A 2N23A 1OQNA 4B6HA 2GJYA 2KIEA 3ABOA 4F7GA 1XJLA 1W1HA 3HK0A 1W1GA 1AVHA 1AIIA 1ANNA 3PP2A 4A6FB 1UPQA 4KVGB 1RRPB 3G9WA 3D8EA 2H0KA 1E5WA 2BCJA 1BAKA 1V5PA 1BC3A 2DHJA 4WVFB 2EC1A 3AU4A 2K00A 1MI1A 2E2XA 2IFSA 4QJ5B 4EVHA 5I2SA 2CAYA 2VXGA 1X05A 4ZRIA 4ZRKA 1HVEA 1A8AA 2ELAA 3NWFA 3USWA 1LB1A
chains in the Genus database with same CATH topology
2UZSA 4L5MA 1U5GA 1X1FA 2MFQA 3AJ4A 1WVHA 1AQCA 2Z0QA 2YT0A 2RNRB 3LJUX 4DXAB 2DA0A 1UNQA 3DXDA 2DX5A 3DXEA 4A4PA 1WGUA 5JLJB 2P0HA 1UEFA 4YL8A 1J0WA 2DHKA 5GOWB 3KSYA 4ZRJA 5DH9B 4H8SA 1V89A 2LG1A 4CYEA 1I7AA 2I1JA 4F7UP 4D7QA 2DHIA 2COCA 5C6RA 1WI1A 3X23A 4A6KA 4HDOA 3A98B 1BC9A 1R8ME 5C16A 1XD4A 2MDXA 1QC6A 2GCLA 1H4RA 1U27A 2YT1A 4DX8A 1NU2A 5D3VA 4IAPA 1PFJA 3DXCA 2D9XA 2COAA 4YONA 1U5EA 1DDMA 5DIFB 1RJ2A 1R8SE 2LKOA 4D7RA 2LOZA 3ODXA 2Z0OA 2DTCA 1OY2A 4IFSA 4A5KA 2OTXA 1TJ6A 4GMXB 4Z21A 1ZVRA 1U2BA 2P0FA 1FGZA 3ULBA 4KN7X 3PZDA 5D3WA 4HB0B 5HE1A 5L81A 1ZC4B 3RCPA 2J0JA 4A6HA 4K2OA 1XCGA 2W2WA 4K2PA 1V61A 3A8QA 1B55A 4C0AA 1RE0B 1GC6A 2K2UA 4GMVA 1MK9B 4GXBA 1DBHA 2UZRA 2AEHA 4KN4X 1X1GA 1FAOA 1UNPA 1W1DA 2VSZA 2D9VA 1V88A 3P6AA 4K17A 4WSFA 5D27A 3CIKA 2W2XD 1ZC3B 1GG3A 1K5DB 2H7DA 2RGNB 2N0YA 1XR0B 4HAZB 1U29A 3ZDTA 4XWXA 2HE7A 2I5CA 3PSCA 5J3QA 2Y8FA 1FHWA 4DBBA 3KY9A 4KAXB 3OANA 4BBKA 3TCAA 3TW5A 3QWMA 2DN6A 1QQGA 2I1KA 1MK7B 1DYNA 2RVBB 5HE0A 1OMWA 3AJCA 3GYOA 1PBVA 1TQZA 1BTKA 2JP2A 5CLLB 1TXDA 1MIZB 2YS3A 2RUKB 2D4QA 3V5WA 4JWLA 1MIXA 1Y19B 5DHFB 1DDVA 3AU5A 1MAIA 1PMSA 1X11A 2M14A 2UVMA 3SWVA 2VKIA 4MY6A 2D11A 1V5MA 2KCJA 2EMTA 1DDWA 2RLOA 3M1IB 1Z87A 4GN1A 4P7IA 4MK0A 1R8QE 3WA0A 4CHJA 3ML4A 3SUZA 5JP4A 2ZPYA 3D8FA 1LKVX 1P5TA 4EMOA 3GYPA 3BINA 4JMIA 2YVCA 3KRXA 2MKRA 4HB2B 1J19A 5KQ1A 4FQ0C 2K2JA 3U7DA 4KHAA 1SHCA 3MPXA 1FHXA 1H10A 5EFXA 2EMSA 1KZ7A 1BWNA 2ELBA 2XQNM 3SO6A 1FGYA 4PQ0A 1ZM0A 1U5DA 2YF0A 1MKEA 5KQ4A 1X86A 2DKQA 3FEHA 2DYQA 1V5UA 2CRFA 3IVFA 2OQBA 1SGHA 1Y5OA 1EVHA 2LYDA 1Q8DA 2J59M 2RSGA 4HATB 1QC7A 3QBVB 4JK1X 1K5GB 3TFMA 1DROA 2DFKA 4CHMA 3D8DA 2IYBA 3LTLA 2LULA 2MWNB 2KUPA 2YSZA 5C5BA 2YRYA 4NY0A 4HB3B 2VRWB 3SV1A 3SYXA 2NZ8B 5J3YA 2K6XA 1P3RA 4HAWB 3NSUA 4HAVB 5FI0A 3F0WA 2J0KA 3PEGA 5JHGA 1M7EA 2R09A 1M7RA 3PVWA 4EJNA 1EAZA 2X18A 2YS1A 5CLQB 4IOYX 1UPRA 5FI1A 1BTNA 3T06A 5D3XA 5KCVA 2P8VA 2D9WA 1WJMA 1P6SA 1N3HA 2DX1A 1XSZA 1NTYA 2J0MA 2NMBA 1MPHA 