2BVCA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium Tuberculosis Glutamine Synthetase in Complex with a Transition-State Mimic Provides Functional Insights.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
total genus 157
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2bvcA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2bvcA02
1F1HA 1P52A 3JU5A 5J9AA 2D3BA 3L2EB 4Q2RA 4LNFA 3JPZA 4LNNA 1CRKA 3FKYA 2J1QA 2CRKA 1HTQA 3L2EA 3L2DA 4RF9A 4AM1A 4GVYA 4BG4A 2LGSA 3ZXRA 4BAXA 2UU7A 4S17A 4BG4B 4HPPA 1QH4A 2BVCA 1RL9A 3DRBA 3M10A 1BG0A 4GVZA 4Z9MA 3JQ3A 3ZXVA 5J99A 1G0WA 4LNKA 2QC8A 1U6RA 1P50A 4RF7A 2D3AA 4S0RA 4LNIA 4XYCA 1I0EA 4ACFA 1LGRA 3B6RA 1HTOA 4GW2A 4RF6A 4RF8A 1F52A 3NG0A 2D3CA 1QK1A 1FPYA 3DREA 1VRPA 2WGSA 4BHLA 1M15A 2OJWA 2WHIA 2GLSA 4GW0A 1SD0A 4LNOA 3JU6A
chains in the Genus database with same CATH superfamily
1N61A 1E7UA 1I4PA 4HCNB 3Q8FA 4ZOHC 1HXYD 4YWGG 3QQ8B 5IP4D 2WXOA 2O2VB 1AYFA 1OQRA 1U6RA 1D5XC 2M0XA 2UWQA 3Q3MC 4C80A 2PIAA 4DWFA 3GE3C 5IA7A 1UBQA 1NEKB 4ZYSA 2FUHB 2MRPA 2M19A 2L0FA 3QC8B 3AI5A 3SFDB 2RSUA 4FN2A 1YX5B 4HEA1 4B6WA 1WZ3A 3CSFA 3RZWC 1WY8A 3VTUA 1E5WA 4WAFA 4HWIB 3ML9A 5CHWA 2J0MA 3L16A 4MGIE 3JSVB 2WNMA 1RFAA 4JX1C 2MJEA 4BKSD 4ZHPA 1MG8A 4WAAA 1I35A 4QAYA 4WJPA 1WYWB 2WGSA 4M8NA 2NS5A 4LNOA 1TT5B 1SIJA 2N7EA 3HUIA 3P4RB 3WALA 1C76A 2C9WB 1CRKA 1QT9A 2PVGC 4TQ0A 4NJCA 3GOEA 3L08A 3AE5B 4US8A 5L83A 2GWCA 1VR9A 1K8RB 2MHJA 2RDHA 4MT5A 2K25A 3NZUA 3RNEC 3QK0A 1L7YA 5BYSA 2L05A 3A9KB 3DVGX 4ANXA 5J9AA 3N3KB 3RI7C 4MSQB 3IG5A 2J1QA 4MH0E 3TSSA 2JWZA 3L54A 2HTHA 3SD5A 2KDIA 4HRSA 4MJSA 4HXDA 1FFUA 1J7AA 3AULA 2WXJA 1E7VA 2HD5B 3ZW3A 4M0WB 2AQ3B 1ZKHA 5FKAC 1WMHB 3NVVA 5LXHA 4LJOB 3Q3NC 3KUDB 1GOZA 2WXKA 1EF5A 3U8ZA 1JW9D 4MM3B 5D2MB 4AQ7A 2OHFA 4YL8A 1WX8A 2SEBD 3RYTA 4DHJB 2MBOA 2WXIA 3O13A 1XLOA 5J99A 3ZUNA 3H9DA 2IDYA 3SHQA 5TR5A 3L0WB 3LYYA 5HI1A 3RZFA 1B9RA 2C7NB 3HVZA 1AN8A 1F2RC 2HJ8A 2KO3A 1SGHA 2XEWA 3JVZX 2N0SB 2KD0A 3UI3A 3PV1A 1OTRB 1JWUD 2Y5BB 1QILA 3VDZA 1P98A 3SU8X 3K9PB 2QILA 4GSWA 3KQ4A 4GW2A 3A4RA 4FXCA 1JWMD 2M4NA 1RWSA 5JH5C 1E6EB 1FNUA 3TUOA 4F1SA 3AE1B 3V60A 4GMVA 1CQVA 4HPMB 3U4EG 1JROA 5G55A 2LXAA 5FR6A 2C60A 1R4NI 2E6XA 1C4AA 1J7CA 2M1MA 4YSYB 2V3NA 3NOBA 2WXFA 4BOSC 1MJDA 4GB9A 2Z0EB 4K81A 4WWMA 1RYJA 4CYEA 3AEBB 1WWTA 4ZRIA 3CMMB 4USAA 4ZHOA 4GOCA 2CRKA 2ZVOA 1V5OA 2KLCA 3R3MA 2ASQA 1I4RA 3RT3B 1VA6A 3M62B 4YT0B 5AUIA 1IP9A 2D3AA 2AL3A 4FHKA 4NZLB 1F9JA 2LGYA 2NVUI 1E90A 2DYMA 1C4PA 3ZDMC 5EE9A 5DCNA 4GLSC 2LI5A 3L17A 1UGJA 4ANUA 2CS4A 1UNSA 4GDLB 2WS3B 3IT4B 1UGMA 3ZJUA 4IWPA 1FNVA 4GGQA 2UU7A 4S17A 4ARIA 2JY6A 1VJKA 2BTEA 1VLBA 3TEYA 4RGNA 1ET9A 3PSEB 2BS4B 1FRDA 1YJIA 2WX1A 4YTMB 2CJNA 1N5XA 1R4NB 2CHXA 3MHSD 1STEA 2NBVB 1C1YB 4S0RA 3DHHC 2K5PA 3A1QB 3V05A 3T9LA 4ARCA 1PGXA 3DBRB 1J8CA 2JWUA 2MBHA 3P63A 3UQBA 4N58A 3PLUA 3EGRA 2FIDA 4ICVA 4B0MA 3ZTCA 1YNTE 1M94A 2KMCA 3L2DA 1L0XB 1FCLA 1Y8RC 3E9SA 4BAXA 1C79A 4GIVA 3DQVA 4NPNA 3BK2A 3DWGC 4KDLB 2REXA 2KMAA 4DHZB 2DZMA 3SEBA 2L3ZA 2L76A 3AEFB 2J4XA 2D3CA 4OW0A 5G2NA 2B3AA 