3DREA

Crystal structure of human brain-type creatine kinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
378
structure length
378
Chain Sequence
b'SNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Creatine kinase B-type
publication title Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 378
sequence length 378
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3dreA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3dreA02
4HPPA 4LNOA 1HTOA 3L2EB 3JQ3A 4RF9A 4RF8A 4RF7A 4LNNA 3DRBA 1F1HA 2BVCA 1P52A 2WGSA 3JPZA 4LNFA 4S0RA 4S17A 2WHIA 1F52A 4RF6A 4Z9MA 4LNKA 1HTQA 5J99A 2LGSA 2CRKA 3M10A 3ZXVA 5J9AA 2J1QA 1LGRA 1QH4A 3NG0A 4BHLA 3DREA 4BG4A 1G0WA 3L2EA 4AM1A 4XYCA 1M15A 3ZXRA 3L2DA 1RL9A 1VRPA 4GW2A 4Q2RA 4GVZA 3JU6A 2GLSA 1QK1A 3JU5A 1BG0A 1SD0A 1P50A 1CRKA 4GW0A 4ACFA 1FPYA 4GVYA 4LNIA 3B6RA 1I0EA 4BG4B 1U6RA
chains in the Genus database with same CATH superfamily
4RF7A 3DRBA 1F1HA 2BVCA 2WGSA 4LNFA 1F52A 4LNKA 3M10A 3NZTA 3L2DA 4GVZA 1FPYA 1U6RA 4HPPA 3JQ3A 1TT4A 2D33A 3JPZA 2D32A 4BAXA 4Z9MA 2QC8A 2LGSA 3ZXVA 3NG0A 2OJWA 3DREA 4BG4A 3IG8A 2UU7A 4GW2A 3JU5A 3FKYA 3LVWA 1I0EA 2GWCA 2D3BA 3L2EB 4RF8A 4S17A 2WHIA 4RF6A 1HTQA 5J99A 2CRKA 2J1QA 1QH4A 4XYCA 4AM1A 1V4GA 1M15A 2GWDA 3ZXRA 1RL9A 1VRPA 4Q2RA 1QK1A 1BG0A 1SD0A 1CRKA 4ACFA 4GVYA 3LN6A 4LNIA 4BG4B 4BHLA 2D3CA 4LNOA 1HTOA 4RF9A 4LNNA 3LVVA 1VA6A 4S0RA 1R8GA 5J9AA 1LGRA 1G0WA 3L2EA 2GLSA 3JU6A 1P50A 2D3AA 4GW0A 3B6RA 3IG5A 1P52A 3LN7A
chains in the Genus database with same CATH topology
4HPPA 4LNOA 1HTOA 3L2EB 3JQ3A 4RF9A 4RF8A 4RF7A 4LNNA 3DRBA 1F1HA 2BVCA 1P52A 2WGSA 3JPZA 4LNFA 4S0RA 4S17A 2WHIA 1F52A 4RF6A 4Z9MA 4LNKA 1HTQA 5J99A 2LGSA 2CRKA 3M10A 3ZXVA 5J9AA 2J1QA 1LGRA 1QH4A 3NG0A 4BHLA 3DREA 4BG4A 1G0WA 3L2EA 4AM1A 4XYCA 1M15A 3ZXRA 3L2DA 1RL9A 1VRPA 4GW2A 4Q2RA 4GVZA 3JU6A 2GLSA 1QK1A 3JU5A 1BG0A 1SD0A 1P50A 1CRKA 4GW0A 4ACFA 1FPYA 4GVYA 4LNIA 3B6RA 1I0EA 4BG4B 1U6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPP A;  4LNO A;  1HTO A;  3L2E B;  3JQ3 A;  4RF9 A;  4RF8 A;  4RF7 A;  4LNN A;  3DRB A;  1F1H A;  2BVC A;  