4K81A 4HHVA 1PLSA 1XKEA 2D9ZA 3VIAA 2R0DA 2DYNA 4HDQA 1IRSA 1KU1A 1ISNA 3VOQA 4DX90 4OIYA 2Y7BA 1AWEA 5DHAB 3CXBB 1GC7A 5D3YA 4Z2NA 2QKLA 1UNRA 3FM8C 2CY4A 4Z2MB 2V76A 2YS5A 3PVUA 2COFA 4A6FA 4FHRB 5HE2A 4JMOA 4GZUA 2D2QA 2EJ8A 4KHBB 5DI9B 3ODWA 4HAXB 2DKPA 1FHOA 1U5FA 3FSSA 3KRWA 2I5FA 3HJLA 1ZSQA 2L2IA 1NI2A 2L1CA 2Z0PA 1LW3A 2HSNA 4TYZA 2FJLA 2GCJA 1Q67A 2ROVA 2D10A 1S9DE 2CODA 5LOPB 4EKUA 2LOXA 1WJ1A 3ULCA 3UZTA 3A8PA 3MDBC 4NSWA 1I2HA 1EGXA 5HE3A 1XT0B 5LONB 4C7PA 4L6EA 2HTHB 3SNHA 4WJ7A 4GPTB 3U8ZA 3ODOA 4KMUX 4Y94A 3TO1A 3TW1A 2ROZB 4JXHA 2G35A 5C5BB 4KHOA 4TKNA 2ADZA 3QIJA 4HAUB 2Q13A 3PG7A 1KZGA 1KI1B 5JHHA 2QKMA 3F5RA 1EF1A 2GS0A 2W2XC 4HAYB 3N7CA 2PZ1A 3P7ZA 2DLWA 2M38A 1NTVA 3SOHB 2P0DA 4PNKA 1WG7A 3TVVA 4F7HA 3PVLA 3BJIA 2KGXB 3O96A 3L8NA 1FOEA 3HQCA 3WYFB 5J3TA 1FB8A 4HB4B 1XODA 4D0NB 2Y8GA 3ZVRA 2D9YA 2AL6A 4MT7A 5C79A 3HW2B 3USYA 3KZ1A 1WGQA 2CY5A 2H7EA 1XX0A 2N23A 1OQNA 4B6HA 2GJYA 4F7GA 1W1HA 3HK0A 1W1GA 3PP2A 4A6FB 1UPQA 4KVGB 1RRPB 3G9WA 3D8EA 1E5WA 2BCJA 1BAKA 1V5PA 2DHJA 4WVFB 2EC1A 3AU4A 2K00A 2E2XA 2IFSA 2CAYA 1X05A 4ZRIA 4ZRKA 2ELAA 3USWA 1LB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZS A;  4L5M A;  1U5G A;  1X1F A;  2MFQ A;  3AJ4 A;  1WVH A;  1AQC A;  2Z0Q A;  2YT0 A;  2RNR B;  3LJU X;  4DXA B;  2DA0 A;  1UNQ A;  3DXD A;  2DX5 A;  3DXE A;  4A4P A;  1WGU A;  5JLJ B;  2P0H A;  1UEF A;  4YL8 A;  1J0W A;  2DHK A;  5GOW B;  3KSY A;  4ZRJ A;  5DH9 B;  4H8S A;  1V89 A;  2LG1 A;  4CYE A;  1I7A A;  2I1J A;  4F7U P;  4D7Q A;  2DHI A;  2COC A;  5C6R A;  1WI1 A;  3X23 A;  4A6K A;  4HDO A;  3A98 B;  1BC9 A;  1R8M E;  5C16 A;  1XD4 A;  2MDX A;  1QC6 A;  2GCL A;  1H4R A;  1U27 A;  2YT1 A;  4DX8 A;  1NU2 A;  5D3V A;  4IAP A;  1PFJ A;  3DXC A;  2D9X A;  2COA A;  4YON A;  1U5E A;  1DDM A;  5DIF B;  1RJ2 A;  1R8S E;  2LKO A;  4D7R A;  2LOZ A;  3ODX A;  2Z0O A;  2DTC A;  1OY2 A;  4IFS A;  4A5K A;  2OTX A;  1TJ6 A;  4GMX B;  4Z21 A;  1ZVR A;  1U2B A;  2P0F A;  1FGZ A;  3ULB A;  3PZD A;  5D3W A;  4HB0 B;  5HE1 A;  5L81 A;  1ZC4 B;  3RCP A;  2J0J A;  4A6H A;  4K2O A;  1XCG A;  2W2W A;  4K2P A;  1V61 A;  3A8Q A;  1B55 A;  4C0A A;  1RE0 B;  1GC6 A;  2K2U A;  4GMV A;  1MK9 B;  4GXB A;  1DBH A;  2UZR A;  2AEH A;  1X1G A;  1FAO A;  1UNP A;  1W1D A;  2VSZ A;  2D9V A;  1V88 A;  3P6A A;  4K17 A;  4WSF A;  5D27 A;  3CIK