2VZKD 4MGZE 4RGMA 2KDMA 2K22A 3LB8C 4WJOA 2KOXA 3NHEB 2X38A 4KIKA 1ESFA 2NBUA 2ZJDA 2G4SA 2L32A 3RULA 3FILB 4YTPB 4IM3A 3KUCB 2JQRB 5EE0A 4OZCA 3AE6B 1VCBA 2MX2A 4IM0A 1HTOA 2DYOA 3N1XC 3AE7B 4JQWC 2GLSA 2BWFA 3PRZA 4UDUC 1F1HA 1FCCC 3M3JA 2I1JA 3EECA 3E56A 1WJ4A 2KN4A 3OWEB 1MG4A 1EU4A 3ZKJC 2QJLA 3H6NA 4JGHB 3AE2B 4HK2A 2AEHA 2D07B 2BB6A 1ENFA 1JMLA 1IPGA 1ZXIA 1GNUA 1SEBD 4JE3B 2AWTA 3FKYA 4LDTB 4DDID 3N20C 1V1OA 3H7SA 4KKIA 5HFYA 1U4AA 3LXFA 1LGRA 3VTVA 1Q5WB 4HPLB 1H4RA 3GP7A 4N6EB 2DHZA 1YJ1A 4C00A 4N9F4 3IAS1 5C23A 3T3OA 1LFDA 2DNFA 3B08A 4A20A 4I6NB 4NAWB 1FM0D 3L4PA 4ZRJA 3DRBA 1C3TA 4ZDVA 1L5PA 1PDXA 1WGGA 3MTNB 3KW5B 1ZDVA 2ZPNA 1T0RC 3VVWB 1M4VA 3AMZA 1FFVA 2J0JA 3R2IA 1C4CA 3OLMD 1OQQA 4F8CB 5AZFA 1GB1A 2L7RA 2O6VD 1DGJA 4BKSA 4HPPA 4EEWA 3AV8A 3IBEA 4W9FA 4IWOA 2WU2B 2WXPA 3AEAB 4LCDE 1D5ZC 3PTFC 2KXJA 3DDCB 1GJZA 4PS3A 2LJ5A 2PE9A 2ICIA 2Q5WD 2MP2A 2VRRB 5CTRC 3ZQ4A 2RPQA 4FJZA 1WYGA 1OEYJ 3MJ5A 3JQ3A 2PEAA 1WF9A 4LNIA 5J17A 4IKGA 4P1BC 1WX7A 2NCNA 1Q0WB 3URYA 4IM2A 2KTRA 4KX6B 2INNE 3QX1A 1V80A 2Y5CA 1N6ZA 1WE6A 4XGAB 2LUEA 3CWIA 1KRHA 2O6VA 1F77A 4PT5A 2N7JA 2L8JA 1WGYA 2WXGA 2IY0B 1WGRA 4XDCA 1A70A 3GS2A 2KMMA 2EKEC 2WXQA 2ZZPB 1D6EC 2DX5B 3ZTDA 4BKTA 3N9YC 4M0WA 3V3XA 2FCQA 1MPEA 3L2EB 4RCOA 2JZPA 1V8CA 2QEJC 2BYEA 2QIEB 4NAWA 2MQJA 4BKGA 1Q1OA 3B2FA 1KH0A 2JZ3B 2EKIA 1KM7A 2PTLA 3K9OB 3KH0A 1NI3A 3Q3JA 3B2GA 4A3OA 4YSZB 2FCMA 4IOIE 1KLUD 1TZ1A 4KIKB 5IAAC 1SBBB 3V6EB 2GMIC 2NTSA 1GG3A 3KWVA 2RD0A 3AU5A 2TSSA 3VFKA 4OVVA 2UYZB 2ZW0A 3OJ4B 1SJED 3ABVB 4DHZE 3ZGZA 1QK1A 2DWQA 2JXXA 5E6JA 3AXCA 4CQNA 1IBXA 1ISNA 1I42A 1UWXA 3JU5A 4C7YA 3TMPB 5BMGA 4PK1A 4TKNA 1N63A 3QCAA 2PKOA 2ACZB 1HA5A 1PFDA 4RFBA 5JXVA 2GOWA 2YLMA 1GUAB 3ZNID 5C1ZA 4RF6A 3IT6B 3NJTA 5DPRA 3VH3B 2K0PA 1V81A 3HVDA 2CKHB 2K9XA 1T6BX 2H88B 4ICUA 4Q2RA 1UELA 1XXGA 4WQOB 1L2NA 1QH4A 4M02A 4EUTA 1DYQA 3AEGB 1EWCA 3BVGA 4W9LA 1QZEA 1EU3A 2FNJB 2QMTA 1FNWA 4LLGM 1XLNA 5IKCM 4HKZE 1ZXHA 3KYDD 2MW5A 3BK1A 4XDDA 3L2EA 2FIFA 2LGSA 4W9JA 2KTRB 1D3ZA 3CIRB 1UH6A 2WXRA 4FJYA 3X0WA 2WDTB 2BYFA 1FXIA 2L00B 4TV3A 4HJKA 1RRBA 3AU4A 4W9CA 2IGGA 1UBIA 4GN1A 3HM6X 3R7QA 2WXLA 4OVZA 1HTQA 3C0RB 4KVGB 2Z59B 3LDZE 2KWVB 4FHJA 5KHQA 3Q3OC 1CK1A 1E0ZA 3TBLD 5BYQA 5TSSA 1AWDA 2KJ6A 5D6JB 4BOZB 2IJ0A 1WRDB 2V4LA 2G45B 1WX9A 4PYZA 4EE2A 4HKQA 3DHIC 2N9LA 1LQBA 3KYCD 4DBGA 4GVZA 4PYUA 4W9HA 4MH8A 1TBEA 1ZW7A 3ZNZB 2R61A 3ZJVA 1WR6E 3Q8EA 3ZIMA 1IYFA 2KT7A 3NRZA 1YX6B 3J9CA 1V1PA 1V86A 2WU5B 3HHMA 1NI2A 4AUQC 4DXGA 4AP4C 1BT0A 4A8XC 4WIPA 3QA8A 4RF7A 1YQBA 1Z2MA 4C56C 2V4IB 1WIAA 2O2VA 3TEWA 1L0YB 1WJNA 2I38A 3BVMA 3RFZB 4II2B 2WWZA 4NNJB 2K8HA 4HLEA 4KKJA 2GB1A 1XT9B 4GU2A 1FXAA 1TKEA 1SE9A 3IVFA 1RL9A 2IBIB 3NS8A 4OHJA 3N1YC 2MWSB 2ZCCA 4FADA 1TTNA 2GBMA 2KX0A 1EM7A 2KACA 1M15A 2Y3AA 1HQRD 3FC4A 3OG5A 4TUUA 2JRHA 3WCQA 4JL9A 2V0GA 1ZOYB 2BKRB 5G5GA 2KVZA 2QSDA 4WWOA 1K50A 3KVFB 3M10A 1HZ6A 1XLQA 3ALBA 2BBCA 1G0WA 4MJSB 2CR5A 3AEEB 5HKHA 3Q8BA 1PUTA 3W2DA 4HDOA 1XEEA 4C4VA 3AEDB 1WGHA 4X57B 1H8CA 2MA9B 2D3BA 1YN5A 4N59A 3DVGY 2CU3A 4GVYA 2RR9A 