1QK1A

Crystal structure of human ubiquitous mitochondrial creatine kinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
379
structure length
379
Chain Sequence
AASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREATINE KINASE, UBIQUITOUS MITOCHONDRIAL
publication title Crystal Structure of Human Ubiquitous Mitochondrial Creatine Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase (creatine kinase)
total genus 130
structure length 379
sequence length 379
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1qk1A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1qk1A02
3ZXRA 1F1HA 3DREA 4RF8A 4RF9A 4BG4B 1P50A 1LGRA 2GLSA 3NG0A 1I0EA 4LNNA 4LNOA 4AM1A 4ACFA 1U6RA 3L2EB 1QH4A 3L2DA 4Q2RA 1FPYA 2WGSA 3B6RA 2WHIA 1G0WA 4Z9MA 1P52A 1QK1A 1VRPA 4S17A 3M10A 4LNKA 3JU5A 3ZXVA 4XYCA 1BG0A 4RF6A 3DRBA 1RL9A 3JQ3A 4HPPA 4S0RA 4GVYA 1F52A 4BG4A 3JU6A 4LNIA 1HTOA 3L2EA 2CRKA 5J99A 4GVZA 1SD0A 4LNFA 1M15A 4BHLA 1CRKA 4RF7A 2LGSA 3JPZA 4GW2A 2BVCA 2J1QA 5J9AA 4GW0A 1HTQA
chains in the Genus database with same CATH superfamily
1F1HA 4BG4B 3L2EB 2WHIA 4Q2RA 3LN7A 1R8GA 2UU7A 4S17A 3FKYA 4BAXA 3M10A 4RF6A 2QC8A 4GVYA 3NZTA 3LN6A 4GVZA 2D33A 5J9AA 3ZXRA 4RF9A 3NG0A 1QH4A 3B6RA 1G0WA 2GWDA 3JU5A 4XYCA 3JQ3A 4S0RA 1F52A 3LVVA 1SD0A 4BHLA 2GWCA 2LGSA 2D3AA 2D3CA 4GW0A 3DREA 4RF8A 2GLSA 4LNOA 4ACFA 1U6RA 3L2DA 1FPYA 2D32A 1P52A 1QK1A 3ZXVA 1V4GA 1BG0A 1RL9A 4BG4A 3L2EA 4LNFA 1M15A 4RF7A 3JPZA 2BVCA 1HTQA 1LGRA 4LNNA 1P50A 2OJWA 1I0EA 4AM1A 2WGSA 1VA6A 4Z9MA 1VRPA 4LNKA 2D3BA 3IG8A 3DRBA 4HPPA 3JU6A 4LNIA 1HTOA 2CRKA 5J99A 1TT4A 3IG5A 1CRKA 4GW2A 2J1QA 3LVWA
chains in the Genus database with same CATH topology
3ZXRA 1F1HA 3DREA 4RF8A 4RF9A 4BG4B 1P50A 1LGRA 2GLSA 3NG0A 1I0EA 4LNNA 4LNOA 4AM1A 4ACFA 1U6RA 3L2EB 1QH4A 3L2DA 4Q2RA 1FPYA 2WGSA 3B6RA 2WHIA 1G0WA 4Z9MA 1P52A 1QK1A 1VRPA 4S17A 3M10A 4LNKA 3JU5A 3ZXVA 4XYCA 1BG0A 4RF6A 3DRBA 1RL9A 3JQ3A 4HPPA 4S0RA 4GVYA 1F52A 4BG4A 3JU6A 4LNIA 1HTOA 3L2EA 2CRKA 5J99A 4GVZA 1SD0A 4LNFA 1M15A 4BHLA 1CRKA 4RF7A 2LGSA 3JPZA 4GW2A 2BVCA 2J1QA 5J9AA 4GW0A 1HTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXR A;  1F1H A;  3DRE A;  4RF8 A;  