1I0EA

Crystal structure of creatine kinase from human muscle
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
374
structure length
365
Chain Sequence
NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human muscle creatine kinase.
pubmed rcsb
molecule tags Transferase
molecule keywords CREATINE KINASE,M CHAIN
total genus 99
structure length 365
sequence length 374
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1i0eA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1i0eA02
4XYCA 4GW0A 1SD0A 3L2EA 4GVYA 3ZXVA 3JU6A 2CRKA 4Z9MA 3B6RA 4RF8A 5J9AA 1M15A 4LNOA 3L2EB 1G0WA 1F1HA 4S0RA 4RF7A 2LGSA 3NG0A 4LNIA 2BVCA 1HTOA 1QK1A 1FPYA 2WGSA 1BG0A 2WHIA 1CRKA 4GW2A 3M10A 3DRBA 4GVZA 3L2DA 4ACFA 3JU5A 3DREA 4RF9A 5J99A 1F52A 4AM1A 4LNNA 4HPPA 4BHLA 3JQ3A 1QH4A 1RL9A 1LGRA 1U6RA 3ZXRA 4BG4B 1P50A 1I0EA 2J1QA 3JPZA 4S17A 1HTQA 1P52A 4RF6A 4BG4A 4LNFA 2GLSA 4Q2RA 4LNKA 1VRPA
chains in the Genus database with same CATH superfamily
1SD0A 4BAXA 3JU6A 2CRKA 4RF8A 1F1HA 2LGSA 1HTOA 1QK1A 1FPYA 3DRBA 2QC8A 4ACFA 3JU5A 4RF9A 4HPPA 3FKYA 3ZXRA 3LVVA 2GWCA 1P50A 1P52A 4LNFA 2GLSA 2OJWA 3B6RA 1M15A 3L2EB 2UU7A 3IG5A 3LN6A 3NG0A 2D32A 1F52A 3JQ3A 1R8GA 1LGRA 2D3BA 1I0EA 2J1QA 3IG8A 1TT4A 1HTQA 2WHIA 2D3AA 2D3CA 2GWDA 4GVYA 4Z9MA 4LNOA 1G0WA 4S0RA 4LNIA 2BVCA 1CRKA 4GW2A 1VA6A 5J99A 4AM1A 1QH4A 1U6RA 4S17A 4RF6A 4BG4A 2D33A 2WGSA 1V4GA 4XYCA 4GW0A 3L2EA 3ZXVA 5J9AA 4RF7A 1BG0A 3LN7A 3M10A 4GVZA 3L2DA 3DREA 4LNNA 4BHLA 1RL9A 3NZTA 3LVWA 4BG4B 3JPZA 4Q2RA 4LNKA 1VRPA
chains in the Genus database with same CATH topology
4XYCA 4GW0A 1SD0A 3L2EA 4GVYA 3ZXVA 3JU6A 2CRKA 4Z9MA 3B6RA 4RF8A 5J9AA 1M15A 4LNOA 3L2EB 1G0WA 1F1HA 4S0RA 4RF7A 2LGSA 3NG0A 4LNIA 2BVCA 1HTOA 1QK1A 1FPYA 2WGSA 1BG0A 2WHIA 1CRKA 4GW2A 3M10A 3DRBA 4GVZA 3L2DA 4ACFA 3JU5A 3DREA 4RF9A 5J99A 1F52A 4AM1A 4LNNA 4HPPA 4BHLA 3JQ3A 1QH4A 1RL9A 1LGRA 1U6RA 3ZXRA 4BG4B 1P50A 1I0EA 2J1QA 3JPZA 4S17A 1HTQA 1P52A 4RF6A 4BG4A 4LNFA 2GLSA 4Q2RA 4LNKA 1VRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYC A;  4GW0 A;  1SD0 A;  3L2E A;  4GVY A;  3ZXV A;  3JU6 A;  2CRK A;  4Z9M A;  3B6R