2ZNVB 1JRUA 3DPDA 5CHVC 3DBHB 3R8BA 2BT6A 5JHAA 2XK5A 5DPWA 1XLPA 4XYCA 4ZRQA 1AARA 5FR3A 3PVLA 1P7FA 1YQ4B 4RMAA 3JSVA 4PS7A 1L6UA 1KOTA 2AL6A 2KKCA 3NZSA 1R8GA 1TIFA 3WAPA 3U7ZA 3GB1A 2NTTA 2AQ1B 2YEPF 2K39A 3VUXA 4EKUA 1JWBD 2LD9A 3DREA 3QAQA 3M95A 3NUHB 1TY2A 2IGDA 1FD6A 1VZ7A 3PZ7A 2MBQA 1IGCA 1XF5L 2XN9C 2GRIA 4LNFA 2PVOD 3RMKC 1J0GA 2N1VA 4ZRPA 3DHGC 3Q69A 1FEHA 1YN4A 3EHVA 2B76B 4RF1A 1R4MB 2WQYB 1WSPA 2VZKB 4XWTA 1HZ5A 4AOFA 1D5MC 4C7ZA 1LO5D 2W55A 4E74A 2PLPA 1V2YA 3W1YA 4IWQA 2V1YA 3HM3A 2INCC 2GBRA 1VD2A 2LGXA 1RFKA 1JCKB 1VRAB 2INPE 1X1MA 2IO2B 5DPTA 2X8XX 2WDVB 1BUIC 1V97A 2MCNB 2FBWB 1WXAA 2BW2A 1CMXB 4XWWA 1FRRA 3Q8CA 2J0KA 1Z5SB 2KTFA 3ZO5B 3UQAA 2KZRA 5JHBA 5GMVA 4RGOS 1VRPA 3L13A 4MGYE 4GW0A 4J6IA 1QOGA 4LDTD 4EZJA 2NPTB 3UIPB 1HEZE 3I5JC 4REZA 2GWDA 3DBLB 2OJRA 5LLIA 3U2SC 5BO4B 1FIQA 2C5LC 2K3UA 2KFJA 1DOYA 4YSXB 3JYUA 4CO7A 5EDSA 1OQYA 4HROA 5HG2A 3PGEA 2G9HD 4LTUA 2JPHA 5J18A 1C9FA 3V6CB 4A9AA 2IZVB 4K7UA 1QOFA 2IPKD 2N9EB 3N30A 2CU1A 3ZLZA 2IYDB 4NQKE 2KJRA 4MACA 2LASA 3P42A 2WXMA 4WURA 2PE6B 5H92C 2WDRB 2Z8LA 1EWYC 2LJIA 3JU6A 1WXVA 2DYBA 4IW0A 2KNBA 5DPSA 4W9GA 2KDEB 1KTKA 4B95A 2BGFA 3D32A 1P3QU 2BS3B 3P4QB 1N5WA 2ZNVC 3RNCC 3EFCA 3PLVA 3AM9A 5L95C 4MDKE 2W54A 4TSSA 3A1QA 1ROEA 4A90A 2BYTA 1DOXA 2A5UA 5GXGB 3P4SB 2NBWB 4LNKA 3Q6BA 2PW9A 1MI0A 1KF6B 3P2BA 2W9NA 1NVID 4BBNF 4CHKA 5G5HA 4B9KA 4IG7B 2NPTA 4RF9A 4HVBA 5IO9A 2JF5A 4Z9MA 2G4DB 3A9JB 4EFOA 2LWPA 3H7PB 1K52A 3PRMB 1OEYA 3PS6A 3IHPC 1DOIA 1T0SC 4ITKA 4M00A 2D11A 1KLVA 3UF8A 2DBYA 3NZ3A 4K7SA 1GB4A 4MELA 4PS8A 4O1NA 3R66C 4P1CC 1WJUA 3Q3FA 4M8MA 2KANA 3LVVA 4KSKC 2HE7A 4WH4A 4XX5A 2L83A 1F52A 2JZZA 1S1QB 3W1SC 4WWPA 4K3BA 2PPHA 3PRPB 1EUVB 2KX3A 2W3SA 4D2KA 4IC7B 1XQQA 3FILA 3WIMA 3DOWA 2FUG1 1E10A 1OGWA 3KUZA 2LVQA 2KDBA 2A4ZA 3GZNB 1ZGUB 2N9XA 4FJVB 4K1RB 3X23A 3ONSA 1TZOA 4R3DA 5IN7A 2FE8A 3CSTA 2JRIB 3T8MA 2KN5A 4HDQA 3S2AA 3DVNU 1K53A 2C7HA 3WANA 4YTNB 3UINB 4G50A 4OZAA 3W5VB 2KJHB 2WX0A 1MHXA 3A4SC 1ZUD2 1QF6A 3MP9A 4XE0A 3RPFC 4RF8A 1RLFA 2FAZA 3MC0B 2JYEA 5EE1A 3AB5A 3RCZA 4NAMA 3PHXB 4KDIC 2DZIA 2NMQA 4A55A 4EZKA 3ZVVA 1KLGD 1C77A 3U7DA 1HE8A 2KFKA 1B1ZA 2BF8B 2AYOB 3ZRFA 2LZ6A 4ANVA 2WDQB 1LM8B 1R4MI 2LUMA 1WR1A 3IFWB 2KC2A 2RPVA 4I6PA 4IUMB 2L0TA 3T3NA 1YQ3B 4IDIA 2MH7A 3AECB 4RNAA 1E8XA 2N4FA 2V3SA 3I63C 3MFGA 1YMHE 2V3PA 3CF6E 1ET6A 2BKFA 3ZXRA 3EFUA 3UGBB 1BG0A 5EE3A 2M0AA 3MC9A 2KAJA 2D10A 1P50A 2DENB 3RN9C 3RD2A 2AX5A 5D3DA 3N1ZC 3MHZA 1V1PB 3QIJA 3N32A 3APDA 3DWMA 3AE9B 2KWCA 1SD0A 1PQSA 4E3CA 3A9JA 2HDEA 1NDDA 3AE3B 2BS2B 2N1WA 2M17A 2BVCA 2GI9A 4DXFA 4NQLB 3VTWA 2MBBB 1RM6C 1Q10A 1WH3A 2QDFA 1VZ6A 2LRWA 4JLCA 3AE4B 3DVNV 1SE3A 1P9DU 2MP2B 3BYTB 2LVOA 4Q2JA 4WQMA 4GDLA 3WAMA 4LNNA 4A6QA 1SF0A 1V5TA 1JQ4A 3ZXVA 1CJEA 4EOYA 2LFIA 4G11A 1QKZA 1MHHE 1T5XD 3A33B 4ANWA 4L2YA 2E3TA 3Q2AC 2GBJA 4DK5A 1SJHD 3TCAA 1P0RA 4FBJB 4FULA 1I4QA 3SR6A 3VUWA 3ZRCA 2JYTA 2ZVNA 4NJ7A 3RUIB 4KGTA 2PMVA 2D3GA 2QHOA 3BVZA 1VDVA 4RH6A 2KFKB 3ML8A 4G3XB 2H89B 1ZE3D 4AJWA 2DAFA 1FXTB 5IOIA 3C19A 1WE7A 2Z0DB 4JWUC 1G6JA 3DBHI 