A;  2W2X D;  1ZC3 B;  1GG3 A;  1K5D B;  2H7D A;  2RGN B;  2N0Y A;  1XR0 B;  4HAZ B;  1U29 A;  3ZDT A;  4XWX A;  2HE7 A;  2I5C A;  3PSC A;  5J3Q A;  2Y8F A;  1FHW A;  4DBB A;  3KY9 A;  4KAX B;  3OAN A;  4BBK A;  3TCA A;  3QWM A;  2DN6 A;  1QQG A;  2I1K A;  1MK7 B;  1DYN A;  2RVB B;  5HE0 A;  1OMW A;  3GYO A;  1PBV A;  1TQZ A;  1BTK A;  2JP2 A;  5CLL B;  1TXD A;  1MIZ B;  2YS3 A;  2RUK B;  2D4Q A;  3V5W A;  4JWL A;  1MIX A;  1Y19 B;  5DHF B;  1DDV A;  3AU5 A;  1MAI A;  1PMS A;  1X11 A;  2M14 A;  2UVM A;  3SWV A;  2VKI A;  4MY6 A;  2D11 A;  1V5M A;  2KCJ A;  2EMT A;  1DDW A;  2RLO A;  3M1I B;  1Z87 A;  4GN1 A;  4P7I A;  4MK0 A;  1R8Q E;  3WA0 A;  4CHJ A;  3ML4 A;  3SUZ A;  5JP4 A;  2ZPY A;  3D8F A;  1P5T A;  4EMO A;  3GYP A;  3BIN A;  4JMI A;  2YVC A;  3KRX A;  2MKR A;  4HB2 B;  1J19 A;  5KQ1 A;  2K2J A;  3U7D A;  4KHA A;  1SHC A;  3MPX A;  1FHX A;  1H10 A;  5EFX A;  2EMS A;  1KZ7 A;  1BWN A;  2ELB A;  2XQN M;  3SO6 A;  1FGY A;  4PQ0 A;  1ZM0 A;  1U5D A;  2YF0 A;  1MKE A;  5KQ4 A;  1X86 A;  2DKQ A;  3FEH A;  2DYQ A;  1V5U A;  2CRF A;  3IVF A;  2OQB A;  1SGH A;  1Y5O A;  1EVH A;  2LYD A;  2J59 M;  2RSG A;  4HAT B;  3QBV B;  1K5G B;  3TFM A;  1DRO A;  2DFK A;  4CHM A;  3D8D A;  2IYB A;  3LTL A;  2LUL A;  2MWN B;  2KUP A;  2YSZ A;  5C5B A;  2YRY A;  4NY0 A;  4HB3 B;  2VRW B;  3SV1 A;  3SYX A;  2NZ8 B;  5J3Y A;  1P3R A;  4HAW B;  3NSU A;  4HAV B;  5FI0 A;  3F0W A;  2J0K A;  3PEG A;  5JHG A;  1M7E A;  2R09 A;  1M7R A;  3PVW A;  4EJN A;  1EAZ A;  2X18 A;  2YS1 A;  5CLQ B;  4IOY X;  1UPR A;  5FI1 A;  1BTN A;  3T06 A;  5D3X A;  5KCV A;  2P8V A;  2D9W A;  1WJM A;  1P6S A;  1N3H A;  2DX1 A;  1XSZ A;  1NTY A;  2J0M A;  2NMB A;  1MPH A;  4K81 A;  4HHV A;  1PLS A;  1XKE A;  2D9Z A;  3VIA A;  2R0D A;  2DYN A;  4HDQ A;  1IRS A;  1KU1 A;  1ISN A;  3VOQ A;  4DX9 0;  4OIY A;  2Y7B A;  1AWE A;  5DHA B;  3CXB B;  1GC7 A;  5D3Y A;  4Z2N A;  2QKL A;  1UNR A;  3FM8 C;  2CY4 A;  4Z2M B;  2V76 A;  2YS5 A;  3PVU A;  2COF A;  4A6F A;  5HE2 A;  4JMO A;  4GZU A;  2D2Q A;  2EJ8 A;  4KHB B;  5DI9 B;  3ODW A;  4HAX B;  2DKP A;  1FHO A;  1U5F A;  3FSS A;  3KRW A;  2I5F A;  1ZSQ A;  2L2I A;  1NI2 A;  2L1C A;  2Z0P A;  1LW3 A;  4TYZ A;  2FJL A;  2GCJ A;  1Q67 A;  2ROV A;  2D10 A;  1S9D E;  2COD A;  5LOP B;  4EKU A;  2LOX A;  1WJ1 A;  3ULC A;  3UZT A;  3A8P