1I0EA

Crystal structure of creatine kinase from human muscle
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
374
structure length
365
Chain Sequence
b'NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREATINE KINASE,M CHAIN
publication title Structure of human muscle creatine kinase.
pubmed rcsb
molecule tags Transferase
total genus 99
structure length 365
sequence length 374
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1i0eA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1i0eA02
4S0RA 3L2EB 4XYCA 1M15A 4AM1A 4ACFA 4LNOA 1VRPA 3NG0A 3ZXRA 1BG0A 1F1HA 2WGSA 4RF8A 2LGSA 1I0EA 1RL9A 1HTOA 3JPZA 4Z9MA 4LNNA 1FPYA 2GLSA 3B6RA 4RF6A 3JU5A 4GW0A 2J1QA 1P50A 3DREA 1G0WA 4RF9A 4BG4A 2BVCA 2WHIA 1P52A 3L2EA 4GVZA 4GVYA 4RF7A 5J99A 4LNFA 4BHLA 4LNIA 3JU6A 4GW2A 3M10A 1CRKA 3JQ3A 5J9AA 4BG4B 1QH4A 3L2DA 1LGRA 4LNKA 1HTQA 1F52A 3ZXVA 2CRKA 1SD0A 4S17A 4HPPA 1U6RA 4Q2RA 3DRBA 1QK1A
chains in the Genus database with same CATH superfamily
4S0RA 3L2EB 1M15A 4AM1A 4BAXA 1BG0A 1HTOA 1RL9A 3JPZA 1FPYA 2GLSA 4RF6A 3FKYA 1R8GA 4BG4A 1P52A 4GVYA 3JU6A 1LGRA 1CRKA 4LNKA 4BG4B 1HTQA 1F52A 2D3AA 1SD0A 4S17A 3ZXRA 2WGSA 2GWDA 2LGSA 4Z9MA 2GWCA 3IG8A 4GW0A 1G0WA 2BVCA 5J99A 2D3BA 4BHLA 4LNIA 3JQ3A 5J9AA 2OJWA 1TT4A 2CRKA 4XYCA 4ACFA 4LNOA 1VRPA 3LVWA 1F1HA 1V4GA 3NZTA 1I0EA 2D3CA 3B6RA 3LVVA 3JU5A 2J1QA 1P50A 3DREA 4RF9A 2UU7A 3LN6A 3L2EA 2D32A 1QH4A 3L2DA 3ZXVA 1U6RA 3DRBA 1QK1A 2QC8A 3NG0A 4RF8A 4LNNA 3IG5A 1VA6A 2WHIA 3LN7A 2D33A 4GVZA 4RF7A 4LNFA 4GW2A 3M10A 4HPPA 4Q2RA
chains in the Genus database with same CATH topology
4S0RA 3L2EB 4XYCA 1M15A 4AM1A 4ACFA 4LNOA 1VRPA 3NG0A 3ZXRA 1BG0A 1F1HA 2WGSA 4RF8A 2LGSA 1I0EA 1RL9A 1HTOA 3JPZA 4Z9MA 4LNNA 1FPYA 2GLSA 3B6RA 4RF6A 3JU5A 4GW0A 2J1QA 1P50A 3DREA 1G0WA 4RF9A 4BG4A 2BVCA 2WHIA 1P52A 3L2EA 4GVZA 4GVYA 4RF7A 5J99A 4LNFA 4BHLA 4LNIA 3JU6A 4GW2A 3M10A 1CRKA 3JQ3A 5J9AA 4BG4B 1QH4A 3L2DA 1LGRA 4LNKA 1HTQA 1F52A 3ZXVA 2CRKA 1SD0A 4S17A 4HPPA 1U6RA 4Q2RA 3DRBA 1QK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0R A;  3L2E B;  4XYC A;  1M15 A;  4AM1 A;  4ACF A;  4LNO A;  1VRP A;  3NG0 