1QK1A

Crystal structure of human ubiquitous mitochondrial creatine kinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
379
structure length
379
Chain Sequence
b'AASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREATINE KINASE, UBIQUITOUS MITOCHONDRIAL
publication title Crystal Structure of Human Ubiquitous Mitochondrial Creatine Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase (creatine kinase)
total genus 130
structure length 379
sequence length 379
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1qk1A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1qk1A02
3M10A 1I0EA 3JPZA 3DREA 1QK1A 2CRKA 3NG0A 1G0WA 3DRBA 4Q2RA 1P50A 4LNOA 1F1HA 1P52A 1U6RA 1BG0A 4GVZA 3JU5A 4HPPA 4RF7A 4LNIA 2BVCA 4LNKA 3JU6A 1HTOA 2WGSA 3ZXVA 1M15A 3JQ3A 2J1QA 1SD0A 1VRPA 4RF9A 4BG4B 4BG4A 2GLSA 1QH4A 1LGRA 2WHIA 4GW2A 1CRKA 1RL9A 3L2DA 1F52A 4BHLA 4LNNA 1HTQA 5J9AA 3B6RA 4GW0A 4RF6A 4LNFA 5J99A 3L2EB 4ACFA 3L2EA 2LGSA 4AM1A 4S17A 4S0RA 4Z9MA 4RF8A 1FPYA 4XYCA 3ZXRA 4GVYA
chains in the Genus database with same CATH superfamily
1G0WA 3DRBA 1P52A 1U6RA 2GWDA 4LNIA 2BVCA 2D3CA 2GWCA 3IG5A 4BG4B 3L2DA 1HTQA 3LN7A 2D3AA 5J99A 3L2EB 4ACFA 4XYCA 3ZXRA 3JPZA 3NG0A 4Q2RA 1R8GA 1BG0A 4GVZA 3JU5A 4HPPA 4RF7A 4LNKA 3LN6A 2WGSA 1M15A 3JQ3A 3IG8A 4GW2A 2OJWA 4LNNA 3B6RA 4LNFA 4S0RA 4GVYA 1I0EA 3NZTA 2CRKA 2UU7A 1P50A 4LNOA 2D32A 3LVVA 2J1QA 1VRPA 4BG4A 2GLSA 1QH4A 1LGRA 1CRKA 1F52A 5J9AA 3L2EA 2LGSA 4AM1A 3M10A 3FKYA 3DREA 1QK1A 1F1HA 2D33A 3LVWA 3JU6A 1HTOA 3ZXVA 1SD0A 4RF9A 2WHIA 1RL9A 4BAXA 4BHLA 4RF6A 4GW0A 2QC8A 2D3BA 1V4GA 4S17A 4Z9MA 1TT4A 4RF8A 1FPYA 1VA6A
chains in the Genus database with same CATH topology
3M10A 1I0EA 3JPZA 3DREA 1QK1A 2CRKA 3NG0A 1G0WA 3DRBA 4Q2RA 1P50A 4LNOA 1F1HA 1P52A 1U6RA 1BG0A 4GVZA 3JU5A 4HPPA 4RF7A 4LNIA 2BVCA 4LNKA 3JU6A 1HTOA 2WGSA 3ZXVA 1M15A 3JQ3A 2J1QA 1SD0A 1VRPA 4RF9A 4BG4B 4BG4A 2GLSA 1QH4A 1LGRA 2WHIA 4GW2A 1CRKA 1RL9A 3L2DA 1F52A 4BHLA 4LNNA 1HTQA 5J9AA 3B6RA 4GW0A 4RF6A 4LNFA 5J99A 3L2EB 4ACFA 3L2EA 2LGSA 4AM1A 4S17A 4S0RA 4Z9MA 4RF8A 1FPYA 4XYCA 3ZXRA 4GVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M10 A;  1I0E A;  3JPZ A;  3DRE A;  