A;  3MDB C;  4NSW A;  1I2H A;  1EGX A;  5HE3 A;  1XT0 B;  5LON B;  4C7P A;  4L6E A;  2HTH B;  3SNH A;  4WJ7 A;  4GPT B;  3U8Z A;  3ODO A;  4Y94 A;  3TO1 A;  3TW1 A;  2ROZ B;  4JXH A;  2G35 A;  5C5B B;  4KHO A;  4TKN A;  2ADZ A;  3QIJ A;  4HAU B;  2Q13 A;  3PG7 A;  1KZG A;  1KI1 B;  5JHH A;  2QKM A;  3F5R A;  1EF1 A;  2GS0 A;  2W2X C;  4HAY B;  3N7C A;  2PZ1 A;  3P7Z A;  2DLW A;  2M38 A;  1NTV A;  2P0D A;  4PNK A;  1WG7 A;  3TVV A;  4F7H A;  3PVL A;  3BJI A;  2KGX B;  3O96 A;  3L8N A;  1FOE A;  3HQC A;  3WYF B;  5J3T A;  1FB8 A;  4HB4 B;  1XOD A;  4D0N B;  2Y8G A;  3ZVR A;  2D9Y A;  2AL6 A;  4MT7 A;  5C79 A;  3HW2 B;  3KZ1 A;  1WGQ A;  2CY5 A;  2H7E A;  1XX0 A;  2N23 A;  1OQN A;  4B6H A;  2GJY A;  4F7G A;  1W1H A;  3HK0 A;  1W1G A;  3PP2 A;  4A6F B;  1UPQ A;  4KVG B;  1RRP B;  3G9W A;  3D8E A;  1E5W A;  2BCJ A;  1BAK A;  1V5P A;  2DHJ A;  4WVF B;  2EC1 A;  3AU4 A;  2K00 A;  2E2X A;  2IFS A;  2CAY A;  1X05 A;  4ZRI A;  4ZRK A;  2ELA A;  1LB1 A; 
#chains in the Genus database with same CATH topology
 2UZS A;  4L5M A;  1U5G A;  1X1F A;  1HM6 A;  2MFQ A;  1WVH A;  1AQC A;  3AJ4 A;  2Z0Q A;  2YT0 A;  2RNR B;  3LJU X;  4DXA B;  2DA0 A;  1YCN A;  1UNQ A;  2Z59 A;  3DXD A;  2DX5 A;  3DXE A;  4A4P A;  1WGU A;  5JLJ B;  2HYU A;  1UEF A;  2P0H A;  4YL8 A;  1BC0 A;  1J0W A;  2DHK A;  3HSA A;  5GOW B;  3KSY A;  4ZRJ A;  5DH9 B;  1HVD A;  1V89 A;  4H8S A;  2LG1 A;  4CYE A;  1I7A A;  2I1J A;  4F7U P;  4D7Q A;  1YII A;  2DHI A;  2COC A;  5C6R A;  2Q4C A;  1WI1 A;  3X23 A;  1A8B A;  4A6K A;  4HDO A;  3A98 B;  1BC9 A;  1R8M E;  5C16 A;  1N00 A;  4HRE A;  1XD4 A;  1YJ0 A;  1QC6 A;  2MDX A;  5I2M A;  2GCL A;  1H4R A;  1U27 A;  2YT1 A;  4DX8 A;  1NU2 A;  5D3V A;  2K49 A;  4QJ3 B;  1I4A A;  2QEZ A;  1PFJ A;  4IAP A;  3DXC A;  2D9X A;  2COA A;  2ZHI A;  4YON A;  1U5E A;  3BRX A;  1DDM A;  5DIF B;  1RJ2 A;  1R8S E;  2LKO A;  4D7R A;  2LOZ A;  3ODX A;  2Z0O A;  3AO0 A;  2DTC A;  1OY2 A;  3U12 A;  4L1R A;  4IFS A;  4A5K A;  2OTX A;  1TJ6 A;  4GMX B;  2ZKM X;  4Z21 A;  1ZVR A;  1U2B A;  2P0F A;  1FGZ A;  3ULB A;  4KN7 X;  3PZD A;  5D3W A;  4HB0 B;  5HE1 A;  5L81 A;  2ZHJ A;  1ZC4 B;  1HAK A;  3RCP A;  2J0J A;  4A6H A;  4K2O A;  1XCG A;  2W2W A;  2Z14 A;  4K2P A;  1V61 A;  3A8Q A;  1B55 A;  1ANX A;  4C0A A;  4CSQ A;  1RE0 B;  1N42 A;  1GC6 A;  2K2U A;  