2BB5A 3IG8A 1SSNA 5E6OA 4BVUC 3IAM1 5E6PA 5LNK1 3ZDTA 2CHZA 3GZNI 1EO6A 3JPZA 1PGAA 2KVRA 2XK5B 3MJWA 2MBEA 3VR8B 3VRBB 2SAKA 4I6LB 4DQOC 5BYRA 2ZPYA 4BBNC 2DZKA 4KZ0A 4RM9A 2MJ3A 4H2AA 3LN7A 1KFYB 4P16A 3EC8A 4ZRKA 4W9IA 1IUEA 4K7WA 3IG3A 2BPSA 1QLBB 1ZDXA 3QWZB 1MFWA 2LVPA 5JZEB 2W3RA 3LN6A 1V9JA 1C78A 4JPSA 3B9JA 3R7RA 2JSVX 4XZ4A 1WZ0A 1T0QC 3ZJTA 1WI0A 1IBXB 3VR9B 2WHIA 2Y5PA 1QOAA 2J7QB 3RNGC 2N9KA 1Y56A 2JU6X 3I3TB 2J42A 3TEZA 3PT2B 3NY5A 1WM3A 2K1FA 1L4ZB 1A5RA 4TQ1A 3P1MA 1WXSA 4TMAB 4DHJD 1FMAD 4OVUA 2L52A 3H1UA 2KQ7A 1L6VA 4ACFA 4F7ZA 1PGBA 5LXIB 4GDKA 1AW7A 3W9CB 4II3B 1TS4A 3I9V1 3LVWA 3Q8AA 1JWSD 1P7EA 5T8IA 1WRIA 3SFEB 2KDFB 1UWMA 4RF0A 4EZLA 2JUOA 1FO4A 2HJ1A 2KQSA 4KGSA 3ZNGC 1FPYA 3SDLC 2KWUB 1QQRA 4HJGE 3VQIA 2KQ4X 5BMHA 3C8YA 4L23A 2KYWA 3ZNHB 2PJHA 3ETRA 5J2RA 3PPAA 4WJQA 2LGDA 5AZGA 1ZPSA 2KLGA 3QARA 4AS1A 4KGRA 1F2RI 2LEKA 2INDC 3BZDB 3BYYB 1UD7A 5H8YE 1I4GA 2EMTA 1J7BA 4WWNA 3TEXA 5AUKA 2QC8A 3L10B 3AN1A 1S3SG 1WXQA 2D32A 4C4VB 2IO0B 3KLSX 1TYGB 2JX5A 4ASWC 3EA6A 3TIXA 4AM1A 1EF1A 3W5UB 3FAHA 1GPXA 4E71A 2MJDA 2YVCA 4JIOU 4DXAB 2LRUA 2K6DB 1UF0A 3U30A 3AE8B 5KHOA 3PREA 1F0ZA 4B0EA 4KZCA 1XCQL 3RNAC 5C2TB 2HTME 1T3QA 3W1SA 1I4HA 2VH1A 1RAXA 4AJYB 3TJPA 2G1EA 1L4DB 1OFFA 1P1AA 2XBBC 2O6VB 3R2TA 1I0EA 2W82A 1JWAD 4NJ6A 2NR2A 2WYQA 1SE2A 1NYRA 1BXTA 2LHEA 2N9PC 1TS2A 3PHWB 2KHWB 2GBNA 5HHDG 1XO3A 3ECIA 1YIWA 1LXDA 2OEDA 3DBLI 3VAWA 1JALA 2R2QA 3APCA 3QHTA 4J3OD 1E8WA 4G0NB 5CX3A 3NG0A 2K8CA 1JRPA 3UIOB 2K8BA 3EUB2 1R7SA 2AQ2B 2DLBA 2D33A 1WM2A 2J52A 2QCZA 2EELA 2RDBC 3H7PA 4BG4A 1V49A 3BWUD 4W9KA 3NVYA 3VHTC 4DDGD 2N7DA 2DAJA 1ZP0B 4LK0M 2D5GA 1SXTA 1E9MA 1GC7A 1YD8U 2WP9B 2IO1B 2RDGA 4XC2A 1GAQB 1L0VB 1PYWD 2ZW1A 2BQQA 1TT4A 1E8ZA 4US9A 1QOBA 1ACCA 2CHWA 3NVWA 3IXSA 4GDKB 4K3CA 4HCPB 2WLBA 4MSMB 2OOBB 2BWES 2DZJA 3PZDA 3TL5A 2FCSA 1CZPA 1E8YA 4W9DA 2GBKA 2MEKA 3BY4B 1TJEA 2RGFA 3B0AA 2K6QA 2RMMA 3H8HA 3ZYYX 4FA6A 1YOVB 1UUPA 2FCNA 4ZYNA 5C3JB 3OJ3A 2CJOA 2LHDA 2ON8A 3NS1A 2C7MB 2IY1B 3PZ8A 1SE4A 2JVCA 3HRDD 3GE8C 1MVKA 3DBSA 2ZCBA 2ONQA 4BZAA 2LGIA 3I57A 2J53A 3DBRI 4FLHA 2WXNA 2I2YA 1SIFA 1KJTA 3QJZA 1N62A 1TS3A 2KK8A 4P6VF 1UZXB 4KV2A 5CHFA 4MGKE 1TS5A 3B1LX 3O65B 4BHLA 3PO0A 2MSED 2OJWA 4W9EA 5D94A 1XD3B 3BINA 4L1BA 1TKYA 4M01A 2I1KA 3RNFC 1D4BA 4BG4B 1YN3A 1V6EA 3VRAB 1J19A 5AEKB 3OAWA 3VH4B 1K51A 2M8SA 3NZTA 3B6RA 1N60A 3M63B 1IGDA 2LXCA 4RM8A 2BYVE 2JT4B 1NENB 2JXTA 1TGZB 4A3PA 1P52A 1NBFC 5D7GA 4MM3A 2L1AA 1E7PB 1NYQA 3V62A 2G3QB 2KWDA 2IGHA 2V9HA 4LJPB 3WAOA 2IO3B 3JW0X 4KSLC 3V61A 2R2OA 3P4PB 3HIZA 2M56B 1V4GA 4P7IA 3VXWA 2MLBA 5E6NA 3APFA 2YEPB 2ZEQA 1T0YA 5D3IB 1WGKA 2VH2A 2XNAC 1I7HA 3ENEA 3MC8A 3RNBC 5FK9C 1BMLC 4JWSC 1YJJA 3AH7A 4URKA 1GC6A 2LMCA 4AWJA 2D2QA 1WGDA 4OZBA 3Q14C 1SB3C 2KC1A 2EMSA 1WMHA 4RGTA 3VUYA 5I4DA 3HK0A 4MEMA 5AZHA 4NY0A 1TKGA 1I4XA 1TY0A 3WA0A 3KWLA 3NVZA 4YXDB 5MPOA 4GXBA 5BMIA 3DCGA 3LJ3A 2WXHA 3BIID 4BFRA 3U52E 3A9KA 1VZ8A 1WXMA 1XCTL 1WFYA 1WJ6A 4WJNA
chains in the Genus database with same CATH topology
