1QK1A

Crystal structure of human ubiquitous mitochondrial creatine kinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
379
structure length
379
Chain Sequence
AASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Ubiquitous Mitochondrial Creatine Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase (creatine kinase)
molecule keywords CREATINE KINASE, UBIQUITOUS MITOCHONDRIAL
total genus 130
structure length 379
sequence length 379
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1qk1A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1qk1A02
4BHLA 3L2EA 1LGRA 1I0EA 4BG4A 3L2EB 2J1QA 1QH4A 4HPPA 1U6RA 2CRKA 3JU6A 4BG4B 3NG0A 1P52A 5J9AA 4LNFA 4GW0A 1RL9A 2LGSA 3JU5A 3ZXVA 3JPZA 1M15A 4RF7A 3DREA 4RF6A 4LNKA 2BVCA 4GVYA 1HTOA 1QK1A 4AM1A 4RF8A 4LNIA 2WHIA 1VRPA 4LNNA 1SD0A 4RF9A 3DRBA 4GVZA 3M10A 4Z9MA 5J99A 2GLSA 1F1HA 2WGSA 1G0WA 4S17A 1CRKA 3B6RA 1P50A 3JQ3A 1FPYA 3ZXRA 4XYCA 4Q2RA 1F52A 1BG0A 1HTQA 4S0RA 3L2DA 4GW2A 4ACFA 4LNOA
chains in the Genus database with same CATH superfamily
3L2EA 1I0EA 1QH4A 4HPPA 4BG4B 2LGSA 3JU5A 2GWDA 3IG5A 2OJWA 4LNNA 1TT4A 3DRBA 2D3CA 2UU7A 4Z9MA 2WGSA 2GLSA 1G0WA 1F52A 4S0RA 4BG4A 1U6RA 2CRKA 3JU6A 3ZXVA 4GW0A 1RL9A 4RF7A 3DREA 2BVCA 4GVYA 4RF8A 2D3AA 3IG8A 1SD0A 4RF9A 3FKYA 3M10A 3ZXRA 3B6RA 4Q2RA 3LVWA 4ACFA 3L2EB 3NZTA 3NG0A 5J9AA 3JPZA 1M15A 1HTOA 4AM1A 2D32A 4LNIA 2WHIA 1VRPA 2GWCA 5J99A 1V4GA 1F1HA 1CRKA 1FPYA 3JQ3A 1HTQA 4XYCA 4GW2A 4LNOA 4BHLA 1LGRA 2J1QA 1P52A 4LNFA 4RF6A 4LNKA 1QK1A 2QC8A 3LN7A 4BAXA 3LN6A 4GVZA 2D3BA 3LVVA 4S17A 1VA6A 1P50A 1R8GA 1BG0A 3L2DA 2D33A
chains in the Genus database with same CATH topology
4BHLA 3L2EA 1LGRA 1I0EA 4BG4A 3L2EB 2J1QA 1QH4A 4HPPA 1U6RA 2CRKA 3JU6A 4BG4B 3NG0A 1P52A 5J9AA 4LNFA 4GW0A 1RL9A 2LGSA 3JU5A 3ZXVA 3JPZA 1M15A 4RF7A 3DREA 4RF6A 4LNKA 2BVCA 4GVYA 1HTOA 1QK1A 4AM1A 4RF8A 4LNIA 2WHIA 1VRPA 4LNNA 1SD0A 4RF9A 3DRBA 4GVZA 3M10A 4Z9MA 5J99A 2GLSA 1F1HA 2WGSA 1G0WA 4S17A 1CRKA 3B6RA 1P50A 3JQ3A 1FPYA 3ZXRA 4XYCA 4Q2RA 1F52A 1BG0A 1HTQA 4S0RA 3L2DA 4GW2A 4ACFA 4LNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHL A;  3L2E A;  1LGR A;  1I0E A;  4BG4 A;  3L2E