4GMV A;  1MK9 B;  3HIE A;  4GXB A;  1DBH A;  2RRF A;  1BC1 A;  2UZR A;  2AEH A;  4KN4 X;  1X1G A;  1FAO A;  1UNP A;  1W1D A;  2VSZ A;  4MDV A;  2D9V A;  1V88 A;  3P6A A;  4K17 A;  1M9I A;  4WSF A;  3ANY A;  5D27 A;  3CIK A;  2W2X D;  1ZC3 B;  1GG3 A;  1K5D B;  2R2Y A;  2H7D A;  2RGN B;  2N0Y A;  2IE6 A;  1XR0 B;  1U29 A;  4HAZ B;  3ZDT A;  4XWX A;  2HE7 A;  2I5C A;  1BO9 A;  3PSC A;  5J3Q A;  2Y8F A;  1FHW A;  4DBB A;  2YT2 A;  3KY9 A;  4KAX B;  3OAN A;  4BBK A;  3TCA A;  1DK5 A;  3TW5 A;  3QWM A;  2DN6 A;  1QQG A;  2I1K A;  1MK7 B;  1DYN A;  2HYV A;  2RVB B;  5HE0 A;  1OMW A;  3AJC A;  3GYO A;  4GNK B;  1PBV A;  1TQZ A;  1BTK A;  2JP2 A;  5CLL B;  1TXD A;  1MIZ B;  2YS3 A;  2RUK B;  5IRS A;  3ABS A;  2D4Q A;  3V5W A;  4QJ4 B;  4JWL A;  1MIX A;  1Y19 B;  2KIG A;  5DHF B;  1DDV A;  3AU5 A;  1MAI A;  1PMS A;  1X11 A;  1C1K A;  2M14 A;  2UVM A;  1AEI A;  4DIX A;  3SWV A;  2VKI A;  4MY6 A;  1HVG A;  2D11 A;  1V5M A;  2KCJ A;  2EMT A;  1DDW A;  2RLO A;  3M1I B;  4QXA B;  1Z87 A;  4GN1 A;  4P7I A;  4MK0 A;  1R8Q E;  3WA0 A;  4CHJ A;  3ML4 A;  3SUZ A;  5JP4 A;  2ZPY A;  3D8F A;  1LKV X;  1P5T A;  4EMO A;  3GYP A;  3BIN A;  3ABR A;  4JMI A;  2YVC A;  3KRX A;  2MKR A;  4HB2 B;  1J19 A;  5KQ1 A;  1N41 A;  4FQ0 C;  2K2J A;  3U7D A;  4Q2S A;  4KHA A;  3DCX A;  1SHC A;  3MPX A;  1FHX A;  1ANW A;  1H10 A;  2Z13 A;  1DM5 A;  5EFX A;  2EMS A;  4EVF A;  1KZ7 A;  1BWN A;  2ELB A;  2IIC A;  3ABQ A;  3NWD A;  2XQN M;  4KHB A;  3SO6 A;  1FGY A;  2RAN A;  4PQ0 A;  1ZM0 A;  2KR0 A;  1G5N A;  1U5D A;  2FJU B;  2YF0 A;  2XO3 A;  1MKE A;  2NBV A;  5KQ4 A;  1X86 A;  2DKQ A;  3FEH A;  2DYQ A;  1BCZ A;  1W7B A;  2KUQ A;  1V5U A;  2CRF A;  2HYW A;  3IVF A;  2OQB A;  1ZYI A;  1SGH A;  2II2 A;  2H0L A;  1Y5O A;  2ZOC A;  1HVF A;  1EVH A;  5M4Y B;  2LYD A;  1Q8D A;  2J59 M;  2RSG A;  4HAT B;  1QC7 A;  3OHM B;  3QBV B;  4JK1 X;  1SAV A;  1K5G B;  3TFM A;  1DRO A;  2DFK A;  4CHM A;  3D8D A;  2IYB A;  3LTL A;  2LUL A;  2MWN B;  2KUP A;  2YSZ A;  5C5B A;  2YRY A;  4NY0 A;  4HB3 B;  2VRW B;  1AXN A;  3SV1 A;  3SYX A;  2NZ8 B;  5J3Y A;  2K6X A;  1P3R A;  4HAW B;  3NSU A;  4HAV B;  2IE7 A;  2H0M A;  5FI0 A;  3F0W A;  2J0K A;  3PEG A;  5JHG A;  1M7E A;  1BCY A;  3A58 A;  2R09 A;  1M7R A;  3PVW A;  4EJN A;  1EAZ A;  2X18 A;  2YS1 A;  5CLQ B;  4IOY X;  1AVC A;  1UPR