1F1HA 1P52A 3JU5A 5J9AA 2D3BA 3L2EB 4Q2RA 4LNFA 3JPZA 4LNNA 1CRKA 3FKYA 2J1QA 2CRKA 1HTQA 3L2EA 3L2DA 4RF9A 4AM1A 4GVYA 4BG4A 2LGSA 3ZXRA 4BAXA 2UU7A 4S17A 4BG4B 4HPPA 1QH4A 2BVCA 1RL9A 3DRBA 3M10A 1BG0A 4GVZA 4Z9MA 3JQ3A 3ZXVA 5J99A 1G0WA 4LNKA 2QC8A 1U6RA 1P50A 4RF7A 2D3AA 4S0RA 4LNIA 4XYCA 1I0EA 4ACFA 1LGRA 3B6RA 1HTOA 4GW2A 4RF6A 4RF8A 1F52A 3NG0A 2D3CA 1QK1A 1FPYA 3DREA 1VRPA 2WGSA 4BHLA 1M15A 2OJWA 2WHIA 2GLSA 4GW0A 1SD0A 4LNOA 3JU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1H A;  1P52 A;  3JU5 A;  5J9A A;  2D3B A;  3L2E B;  4Q2R A;  4LNF A;  3JPZ A;  4LNN A;  1CRK A;  3FKY A;  2J1Q A;  2CRK A;  1HTQ A;  3L2E A;  3L2D A;  4RF9 A;  4AM1 A;  4GVY A;  4BG4 A;  2LGS A;  3ZXR A;  4BAX A;  2UU7 A;  4S17 A;  4BG4 B;  4HPP A;  1QH4 A;  2BVC A;  1RL9 A;  3DRB A;  3M10 A;  1BG0 A;  4GVZ A;  4Z9M A;  3JQ3 A;  3ZXV A;  5J99 A;  1G0W A;  4LNK A;  2QC8 A;  1U6R A;  1P50 A;  4RF7 A;  2D3A A;  4S0R A;  4LNI A;  4XYC A;  1I0E A;  4ACF A;  1LGR A;  3B6R A;  1HTO A;  4GW2 A;  4RF6 A;  4RF8 A;  1F52 A;  3NG0 A;  2D3C A;  1QK1 A;  1FPY A;  3DRE A;  1VRP A;  2WGS A;  4BHL A;  1M15 A;  2OJW A;  2WHI A;  2GLS A;  4GW0 A;  1SD0 A;  4LNO A;  3JU6 A; 
#chains in the Genus database with same CATH topology
 1N61 A;  1E7U A;  1I4P A;  4HCN B;  3Q8F A;  4ZOH C;  1HXY D;  4YWG G;  3QQ8 B;  5IP4 D;  2WXO A;  2O2V B;  1AYF A;  1OQR A;  1U6R A;  1D5X C;  2M0X A;  2UWQ A;  3Q3M C;  4C80 A;  2PIA A;  4DWF A;  3GE3 C;  5IA7 A;  1UBQ A;  1NEK B;  4ZYS A;  2FUH B;  2MRP A;  2M19 A;  2L0F A;  3QC8 B;  3AI5 A;  3SFD B;  2RSU A;  4FN2 A;  1YX5 B;  4HEA 1;  4B6W A;  1WZ3 A;  3CSF A;  3RZW C;  1WY8 A;  3VTU A;  1E5W A;  4WAF A;  4HWI B;  3ML9 A;  5CHW A;  2J0M A;  3L16 A;  4MGI E;  3JSV B;  2WNM A;  1RFA A;  4JX1 C;  2MJE A;  4BKS D;  4ZHP A;  1MG8 A;  4WAA A;  1I35 A;  4QAY A;  4WJP A;  1WYW B;  2WGS A;  4M8N A;  2NS5 A;  4LNO A;  1TT5 B;  1SIJ A;  2N7E A;  3HUI A;  3P4R B;  3WAL A;  1C76 A;  2C9W B;  1CRK A;  1QT9 A;  2PVG C;  4TQ0 A;  4NJC A;  3GOE A;  3L08 A;  3AE5 B;  4US8 A;  5L83 A;  2GWC A;  1VR9 A;  1K8R B;  2MHJ A;  2RDH A;  4MT5 A;  2K25 A;  3NZU A;  3RNE C;  3QK0 A;  1L7Y A;  5BYS A;  2L05 A;  3A9K B;  3DVG X;  4ANX A;  5J9A A;  3N3K B;  3RI7 C;  4MSQ B;  3IG5 A;  2J1Q A;  4MH0 E;  3TSS A;  2JWZ A;  3L54 A;  2HTH A;  3SD5 A;  2KDI A;  4HRS A;  4MJS A;  4HXD A;  1FFU A;  1J7A A;  3AUL A;  2WXJ A;  1E7V A;  2HD5 B;  3ZW3 A;  4M0W B;  2AQ3 B;  1ZKH A;  5FKA C;  1WMH B;  3NVV A;  5LXH A;  4LJO B;  3Q3N C;  3KUD B;  1GOZ A;  2WXK A;  1EF5 A;  3U8Z A;  1JW9 D;  4MM3 B;  5D2M B;  4AQ7 A;  2OHF A;  4YL8 A;  1WX8 A;  2SEB D;  3RYT A;  4DHJ B;  2MBO A;  2WXI A;  3O13 A;  1XLO A;  5J99 A;  3ZUN A;  3H9D A;  2IDY A;  3SHQ A;  5TR5 A;  3L0W B;  3LYY A;  5HI1 A;  3RZF A;  1B9R A;  2C7N B;  3HVZ A;  1AN8 A;  1F2R C;  2HJ8 A;  2KO3 A;  1SGH A;  2XEW A;  3JVZ X;  2N0S B;  2KD0 A;  3UI3 A;  3PV1 A;  1OTR B;  1JWU D;  2Y5B B;  1QIL A;  3VDZ A;  1P98 A;  3SU8 X;  3K9P B;  2QIL A;  4GSW A;  3KQ4 A;  4GW2 A;  3A4R A;  4FXC A;  1JWM D;  2M4N A;  1RWS A;  5JH5 C;  1E6E B;  