1QH4A

Crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
b'PFSNSHNLLKMKYSVDDEYPDLSVHNNHMAKVLTLDLYKKLRDRQTSSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPVIEDRHGGYKPTDEHKTDLNADNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLGGDLKGKYYALRNMTDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFGEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEKRLEKGQSIDDLMPAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREATINE KINASE
publication title Crystal structure of brain-type creatine kinase at 1.41 A resolution.
pubmed rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 138
structure length 380
sequence length 380
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1999-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1qh4A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1qh4A02
2WHIA 4RF8A 2BVCA 3JPZA 4S0RA 4GVZA 2J1QA 4BHLA 2LGSA 1U6RA 4LNKA 3B6RA 4Z9MA 3L2EB 4GW0A 1FPYA 3M10A 4RF9A 1P50A 5J9AA 3NG0A 1BG0A 4HPPA 4S17A 1CRKA 1P52A 4ACFA 1HTQA 1F52A 3L2EA 1G0WA 4LNOA 4LNNA 1HTOA 3DREA 3DRBA 4Q2RA 1VRPA 1QK1A 5J99A 4BG4B 3JU6A 3JQ3A 3ZXRA 2GLSA 4GW2A 1M15A 4BG4A 1F1HA 4LNIA 4XYCA 1RL9A 1LGRA 4RF7A 1I0EA 4RF6A 4LNFA 4AM1A 2WGSA 3ZXVA 1QH4A 4GVYA 1SD0A 3JU5A 3L2DA 2CRKA
chains in the Genus database with same CATH superfamily
3IG5A 3LN6A 4GVZA 2OJWA 1P50A 2UU7A 4S17A 3FKYA 4LNOA 4LNNA 1HTOA 3DREA 1VRPA 5J99A 2GLSA 4GW2A 1M15A 4LNIA 1I0EA 1QH4A 3L2DA 2CRKA 4RF8A 2J1QA 4BHLA 2D3CA 4Z9MA 4RF9A 4ACFA 2D3AA 1HTQA 3L2EA 2D32A 4Q2RA 1QK1A 3ZXRA 1VA6A 1R8GA 1RL9A 4AM1A 3IG8A 4GVYA 4BAXA 3ZXVA 2BVCA 2D3BA 1U6RA 4LNKA 3B6RA 4GW0A 1FPYA 3M10A 3LVVA 5J9AA 3NG0A 4HPPA 2QC8A 1F52A 3LVWA 4BG4B 3JQ3A 1F1HA 2GWDA 4RF7A 4RF6A 1V4GA 2WGSA 2GWCA 2WHIA 3JPZA 4S0RA 2LGSA 3NZTA 3L2EB 2D33A 1BG0A 1CRKA 1P52A 1G0WA 1TT4A 3DRBA 3LN7A 3JU6A 4BG4A 4XYCA 1LGRA 4LNFA 1SD0A 3JU5A
chains in the Genus database with same CATH topology
2WHIA 4RF8A 2BVCA 3JPZA 4S0RA 4GVZA 2J1QA 4BHLA 2LGSA 1U6RA 4LNKA 3B6RA 4Z9MA 3L2EB 4GW0A 1FPYA 3M10A 4RF9A 1P50A 5J9AA 3NG0A 1BG0A 4HPPA 4S17A 1CRKA 1P52A 4ACFA 1HTQA 1F52A 3L2EA 1G0WA 4LNOA 4LNNA 1HTOA 3DREA 3DRBA 4Q2RA 1VRPA 1QK1A 5J99A 4BG4B 3JU6A 3JQ3A 3ZXRA 2GLSA 4GW2A 1M15A 4BG4A 1F1HA 4LNIA 4XYCA 1RL9A 1LGRA 4RF7A 1I0EA 4RF6A 4LNFA 4AM1A 2WGSA 3ZXVA 1QH4A 