A;  5FI1 A;  1BTN A;  3T06 A;  5D3X A;  5KCV A;  2P8V A;  2D9W A;  1WJM A;  1P6S A;  1N3H A;  2DX1 A;  1N44 A;  1XSZ A;  1NTY A;  2J0M A;  2Z4D A;  2NMB A;  1MPH A;  1UPT B;  4K81 A;  2K8E A;  4HHV A;  1PLS A;  1XKE A;  2D9Z A;  3VIA A;  2R0D A;  2DYN A;  4HDQ A;  1IRS A;  1KU1 A;  1T77 A;  1ISN A;  3NW8 A;  3VOQ A;  3NWA A;  4DX9 0;  4OIY A;  2Y7B A;  1AWE A;  4OSN A;  3CXB B;  5DHA B;  1GC7 A;  5D3Y A;  4Z2N A;  2QKL A;  1UNR A;  3FM8 C;  4GOU A;  2CY4 A;  4Z2M B;  1MCX A;  2V76 A;  2YS5 A;  3PVU A;  2COF A;  4A6F A;  4FHR B;  5HE2 A;  4JMO A;  2GUM A;  4GZU A;  1AVR A;  2D2Q A;  2EJ8 A;  3FVC A;  4KHB B;  5DI9 B;  3ODW A;  4HAX B;  1BCW A;  2DKP A;  1FHO A;  1U5F A;  3B77 A;  3FSS A;  3KRW A;  1W3W A;  2I5F A;  3HJL A;  1ZSQ A;  1W45 A;  2L2I A;  1NI2 A;  2L1C A;  2Z0P A;  1LW3 A;  2HSN A;  4TYZ A;  2FJL A;  2GCJ A;  1Q67 A;  2ROV A;  2XO2 A;  2D10 A;  1S9D E;  2COD A;  5LOP B;  4EKU A;  2LOX A;  1WJ1 A;  3ULC A;  3UZT A;  3A8P A;  3MDB C;  1ALA A;  1I2H A;  4NSW A;  1EGX A;  5HE3 A;  1XT0 B;  5LON B;  4C7P A;  4L6E A;  2HTH B;  3SNH A;  4WJ7 A;  4GPT B;  3U8Z A;  3ODO A;  4KMU X;  4X9P A;  4Y94 A;  3TO1 A;  3TW1 A;  2ROZ B;  4JXH A;  2G35 A;  5C5B B;  4KHO A;  4TKN A;  2ADZ A;  3QIJ A;  1R4A E;  4HAU B;  4MDU A;  2Q13 A;  3PG7 A;  1KZG A;  1KI1 B;  5JHH A;  2QKM A;  3F5R A;  1EF1 A;  2GS0 A;  2W2X C;  4HAY B;  3N7C A;  2PZ1 A;  3P7Z A;  4D6W A;  2DLW A;  2M38 A;  1NTV A;  3SOH B;  2P0D A;  4PNK A;  1WG7 A;  3TVV A;  4F7H A;  3PVL A;  1AOW A;  5LG4 B;  3BJI A;  2KGX B;  3O96 A;  3L8N A;  1FOE A;  3HQC A;  4OT1 A;  3WYF B;  5J3T A;  1FB8 A;  4HB4 B;  1XOD A;  4D0N B;  2OY9 A;  2Y8G A;  3ZVR A;  1YGM A;  2D9Y A;  2AL6 A;  4HSI A;  4MT7 A;  5C79 A;  3HW2 B;  3USY A;  3KZ1 A;  1WGQ A;  2CY5 A;  2H7E A;  1XX0 A;  2N23 A;  1OQN A;  4B6H A;  2GJY A;  2KIE A;  3ABO A;  4F7G A;  1XJL A;  1W1H A;  3HK0 A;  1W1G A;  1AVH A;  1AII A;  1ANN A;  3PP2 A;  4A6F B;  1UPQ A;  4KVG B;  1RRP B;  3G9W A;  3D8E A;  2H0K A;  1E5W A;  2BCJ A;  1BAK A;  1V5P A;  1BC3 A;  2DHJ A;  4WVF B;  2EC1 A;  3AU4 A;  2K00 A;  1MI1 A;  2E2X A;  2IFS A;  4QJ5 B;  4EVH A;  5I2S A;  2CAY A;  2VXG A;  1X05 A;  4ZRI A;  4ZRK A;  1HVE A;  1A8A A;  2ELA A;  3NWF A;  3USW A;  1LB1 A; 
#chains in the Genus database with same CATH homology