1FNU A;  3TUO A;  4F1S A;  3AE1 B;  3V60 A;  4GMV A;  1CQV A;  4HPM B;  3U4E G;  1JRO A;  5G55 A;  2LXA A;  5FR6 A;  2C60 A;  1R4N I;  2E6X A;  1C4A A;  1J7C A;  2M1M A;  4YSY B;  2V3N A;  3NOB A;  2WXF A;  4BOS C;  1MJD A;  4GB9 A;  2Z0E B;  4K81 A;  4WWM A;  1RYJ A;  4CYE A;  3AEB B;  1WWT A;  4ZRI A;  3CMM B;  4USA A;  4ZHO A;  4GOC A;  2CRK A;  2ZVO A;  1V5O A;  2KLC A;  3R3M A;  2ASQ A;  1I4R A;  3RT3 B;  1VA6 A;  3M62 B;  4YT0 B;  5AUI A;  1IP9 A;  2D3A A;  2AL3 A;  4FHK A;  4NZL B;  1F9J A;  2LGY A;  2NVU I;  1E90 A;  2DYM A;  1C4P A;  3ZDM C;  5EE9 A;  5DCN A;  4GLS C;  2LI5 A;  3L17 A;  1UGJ A;  4ANU A;  2CS4 A;  1UNS A;  4GDL B;  2WS3 B;  3IT4 B;  1UGM A;  3ZJU A;  4IWP A;  1FNV A;  4GGQ A;  2UU7 A;  4S17 A;  4ARI A;  2JY6 A;  1VJK A;  2BTE A;  1VLB A;  3TEY A;  4RGN A;  1ET9 A;  3PSE B;  2BS4 B;  1FRD A;  1YJI A;  2WX1 A;  4YTM B;  2CJN A;  1N5X A;  1R4N B;  2CHX A;  3MHS D;  1STE A;  2NBV B;  1C1Y B;  4S0R A;  3DHH C;  2K5P A;  3A1Q B;  3V05 A;  3T9L A;  4ARC A;  1PGX A;  3DBR B;  1J8C A;  2JWU A;  2MBH A;  3P63 A;  3UQB A;  4N58 A;  3PLU A;  3EGR A;  2FID A;  4ICV A;  4B0M A;  3ZTC A;  1YNT E;  1M94 A;  2KMC A;  3L2D A;  1L0X B;  1FCL A;  1Y8R C;  3E9S A;  4BAX A;  1C79 A;  4GIV A;  3DQV A;  4NPN A;  3BK2 A;  3DWG C;  4KDL B;  2REX A;  2KMA A;  4DHZ B;  2DZM A;  3SEB A;  2L3Z A;  2L76 A;  3AEF B;  2J4X A;  2D3C A;  4OW0 A;  5G2N A;  2B3A A;  2VZK D;  4MGZ E;  4RGM A;  2KDM A;  2K22 A;  3LB8 C;  4WJO A;  2KOX A;  3NHE B;  2X38 A;  4KIK A;  1ESF A;  2NBU A;  2ZJD A;  2G4S A;  2L32 A;  3RUL A;  3FIL B;  4YTP B;  4IM3 A;  3KUC B;  2JQR B;  5EE0 A;  4OZC A;  3AE6 B;  1VCB A;  2MX2 A;  4IM0 A;  1HTO A;  2DYO A;  3N1X C;  3AE7 B;  4JQW C;  2GLS A;  2BWF A;  3PRZ A;  4UDU C;  1F1H A;  1FCC C;  3M3J A;  2I1J A;  3EEC A;  3E56 A;  1WJ4 A;  2KN4 A;  3OWE B;  1MG4 A;  1EU4 A;  3ZKJ C;  2QJL A;  3H6N A;  4JGH B;  3AE2 B;  4HK2 A;  2AEH A;  2D07 B;  2BB6 A;  1ENF A;  1JML A;  1IPG A;  1ZXI A;  1GNU A;  1SEB D;  4JE3 B;  2AWT A;  3FKY A;  4LDT B;  4DDI D;  3N20 C;  1V1O A;  3H7S A;  4KKI A;  5HFY A;  1U4A A;  3LXF A;  1LGR A;  3VTV A;  1Q5W B;  4HPL B;  1H4R A;  3GP7 A;  4N6E B;  2DHZ A;  1YJ1 A;  4C00 A;  4N9F 4;  3IAS 1;  5C23 A;  3T3O A;  1LFD A;  2DNF A;  3B08 A;  4A20 A;  4I6N B;  4NAW B;  1FM0 D;  3L4P A;  4ZRJ A;  3DRB A;  1C3T A;  4ZDV A;  1L5P A;  1PDX A;  1WGG A;  3MTN B;  3KW5 B;  1ZDV A;  2ZPN A;  1T0R C;  3VVW B;  1M4V A;  3AMZ A;  1FFV A;  2J0J A;  3R2I A;  1C4C A;  3OLM D;  1OQQ A;  4F8C B;  5AZF A;  1GB1 A;  2L7R A;  2O6V D;  1DGJ A;  4BKS A;  4HPP A;  4EEW A;  3AV8 A;  3IBE A;  4W9F A;  4IWO A;  2WU2 B;  2WXP A;  3AEA B;  4LCD E;  1D5Z C;  3PTF C;  2KXJ A;  3DDC B;  1GJZ A;  4PS3 A;  2LJ5 A;  2PE9 A;  2ICI A;  2Q5W D;  2MP2 A;  2VRR B;  5CTR C;  3ZQ4 A;  2RPQ A;  4FJZ A;  1WYG A;  1OEY J;  3MJ5 A;  3JQ3 A;  2PEA A;  1WF9 A;  4LNI A;  5J17 A;  4IKG A;  4P1B C;  1WX7 A;  2NCN A;  1Q0W B;  3URY A;  4IM2 A;  2KTR A;  4KX6 B;  2INN E;  3QX1 A;  1V80 A;  2Y5C A;  1N6Z A;  1WE6 A;  4XGA B;  