1QK1 A;  2CRK A;  3NG0 A;  1G0W A;  3DRB A;  4Q2R A;  1P50 A;  4LNO A;  1F1H A;  1P52 A;  1U6R A;  1BG0 A;  4GVZ A;  3JU5 A;  4HPP A;  4RF7 A;  4LNI A;  2BVC A;  4LNK A;  3JU6 A;  1HTO A;  2WGS A;  3ZXV A;  1M15 A;  3JQ3 A;  2J1Q A;  1SD0 A;  1VRP A;  4RF9 A;  4BG4 B;  4BG4 A;  2GLS A;  1QH4 A;  1LGR A;  2WHI A;  4GW2 A;  1CRK A;  1RL9 A;  3L2D A;  1F52 A;  4BHL A;  4LNN A;  1HTQ A;  5J9A A;  3B6R A;  4GW0 A;  4RF6 A;  4LNF A;  5J99 A;  3L2E B;  4ACF A;  3L2E A;  2LGS A;  4AM1 A;  4S17 A;  4S0R A;  4Z9M A;  4RF8 A;  1FPY A;  4XYC A;  3ZXR A;  4GVY A; 
#chains in the Genus database with same CATH topology
 1G0W A;  3DRB A;  1P52 A;  1U6R A;  2GWD A;  4LNI A;  2BVC A;  2D3C A;  2GWC A;  3IG5 A;  4BG4 B;  3L2D A;  1HTQ A;  3LN7 A;  2D3A A;  5J99 A;  3L2E B;  4ACF A;  4XYC A;  3ZXR A;  3JPZ A;  3NG0 A;  4Q2R A;  1R8G A;  1BG0 A;  4GVZ A;  3JU5 A;  4HPP A;  4RF7 A;  4LNK A;  3LN6 A;  2WGS A;  1M15 A;  3JQ3 A;  3IG8 A;  4GW2 A;  2OJW A;  4LNN A;  3B6R A;  4LNF A;  4S0R A;  4GVY A;  1I0E A;  3NZT A;  2CRK A;  2UU7 A;  1P50 A;  4LNO A;  2D32 A;  3LVV A;  2J1Q A;  1VRP A;  4BG4 A;  2GLS A;  1QH4 A;  1LGR A;  1CRK A;  1F52 A;  5J9A A;  3L2E A;  2LGS A;  4AM1 A;  3M10 A;  3FKY A;  3DRE A;  1QK1 A;  1F1H A;  2D33 A;  3LVW A;  3JU6 A;  1HTO A;  3ZXV A;  1SD0 A;  4RF9 A;  2WHI A;  1RL9 A;  4BAX A;  4BHL A;  4RF6 A;  4GW0 A;  2QC8 A;  2D3B A;  1V4G A;  4S17 A;  4Z9M A;  1TT4 A;  4RF8 A;  1FPY A;  1VA6 A; 
#chains in the Genus database with same CATH homology
 3M10 A;  1I0E A;  3JPZ A;  3DRE A;  1QK1 A;  2CRK A;  3NG0 A;  1G0W A;  3DRB A;  4Q2R A;  1P50 A;  4LNO A;  1F1H A;  1P52 A;  1U6R A;  1BG0 A;  4GVZ A;  3JU5 A;  4HPP A;  4RF7 A;  4LNI A;  2BVC A;  4LNK A;  3JU6 A;  1HTO A;  2WGS A;  3ZXV A;  1M15 A;  3JQ3 A;  2J1Q A;  1SD0 A;  1VRP A;  4RF9 A;  4BG4 B;  4BG4 A;  2GLS A;  1QH4 A;  1LGR A;  2WHI A;  4GW2 A;  1CRK A;  1RL9 A;  3L2D A;  1F52 A;  4BHL A;  4LNN A;  1HTQ A;  5J9A A;  3B6R A;  4GW0 A;  4RF6 A;  4LNF A;  5J99 A;  3L2E B;  4ACF A;  3L2E A;  2LGS A;  4AM1 A;  4S17 A;  4S0R A;  4Z9M A;  4RF8 A;  1FPY A;  4XYC A;  3ZXR A;  4GVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...