A;  4RF8 A;  5J9A A;  1M15 A;  4LNO A;  3L2E B;  1G0W A;  1F1H A;  4S0R A;  4RF7 A;  2LGS A;  3NG0 A;  4LNI A;  2BVC A;  1HTO A;  1QK1 A;  1FPY A;  2WGS A;  1BG0 A;  2WHI A;  1CRK A;  4GW2 A;  3M10 A;  3DRB A;  4GVZ A;  3L2D A;  4ACF A;  3JU5 A;  3DRE A;  4RF9 A;  5J99 A;  1F52 A;  4AM1 A;  4LNN A;  4HPP A;  4BHL A;  3JQ3 A;  1QH4 A;  1RL9 A;  1LGR A;  1U6R A;  3ZXR A;  4BG4 B;  1P50 A;  1I0E A;  2J1Q A;  3JPZ A;  4S17 A;  1HTQ A;  1P52 A;  4RF6 A;  4BG4 A;  4LNF A;  2GLS A;  4Q2R A;  4LNK A;  1VRP A; 
#chains in the Genus database with same CATH topology
 1SD0 A;  4BAX A;  3JU6 A;  2CRK A;  4RF8 A;  1F1H A;  2LGS A;  1HTO A;  1QK1 A;  1FPY A;  3DRB A;  2QC8 A;  4ACF A;  3JU5 A;  4RF9 A;  4HPP A;  3FKY A;  3ZXR A;  3LVV A;  2GWC A;  1P50 A;  1P52 A;  4LNF A;  2GLS A;  2OJW A;  3B6R A;  1M15 A;  3L2E B;  2UU7 A;  3IG5 A;  3LN6 A;  3NG0 A;  2D32 A;  1F52 A;  3JQ3 A;  1R8G A;  1LGR A;  2D3B A;  1I0E A;  2J1Q A;  3IG8 A;  1TT4 A;  1HTQ A;  2WHI A;  2D3A A;  2D3C A;  2GWD A;  4GVY A;  4Z9M A;  4LNO A;  1G0W A;  4S0R A;  4LNI A;  2BVC A;  1CRK A;  4GW2 A;  1VA6 A;  5J99 A;  4AM1 A;  1QH4 A;  1U6R A;  4S17 A;  4RF6 A;  4BG4 A;  2D33 A;  2WGS A;  1V4G A;  4XYC A;  4GW0 A;  3L2E A;  3ZXV A;  5J9A A;  4RF7 A;  1BG0 A;  3LN7 A;  3M10 A;  4GVZ A;  3L2D A;  3DRE A;  4LNN A;  4BHL A;  1RL9 A;  3NZT A;  3LVW A;  4BG4 B;  3JPZ A;  4Q2R A;  4LNK A;  1VRP A; 
#chains in the Genus database with same CATH homology
 4XYC A;  4GW0 A;  1SD0 A;  3L2E A;  4GVY A;  3ZXV A;  3JU6 A;  2CRK A;  4Z9M A;  3B6R A;  4RF8 A;  5J9A A;  1M15 A;  4LNO A;  3L2E B;  1G0W A;  1F1H A;  4S0R A;  4RF7 A;  2LGS A;  3NG0 A;  4LNI A;  2BVC A;  1HTO A;  1QK1 A;  1FPY A;  2WGS A;  1BG0 A;  2WHI A;  1CRK A;  4GW2 A;  3M10 A;  3DRB A;  4GVZ A;  3L2D A;  4ACF A;  3JU5 A;  3DRE A;  4RF9 A;  5J99 A;  1F52 A;  4AM1 A;  4LNN A;  4HPP A;  4BHL A;  3JQ3 A;  1QH4 A;  1RL9 A;  1LGR A;  1U6R A;  3ZXR A;  4BG4 B;  1P50 A;  1I0E A;  2J1Q A;  3JPZ A;  4S17 A;  1HTQ A;  1P52 A;  4RF6 A;  4BG4 A;  4LNF A;  2GLS A;  4Q2R A;  4LNK A;  1VRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...