 2UZS A;  4L5M A;  1U5G A;  1X1F A;  2MFQ A;  3AJ4 A;  1WVH A;  1AQC A;  2Z0Q A;  2YT0 A;  2RNR B;  3LJU X;  4DXA B;  2DA0 A;  1UNQ A;  3DXD A;  2DX5 A;  3DXE A;  4A4P A;  1WGU A;  5JLJ B;  2P0H A;  1UEF A;  4YL8 A;  1J0W A;  2DHK A;  5GOW B;  3KSY A;  4ZRJ A;  5DH9 B;  4H8S A;  1V89 A;  2LG1 A;  4CYE A;  1I7A A;  2I1J A;  4F7U P;  4D7Q A;  2DHI A;  2COC A;  5C6R A;  1WI1 A;  3X23 A;  4A6K A;  4HDO A;  3A98 B;  1BC9 A;  1R8M E;  5C16 A;  1XD4 A;  2MDX A;  1QC6 A;  2GCL A;  1H4R A;  1U27 A;  2YT1 A;  4DX8 A;  1NU2 A;  5D3V A;  4IAP A;  1PFJ A;  3DXC A;  2D9X A;  2COA A;  4YON A;  1U5E A;  1DDM A;  5DIF B;  1RJ2 A;  1R8S E;  2LKO A;  4D7R A;  2LOZ A;  3ODX A;  2Z0O A;  2DTC A;  1OY2 A;  4IFS A;  4A5K A;  2OTX A;  1TJ6 A;  4GMX B;  4Z21 A;  1ZVR A;  1U2B A;  2P0F A;  1FGZ A;  3ULB A;  4KN7 X;  3PZD A;  5D3W A;  4HB0 B;  5HE1 A;  5L81 A;  1ZC4 B;  3RCP A;  2J0J A;  4A6H A;  4K2O A;  1XCG A;  2W2W A;  4K2P A;  1V61 A;  3A8Q A;  1B55 A;  4C0A A;  1RE0 B;  1GC6 A;  2K2U A;  4GMV A;  1MK9 B;  4GXB A;  1DBH A;  2UZR A;  2AEH A;  4KN4 X;  1X1G A;  1FAO A;  1UNP A;  1W1D A;  2VSZ A;  2D9V A;  1V88 A;  3P6A A;  4K17 A;  4WSF A;  5D27 A;  3CIK A;  2W2X D;  1ZC3 B;  1GG3 A;  1K5D B;  2H7D A;  2RGN B;  2N0Y A;  1XR0 B;  4HAZ B;  1U29 A;  3ZDT A;  4XWX A;  2HE7 A;  2I5C A;  3PSC A;  5J3Q A;  2Y8F A;  1FHW A;  4DBB A;  3KY9 A;  4KAX B;  3OAN A;  4BBK A;  3TCA A;  3TW5 A;  3QWM A;  2DN6 A;  1QQG A;  2I1K A;  1MK7 B;  1DYN A;  2RVB B;  5HE0 A;  1OMW A;  3AJC A;  3GYO A;  1PBV A;  1TQZ A;  1BTK A;  2JP2 A;  5CLL B;  1TXD A;  1MIZ B;  2YS3 A;  2RUK B;  2D4Q A;  3V5W A;  4JWL A;  1MIX A;  1Y19 B;  5DHF B;  1DDV A;  3AU5 A;  1MAI A;  1PMS A;  1X11 A;  2M14 A;  2UVM A;  3SWV A;  2VKI A;  4MY6 A;  2D11 A;  1V5M A;  2KCJ A;  2EMT A;  1DDW A;  2RLO A;  3M1I B;  1Z87 A;  4GN1 A;  4P7I A;  4MK0 A;  1R8Q E;  3WA0 A;  4CHJ A;  3ML4 A;  3SUZ A;  5JP4 A;  2ZPY A;  3D8F A;  1LKV X;  1P5T A;  4EMO A;  3GYP A;  3BIN A;  4JMI A;  2YVC A;  3KRX A;  2MKR A;  4HB2 B;  1J19 A;  5KQ1 A;  4FQ0 C;  2K2J A;  3U7D A;  4KHA A;  1SHC A;  3MPX A;  1FHX A;  1H10 A;  5EFX A;  2EMS A;  1KZ7 A;  1BWN A;  2ELB A;  2XQN M;  3SO6 A;  1FGY A;  4PQ0 A;  1ZM0 A;  1U5D A;  2YF0 A;  1MKE A;  5KQ4 A;  1X86 A;  2DKQ A;  3FEH A;  2DYQ A;  1V5U A;  2CRF A;  3IVF A;  2OQB A;  1SGH A;  1Y5O A;  1EVH A;  2LYD A;  