A;  3ZXR A;  1BG0 A;  1F1H A;  2WGS A;  4RF8 A;  2LGS A;  1I0E A;  1RL9 A;  1HTO A;  3JPZ A;  4Z9M A;  4LNN A;  1FPY A;  2GLS A;  3B6R A;  4RF6 A;  3JU5 A;  4GW0 A;  2J1Q A;  1P50 A;  3DRE A;  1G0W A;  4RF9 A;  4BG4 A;  2BVC A;  2WHI A;  1P52 A;  3L2E A;  4GVZ A;  4GVY A;  4RF7 A;  5J99 A;  4LNF A;  4BHL A;  4LNI A;  3JU6 A;  4GW2 A;  3M10 A;  1CRK A;  3JQ3 A;  5J9A A;  4BG4 B;  1QH4 A;  3L2D A;  1LGR A;  4LNK A;  1HTQ A;  1F52 A;  3ZXV A;  2CRK A;  1SD0 A;  4S17 A;  4HPP A;  1U6R A;  4Q2R A;  3DRB A;  1QK1 A; 
#chains in the Genus database with same CATH topology
 4S0R A;  3L2E B;  1M15 A;  4AM1 A;  4BAX A;  1BG0 A;  1HTO A;  1RL9 A;  3JPZ A;  1FPY A;  2GLS A;  4RF6 A;  3FKY A;  1R8G A;  4BG4 A;  1P52 A;  4GVY A;  3JU6 A;  1LGR A;  1CRK A;  4LNK A;  4BG4 B;  1HTQ A;  1F52 A;  2D3A A;  1SD0 A;  4S17 A;  3ZXR A;  2WGS A;  2GWD A;  2LGS A;  4Z9M A;  2GWC A;  3IG8 A;  4GW0 A;  1G0W A;  2BVC A;  5J99 A;  2D3B A;  4BHL A;  4LNI A;  3JQ3 A;  5J9A A;  2OJW A;  1TT4 A;  2CRK A;  4XYC A;  4ACF A;  4LNO A;  1VRP A;  3LVW A;  1F1H A;  1V4G A;  3NZT A;  1I0E A;  2D3C A;  3B6R A;  3LVV A;  3JU5 A;  2J1Q A;  1P50 A;  3DRE A;  4RF9 A;  2UU7 A;  3LN6 A;  3L2E A;  2D32 A;  1QH4 A;  3L2D A;  3ZXV A;  1U6R A;  3DRB A;  1QK1 A;  2QC8 A;  3NG0 A;  4RF8 A;  4LNN A;  3IG5 A;  1VA6 A;  2WHI A;  3LN7 A;  2D33 A;  4GVZ A;  4RF7 A;  4LNF A;  4GW2 A;  3M10 A;  4HPP A;  4Q2R A; 
#chains in the Genus database with same CATH homology
 4S0R A;  3L2E B;  4XYC A;  1M15 A;  4AM1 A;  4ACF A;  4LNO A;  1VRP A;  3NG0 A;  3ZXR A;  1BG0 A;  1F1H A;  2WGS A;  4RF8 A;  2LGS A;  1I0E A;  1RL9 A;  1HTO A;  3JPZ A;  4Z9M A;  4LNN A;  1FPY A;  2GLS A;  3B6R A;  4RF6 A;  3JU5 A;  4GW0 A;  2J1Q A;  1P50 A;  3DRE A;  1G0W A;  4RF9 A;  4BG4 A;  2BVC A;  2WHI A;  1P52 A;  3L2E A;  4GVZ A;  4GVY A;  4RF7 A;  5J99 A;  4LNF A;  4BHL A;  4LNI A;  3JU6 A;  4GW2 A;  3M10 A;  1CRK A;  3JQ3 A;  5J9A A;  4BG4 B;  1QH4 A;  3L2D A;  1LGR A;  4LNK A;  1HTQ A;  1F52 A;  3ZXV A;  2CRK A;  1SD0 A;  4S17 A;  4HPP A;  1U6R A;  4Q2R A;  3DRB A;  1QK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...