1P52 A;  2WGS A;  3JPZ A;  4LNF A;  4S0R A;  4S17 A;  2WHI A;  1F52 A;  4RF6 A;  4Z9M A;  4LNK A;  1HTQ A;  5J99 A;  2LGS A;  2CRK A;  3M10 A;  3ZXV A;  5J9A A;  2J1Q A;  1LGR A;  1QH4 A;  3NG0 A;  4BHL A;  3DRE A;  4BG4 A;  1G0W A;  3L2E A;  4AM1 A;  4XYC A;  1M15 A;  3ZXR A;  3L2D A;  1RL9 A;  1VRP A;  4GW2 A;  4Q2R A;  4GVZ A;  3JU6 A;  2GLS A;  1QK1 A;  3JU5 A;  1BG0 A;  1SD0 A;  1P50 A;  1CRK A;  4GW0 A;  4ACF A;  1FPY A;  4GVY A;  4LNI A;  3B6R A;  1I0E A;  4BG4 B;  1U6R A; 
#chains in the Genus database with same CATH topology
 4RF7 A;  3DRB A;  1F1H A;  2BVC A;  2WGS A;  4LNF A;  1F52 A;  4LNK A;  3M10 A;  3NZT A;  3L2D A;  4GVZ A;  1FPY A;  1U6R A;  4HPP A;  3JQ3 A;  1TT4 A;  2D33 A;  3JPZ A;  2D32 A;  4BAX A;  4Z9M A;  2QC8 A;  2LGS A;  3ZXV A;  3NG0 A;  2OJW A;  3DRE A;  4BG4 A;  3IG8 A;  2UU7 A;  4GW2 A;  3JU5 A;  3FKY A;  3LVW A;  1I0E A;  2GWC A;  2D3B A;  3L2E B;  4RF8 A;  4S17 A;  2WHI A;  4RF6 A;  1HTQ A;  5J99 A;  2CRK A;  2J1Q A;  1QH4 A;  4XYC A;  4AM1 A;  1V4G A;  1M15 A;  2GWD A;  3ZXR A;  1RL9 A;  1VRP A;  4Q2R A;  1QK1 A;  1BG0 A;  1SD0 A;  1CRK A;  4ACF A;  4GVY A;  3LN6 A;  4LNI A;  4BG4 B;  4BHL A;  2D3C A;  4LNO A;  1HTO A;  4RF9 A;  4LNN A;  3LVV A;  1VA6 A;  4S0R A;  1R8G A;  5J9A A;  1LGR A;  1G0W A;  3L2E A;  2GLS A;  3JU6 A;  1P50 A;  2D3A A;  4GW0 A;  3B6R A;  3IG5 A;  1P52 A;  3LN7 A; 
#chains in the Genus database with same CATH homology
 4HPP A;  4LNO A;  1HTO A;  3L2E B;  3JQ3 A;  4RF9 A;  4RF8 A;  4RF7 A;  4LNN A;  3DRB A;  1F1H A;  2BVC A;  1P52 A;  2WGS A;  3JPZ A;  4LNF A;  4S0R A;  4S17 A;  2WHI A;  1F52 A;  4RF6 A;  4Z9M A;  4LNK A;  1HTQ A;  5J99 A;  2LGS A;  2CRK A;  3M10 A;  3ZXV A;  5J9A A;  2J1Q A;  1LGR A;  1QH4 A;  3NG0 A;  4BHL A;  3DRE A;  4BG4 A;  1G0W A;  3L2E A;  4AM1 A;  4XYC A;  1M15 A;  3ZXR A;  3L2D A;  1RL9 A;  1VRP A;  4GW2 A;  4Q2R A;  4GVZ A;  3JU6 A;  2GLS A;  1QK1 A;  3JU5 A;  1BG0 A;  1SD0 A;  1P50 A;  1CRK A;  4GW0 A;  4ACF A;  1FPY A;  4GVY A;  4LNI A;  3B6R A;  1I0E A;  4BG4 B;  1U6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...