2LUE A;  3CWI A;  1KRH A;  2O6V A;  1F77 A;  4PT5 A;  2N7J A;  2L8J A;  1WGY A;  2WXG A;  2IY0 B;  1WGR A;  4XDC A;  1A70 A;  3GS2 A;  2KMM A;  2EKE C;  2WXQ A;  2ZZP B;  1D6E C;  2DX5 B;  3ZTD A;  4BKT A;  3N9Y C;  4M0W A;  3V3X A;  2FCQ A;  1MPE A;  3L2E B;  4RCO A;  2JZP A;  1V8C A;  2QEJ C;  2BYE A;  2QIE B;  4NAW A;  2MQJ A;  4BKG A;  1Q1O A;  3B2F A;  1KH0 A;  2JZ3 B;  2EKI A;  1KM7 A;  2PTL A;  3K9O B;  3KH0 A;  1NI3 A;  3Q3J A;  3B2G A;  4A3O A;  4YSZ B;  2FCM A;  4IOI E;  1KLU D;  1TZ1 A;  4KIK B;  5IAA C;  1SBB B;  3V6E B;  2GMI C;  2NTS A;  1GG3 A;  3KWV A;  2RD0 A;  3AU5 A;  2TSS A;  3VFK A;  4OVV A;  2UYZ B;  2ZW0 A;  3OJ4 B;  1SJE D;  3ABV B;  4DHZ E;  3ZGZ A;  1QK1 A;  2DWQ A;  2JXX A;  5E6J A;  3AXC A;  4CQN A;  1IBX A;  1ISN A;  1I42 A;  1UWX A;  3JU5 A;  4C7Y A;  3TMP B;  5BMG A;  4PK1 A;  4TKN A;  1N63 A;  3QCA A;  2PKO A;  2ACZ B;  1HA5 A;  1PFD A;  4RFB A;  5JXV A;  2GOW A;  2YLM A;  1GUA B;  3ZNI D;  5C1Z A;  4RF6 A;  3IT6 B;  3NJT A;  5DPR A;  3VH3 B;  2K0P A;  1V81 A;  3HVD A;  2CKH B;  2K9X A;  1T6B X;  2H88 B;  4ICU A;  4Q2R A;  1UEL A;  1XXG A;  4WQO B;  1L2N A;  1QH4 A;  4M02 A;  4EUT A;  1DYQ A;  3AEG B;  1EWC A;  3BVG A;  4W9L A;  1QZE A;  1EU3 A;  2FNJ B;  2QMT A;  1FNW A;  4LLG M;  1XLN A;  5IKC M;  4HKZ E;  1ZXH A;  3KYD D;  2MW5 A;  3BK1 A;  4XDD A;  3L2E A;  2FIF A;  2LGS A;  4W9J A;  2KTR B;  1D3Z A;  3CIR B;  1UH6 A;  2WXR A;  4FJY A;  3X0W A;  2WDT B;  2BYF A;  1FXI A;  2L00 B;  4TV3 A;  4HJK A;  1RRB A;  3AU4 A;  4W9C A;  2IGG A;  1UBI A;  4GN1 A;  3HM6 X;  3R7Q A;  2WXL A;  4OVZ A;  1HTQ A;  3C0R B;  4KVG B;  2Z59 B;  3LDZ E;  2KWV B;  4FHJ A;  5KHQ A;  3Q3O C;  1CK1 A;  1E0Z A;  3TBL D;  5BYQ A;  5TSS A;  1AWD A;  2KJ6 A;  5D6J B;  4BOZ B;  2IJ0 A;  1WRD B;  2V4L A;  2G45 B;  1WX9 A;  4PYZ A;  4EE2 A;  4HKQ A;  3DHI C;  2N9L A;  1LQB A;  3KYC D;  4DBG A;  4GVZ A;  4PYU A;  4W9H A;  4MH8 A;  1TBE A;  1ZW7 A;  3ZNZ B;  2R61 A;  3ZJV A;  1WR6 E;  3Q8E A;  3ZIM A;  1IYF A;  2KT7 A;  3NRZ A;  1YX6 B;  3J9C A;  1V1P A;  1V86 A;  2WU5 B;  3HHM A;  1NI2 A;  4AUQ C;  4DXG A;  4AP4 C;  1BT0 A;  4A8X C;  4WIP A;  3QA8 A;  4RF7 A;  1YQB A;  1Z2M A;  4C56 C;  2V4I B;  1WIA A;  2O2V A;  3TEW A;  1L0Y B;  1WJN A;  2I38 A;  3BVM A;  3RFZ B;  4II2 B;  2WWZ A;  4NNJ B;  2K8H A;  4HLE A;  4KKJ A;  2GB1 A;  1XT9 B;  4GU2 A;  1FXA A;  1TKE A;  1SE9 A;  3IVF A;  1RL9 A;  2IBI B;  3NS8 A;  4OHJ A;  3N1Y C;  2MWS B;  2ZCC A;  4FAD A;  1TTN A;  2GBM A;  2KX0 A;  1EM7 A;  2KAC A;  1M15 A;  2Y3A A;  1HQR D;  3FC4 A;  3OG5 A;  4TUU A;  2JRH A;  3WCQ A;  4JL9 A;  2V0G A;  1ZOY B;  2BKR B;  5G5G A;  2KVZ A;  2QSD A;  4WWO A;  1K50 A;  3KVF B;  3M10 A;  1HZ6 A;  1XLQ A;  3ALB A;  2BBC A;  1G0W A;  4MJS B;  2CR5 A;  3AEE B;  5HKH A;  3Q8B A;  1PUT A;  3W2D A;  4HDO A;  1XEE A;  4C4V A;  3AED B;  1WGH A;  4X57 B;  1H8C A;  2MA9 B;  2D3B A;  1YN5 A;  4N59 A;  3DVG Y;  2CU3 A;  4GVY A;  2RR9 A;  2ZNV B;  1JRU A;  3DPD A;  5CHV C;  3DBH B;  3R8B A;  2BT6 A;  5JHA A;  2XK5 A;  5DPW A;  1XLP A;  4XYC