B;  2J1Q A;  1QH4 A;  4HPP A;  1U6R A;  2CRK A;  3JU6 A;  4BG4 B;  3NG0 A;  1P52 A;  5J9A A;  4LNF A;  4GW0 A;  1RL9 A;  2LGS A;  3JU5 A;  3ZXV A;  3JPZ A;  1M15 A;  4RF7 A;  3DRE A;  4RF6 A;  4LNK A;  2BVC A;  4GVY A;  1HTO A;  1QK1 A;  4AM1 A;  4RF8 A;  4LNI A;  2WHI A;  1VRP A;  4LNN A;  1SD0 A;  4RF9 A;  3DRB A;  4GVZ A;  3M10 A;  4Z9M A;  5J99 A;  2GLS A;  1F1H A;  2WGS A;  1G0W A;  4S17 A;  1CRK A;  3B6R A;  1P50 A;  3JQ3 A;  1FPY A;  3ZXR A;  4XYC A;  4Q2R A;  1F52 A;  1BG0 A;  1HTQ A;  4S0R A;  3L2D A;  4GW2 A;  4ACF A;  4LNO A; 
#chains in the Genus database with same CATH topology
 3L2E A;  1I0E A;  1QH4 A;  4HPP A;  4BG4 B;  2LGS A;  3JU5 A;  2GWD A;  3IG5 A;  2OJW A;  4LNN A;  1TT4 A;  3DRB A;  2D3C A;  2UU7 A;  4Z9M A;  2WGS A;  2GLS A;  1G0W A;  1F52 A;  4S0R A;  4BG4 A;  1U6R A;  2CRK A;  3JU6 A;  3ZXV A;  4GW0 A;  1RL9 A;  4RF7 A;  3DRE A;  2BVC A;  4GVY A;  4RF8 A;  2D3A A;  3IG8 A;  1SD0 A;  4RF9 A;  3FKY A;  3M10 A;  3ZXR A;  3B6R A;  4Q2R A;  3LVW A;  4ACF A;  3L2E B;  3NZT A;  3NG0 A;  5J9A A;  3JPZ A;  1M15 A;  1HTO A;  4AM1 A;  2D32 A;  4LNI A;  2WHI A;  1VRP A;  2GWC A;  5J99 A;  1V4G A;  1F1H A;  1CRK A;  1FPY A;  3JQ3 A;  1HTQ A;  4XYC A;  4GW2 A;  4LNO A;  4BHL A;  1LGR A;  2J1Q A;  1P52 A;  4LNF A;  4RF6 A;  4LNK A;  1QK1 A;  2QC8 A;  3LN7 A;  4BAX A;  3LN6 A;  4GVZ A;  2D3B A;  3LVV A;  4S17 A;  1VA6 A;  1P50 A;  1R8G A;  1BG0 A;  3L2D A;  2D33 A; 
#chains in the Genus database with same CATH homology
 4BHL A;  3L2E A;  1LGR A;  1I0E A;  4BG4 A;  3L2E B;  2J1Q A;  1QH4 A;  4HPP A;  1U6R A;  2CRK A;  3JU6 A;  4BG4 B;  3NG0 A;  1P52 A;  5J9A A;  4LNF A;  4GW0 A;  1RL9 A;  2LGS A;  3JU5 A;  3ZXV A;  3JPZ A;  1M15 A;  4RF7 A;  3DRE A;  4RF6 A;  4LNK A;  2BVC A;  4GVY A;  1HTO A;  1QK1 A;  4AM1 A;  4RF8 A;  4LNI A;  2WHI A;  1VRP A;  4LNN A;  1SD0 A;  4RF9 A;  3DRB A;  4GVZ A;  3M10 A;  4Z9M A;  5J99 A;  2GLS A;  1F1H A;  2WGS A;  1G0W A;  4S17 A;  1CRK A;  3B6R A;  1P50 A;  3JQ3 A;  1FPY A;  3ZXR A;  4XYC A;  4Q2R A;  1F52 A;  1BG0 A;  1HTQ A;  4S0R A;  3L2D A;  4GW2 A;  4ACF A;  4LNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...