4RF9 A;  4BG4 B;  1P50 A;  1LGR A;  2GLS A;  3NG0 A;  1I0E A;  4LNN A;  4LNO A;  4AM1 A;  4ACF A;  1U6R A;  3L2E B;  1QH4 A;  3L2D A;  4Q2R A;  1FPY A;  2WGS A;  3B6R A;  2WHI A;  1G0W A;  4Z9M A;  1P52 A;  1QK1 A;  1VRP A;  4S17 A;  3M10 A;  4LNK A;  3JU5 A;  3ZXV A;  4XYC A;  1BG0 A;  4RF6 A;  3DRB A;  1RL9 A;  3JQ3 A;  4HPP A;  4S0R A;  4GVY A;  1F52 A;  4BG4 A;  3JU6 A;  4LNI A;  1HTO A;  3L2E A;  2CRK A;  5J99 A;  4GVZ A;  1SD0 A;  4LNF A;  1M15 A;  4BHL A;  1CRK A;  4RF7 A;  2LGS A;  3JPZ A;  4GW2 A;  2BVC A;  2J1Q A;  5J9A A;  4GW0 A;  1HTQ A; 
#chains in the Genus database with same CATH topology
 1F1H A;  4BG4 B;  3L2E B;  2WHI A;  4Q2R A;  3LN7 A;  1R8G A;  2UU7 A;  4S17 A;  3FKY A;  4BAX A;  3M10 A;  4RF6 A;  2QC8 A;  4GVY A;  3NZT A;  3LN6 A;  4GVZ A;  2D33 A;  5J9A A;  3ZXR A;  4RF9 A;  3NG0 A;  1QH4 A;  3B6R A;  1G0W A;  2GWD A;  3JU5 A;  4XYC A;  3JQ3 A;  4S0R A;  1F52 A;  3LVV A;  1SD0 A;  4BHL A;  2GWC A;  2LGS A;  2D3A A;  2D3C A;  4GW0 A;  3DRE A;  4RF8 A;  2GLS A;  4LNO A;  4ACF A;  1U6R A;  3L2D A;  1FPY A;  2D32 A;  1P52 A;  1QK1 A;  3ZXV A;  1V4G A;  1BG0 A;  1RL9 A;  4BG4 A;  3L2E A;  4LNF A;  1M15 A;  4RF7 A;  3JPZ A;  2BVC A;  1HTQ A;  1LGR A;  4LNN A;  1P50 A;  2OJW A;  1I0E A;  4AM1 A;  2WGS A;  1VA6 A;  4Z9M A;  1VRP A;  4LNK A;  2D3B A;  3IG8 A;  3DRB A;  4HPP A;  3JU6 A;  4LNI A;  1HTO A;  2CRK A;  5J99 A;  1TT4 A;  3IG5 A;  1CRK A;  4GW2 A;  2J1Q A;  3LVW A; 
#chains in the Genus database with same CATH homology
 3ZXR A;  1F1H A;  3DRE A;  4RF8 A;  4RF9 A;  4BG4 B;  1P50 A;  1LGR A;  2GLS A;  3NG0 A;  1I0E A;  4LNN A;  4LNO A;  4AM1 A;  4ACF A;  1U6R A;  3L2E B;  1QH4 A;  3L2D A;  4Q2R A;  1FPY A;  2WGS A;  3B6R A;  2WHI A;  1G0W A;  4Z9M A;  1P52 A;  1QK1 A;  1VRP A;  4S17 A;  3M10 A;  4LNK A;  3JU5 A;  3ZXV A;  4XYC A;  1BG0 A;  4RF6 A;  3DRB A;  1RL9 A;  3JQ3 A;  4HPP A;  4S0R A;  4GVY A;  1F52 A;  4BG4 A;  3JU6 A;  4LNI A;  1HTO A;  3L2E A;  2CRK A;  5J99 A;  4GVZ A;  1SD0 A;  4LNF A;  1M15 A;  4BHL A;  1CRK A;  4RF7 A;  2LGS A;  3JPZ A;  4GW2 A;  2BVC A;  2J1Q A;  5J9A A;  4GW0 A;  1HTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...