1Q8D A;  2J59 M;  2RSG A;  4HAT B;  1QC7 A;  3QBV B;  4JK1 X;  1K5G B;  3TFM A;  1DRO A;  2DFK A;  4CHM A;  3D8D A;  2IYB A;  3LTL A;  2LUL A;  2MWN B;  2KUP A;  2YSZ A;  5C5B A;  2YRY A;  4NY0 A;  4HB3 B;  2VRW B;  3SV1 A;  3SYX A;  2NZ8 B;  5J3Y A;  2K6X A;  1P3R A;  4HAW B;  3NSU A;  4HAV B;  5FI0 A;  3F0W A;  2J0K A;  3PEG A;  5JHG A;  1M7E A;  2R09 A;  1M7R A;  3PVW A;  4EJN A;  1EAZ A;  2X18 A;  2YS1 A;  5CLQ B;  4IOY X;  1UPR A;  5FI1 A;  1BTN A;  3T06 A;  5D3X A;  5KCV A;  2P8V A;  2D9W A;  1WJM A;  1P6S A;  1N3H A;  2DX1 A;  1XSZ A;  1NTY A;  2J0M A;  2NMB A;  1MPH A;  4K81 A;  4HHV A;  1PLS A;  1XKE A;  2D9Z A;  3VIA A;  2R0D A;  2DYN A;  4HDQ A;  1IRS A;  1KU1 A;  1ISN A;  3VOQ A;  4DX9 0;  4OIY A;  2Y7B A;  1AWE A;  5DHA B;  3CXB B;  1GC7 A;  5D3Y A;  4Z2N A;  2QKL A;  1UNR A;  3FM8 C;  2CY4 A;  4Z2M B;  2V76 A;  2YS5 A;  3PVU A;  2COF A;  4A6F A;  4FHR B;  5HE2 A;  4JMO A;  4GZU A;  2D2Q A;  2EJ8 A;  4KHB B;  5DI9 B;  3ODW A;  4HAX B;  2DKP A;  1FHO A;  1U5F A;  3FSS A;  3KRW A;  2I5F A;  3HJL A;  1ZSQ A;  2L2I A;  1NI2 A;  2L1C A;  2Z0P A;  1LW3 A;  2HSN A;  4TYZ A;  2FJL A;  2GCJ A;  1Q67 A;  2ROV A;  2D10 A;  1S9D E;  2COD A;  5LOP B;  4EKU A;  2LOX A;  1WJ1 A;  3ULC A;  3UZT A;  3A8P A;  3MDB C;  4NSW A;  1I2H A;  1EGX A;  5HE3 A;  1XT0 B;  5LON B;  4C7P A;  4L6E A;  2HTH B;  3SNH A;  4WJ7 A;  4GPT B;  3U8Z A;  3ODO A;  4KMU X;  4Y94 A;  3TO1 A;  3TW1 A;  2ROZ B;  4JXH A;  2G35 A;  5C5B B;  4KHO A;  4TKN A;  2ADZ A;  3QIJ A;  4HAU B;  2Q13 A;  3PG7 A;  1KZG A;  1KI1 B;  5JHH A;  2QKM A;  3F5R A;  1EF1 A;  2GS0 A;  2W2X C;  4HAY B;  3N7C A;  2PZ1 A;  3P7Z A;  2DLW A;  2M38 A;  1NTV A;  3SOH B;  2P0D A;  4PNK A;  1WG7 A;  3TVV A;  4F7H A;  3PVL A;  3BJI A;  2KGX B;  3O96 A;  3L8N A;  1FOE A;  3HQC A;  3WYF B;  5J3T A;  1FB8 A;  4HB4 B;  1XOD A;  4D0N B;  2Y8G A;  3ZVR A;  2D9Y A;  2AL6 A;  4MT7 A;  5C79 A;  3HW2 B;  3USY A;  3KZ1 A;  1WGQ A;  2CY5 A;  2H7E A;  1XX0 A;  2N23 A;  1OQN A;  4B6H A;  2GJY A;  4F7G A;  1W1H A;  3HK0 A;  1W1G A;  3PP2 A;  4A6F B;  1UPQ A;  4KVG B;  1RRP B;  3G9W A;  3D8E A;  1E5W A;  2BCJ A;  1BAK A;  1V5P A;  2DHJ A;  4WVF B;  2EC1 A;  3AU4 A;  2K00 A;  2E2X A;  2IFS A;  2CAY A;  1X05 A;  4ZRI A;  4ZRK A;  2ELA A;  3USW A;  1LB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...