4GVYA 1SD0A 3JU5A 3L2DA 2CRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHI A;  4RF8 A;  2BVC A;  3JPZ A;  4S0R A;  4GVZ A;  2J1Q A;  4BHL A;  2LGS A;  1U6R A;  4LNK A;  3B6R A;  4Z9M A;  3L2E B;  4GW0 A;  1FPY A;  3M10 A;  4RF9 A;  1P50 A;  5J9A A;  3NG0 A;  1BG0 A;  4HPP A;  4S17 A;  1CRK A;  1P52 A;  4ACF A;  1HTQ A;  1F52 A;  3L2E A;  1G0W A;  4LNO A;  4LNN A;  1HTO A;  3DRE A;  3DRB A;  4Q2R A;  1VRP A;  1QK1 A;  5J99 A;  4BG4 B;  3JU6 A;  3JQ3 A;  3ZXR A;  2GLS A;  4GW2 A;  1M15 A;  4BG4 A;  1F1H A;  4LNI A;  4XYC A;  1RL9 A;  1LGR A;  4RF7 A;  1I0E A;  4RF6 A;  4LNF A;  4AM1 A;  2WGS A;  3ZXV A;  1QH4 A;  4GVY A;  1SD0 A;  3JU5 A;  3L2D A;  2CRK A; 
#chains in the Genus database with same CATH topology
 3IG5 A;  3LN6 A;  4GVZ A;  2OJW A;  1P50 A;  2UU7 A;  4S17 A;  3FKY A;  4LNO A;  4LNN A;  1HTO A;  3DRE A;  1VRP A;  5J99 A;  2GLS A;  4GW2 A;  1M15 A;  4LNI A;  1I0E A;  1QH4 A;  3L2D A;  2CRK A;  4RF8 A;  2J1Q A;  4BHL A;  2D3C A;  4Z9M A;  4RF9 A;  4ACF A;  2D3A A;  1HTQ A;  3L2E A;  2D32 A;  4Q2R A;  1QK1 A;  3ZXR A;  1VA6 A;  1R8G A;  1RL9 A;  4AM1 A;  3IG8 A;  4GVY A;  4BAX A;  3ZXV A;  2BVC A;  2D3B A;  1U6R A;  4LNK A;  3B6R A;  4GW0 A;  1FPY A;  3M10 A;  3LVV A;  5J9A A;  3NG0 A;  4HPP A;  2QC8 A;  1F52 A;  3LVW A;  4BG4 B;  3JQ3 A;  1F1H A;  2GWD A;  4RF7 A;  4RF6 A;  1V4G A;  2WGS A;  2GWC A;  2WHI A;  3JPZ A;  4S0R A;  2LGS A;  3NZT A;  3L2E B;  2D33 A;  1BG0 A;  1CRK A;  1P52 A;  1G0W A;  1TT4 A;  3DRB A;  3LN7 A;  3JU6 A;  4BG4 A;  4XYC A;  1LGR A;  4LNF A;  1SD0 A;  3JU5 A; 
#chains in the Genus database with same CATH homology
 2WHI A;  4RF8 A;  2BVC A;  3JPZ A;  4S0R A;  4GVZ A;  2J1Q A;  4BHL A;  2LGS A;  1U6R A;  4LNK A;  3B6R A;  4Z9M A;  3L2E B;  4GW0 A;  1FPY A;  3M10 A;  4RF9 A;  1P50 A;  5J9A A;  3NG0 A;  1BG0 A;  4HPP A;  4S17 A;  1CRK A;  1P52 A;  4ACF A;  1HTQ A;  1F52 A;  3L2E A;  1G0W A;  4LNO A;  4LNN A;  1HTO A;  3DRE A;  3DRB A;  4Q2R A;  1VRP A;  1QK1 A;  5J99 A;  4BG4 B;  3JU6 A;  3JQ3 A;  3ZXR A;  2GLS A;  4GW2 A;  1M15 A;  4BG4 A;  1F1H A;  4LNI A;  4XYC A;  1RL9 A;  1LGR A;  4RF7 A;  1I0E A;  4RF6 A;  4LNF A;  4AM1 A;  2WGS A;  3ZXV A;  1QH4 A;  4GVY A;  1SD0 A;  3JU5 A;  3L2D A;  2CRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...