A;  4ZRQ A;  1AAR A;  5FR3 A;  3PVL A;  1P7F A;  1YQ4 B;  4RMA A;  3JSV A;  4PS7 A;  1L6U A;  1KOT A;  2AL6 A;  2KKC A;  3NZS A;  1R8G A;  1TIF A;  3WAP A;  3U7Z A;  3GB1 A;  2NTT A;  2AQ1 B;  2YEP F;  2K39 A;  3VUX A;  4EKU A;  1JWB D;  2LD9 A;  3DRE A;  3QAQ A;  3M95 A;  3NUH B;  1TY2 A;  2IGD A;  1FD6 A;  1VZ7 A;  3PZ7 A;  2MBQ A;  1IGC A;  1XF5 L;  2XN9 C;  2GRI A;  4LNF A;  2PVO D;  3RMK C;  1J0G A;  2N1V A;  4ZRP A;  3DHG C;  3Q69 A;  1FEH A;  1YN4 A;  3EHV A;  2B76 B;  4RF1 A;  1R4M B;  2WQY B;  1WSP A;  2VZK B;  4XWT A;  1HZ5 A;  4AOF A;  1D5M C;  4C7Z A;  1LO5 D;  2W55 A;  4E74 A;  2PLP A;  1V2Y A;  3W1Y A;  4IWQ A;  2V1Y A;  3HM3 A;  2INC C;  2GBR A;  1VD2 A;  2LGX A;  1RFK A;  1JCK B;  1VRA B;  2INP E;  1X1M A;  2IO2 B;  5DPT A;  2X8X X;  2WDV B;  1BUI C;  1V97 A;  2MCN B;  2FBW B;  1WXA A;  2BW2 A;  1CMX B;  4XWW A;  1FRR A;  3Q8C A;  2J0K A;  1Z5S B;  2KTF A;  3ZO5 B;  3UQA A;  2KZR A;  5JHB A;  5GMV A;  4RGO S;  1VRP A;  3L13 A;  4MGY E;  4GW0 A;  4J6I A;  1QOG A;  4LDT D;  4EZJ A;  2NPT B;  3UIP B;  1HEZ E;  3I5J C;  4REZ A;  2GWD A;  3DBL B;  2OJR A;  5LLI A;  3U2S C;  5BO4 B;  1FIQ A;  2C5L C;  2K3U A;  2KFJ A;  1DOY A;  4YSX B;  3JYU A;  4CO7 A;  5EDS A;  1OQY A;  4HRO A;  5HG2 A;  3PGE A;  2G9H D;  4LTU A;  2JPH A;  5J18 A;  1C9F A;  3V6C B;  4A9A A;  2IZV B;  4K7U A;  1QOF A;  2IPK D;  2N9E B;  3N30 A;  2CU1 A;  3ZLZ A;  2IYD B;  4NQK E;  2KJR A;  4MAC A;  2LAS A;  3P42 A;  2WXM A;  4WUR A;  2PE6 B;  5H92 C;  2WDR B;  2Z8L A;  1EWY C;  2LJI A;  3JU6 A;  1WXV A;  2DYB A;  4IW0 A;  2KNB A;  5DPS A;  4W9G A;  2KDE B;  1KTK A;  4B95 A;  2BGF A;  3D32 A;  1P3Q U;  2BS3 B;  3P4Q B;  1N5W A;  2ZNV C;  3RNC C;  3EFC A;  3PLV A;  3AM9 A;  5L95 C;  4MDK E;  2W54 A;  4TSS A;  3A1Q A;  1ROE A;  4A90 A;  2BYT A;  1DOX A;  2A5U A;  5GXG B;  3P4S B;  2NBW B;  4LNK A;  3Q6B A;  2PW9 A;  1MI0 A;  1KF6 B;  3P2B A;  2W9N A;  1NVI D;  4BBN F;  4CHK A;  5G5H A;  4B9K A;  4IG7 B;  2NPT A;  4RF9 A;  4HVB A;  5IO9 A;  2JF5 A;  4Z9M A;  2G4D B;  3A9J B;  4EFO A;  2LWP A;  3H7P B;  1K52 A;  3PRM B;  1OEY A;  3PS6 A;  3IHP C;  1DOI A;  1T0S C;  4ITK A;  4M00 A;  2D11 A;  1KLV A;  3UF8 A;  2DBY A;  3NZ3 A;  4K7S A;  1GB4 A;  4MEL A;  4PS8 A;  4O1N A;  3R66 C;  4P1C C;  1WJU A;  3Q3F A;  4M8M A;  2KAN A;  3LVV A;  4KSK C;  2HE7 A;  4WH4 A;  4XX5 A;  2L83 A;  1F52 A;  2JZZ A;  1S1Q B;  3W1S C;  4WWP A;  4K3B A;  2PPH A;  3PRP B;  1EUV B;  2KX3 A;  2W3S A;  4D2K A;  4IC7 B;  1XQQ A;  3FIL A;  3WIM A;  3DOW A;  2FUG 1;  1E10 A;  1OGW A;  3KUZ A;  2LVQ A;  2KDB A;  2A4Z A;  3GZN B;  1ZGU B;  2N9X A;  4FJV B;  4K1R B;  3X23 A;  3ONS A;  1TZO A;  4R3D A;  5IN7 A;  2FE8 A;  3CST A;  2JRI B;  3T8M A;  2KN5 A;  4HDQ A;  3S2A A;  3DVN U;  1K53 A;  2C7H A;  3WAN A;  4YTN B;  3UIN B;  4G50 A;  4OZA A;  3W5V B;  2KJH B;  2WX0 A;  1MHX A;  3A4S C;  1ZUD 2;  1QF6 A;  3MP9 A;  4XE0 A;  3RPF C;  4RF8 A;  1RLF A;  2FAZ A;  3MC0 B;  2JYE A;  5EE1 A;  3AB5 A;  3RCZ A;  4NAM A;  3PHX B;  4KDI C;  2DZI A;  2NMQ A;  4A55 A;  4EZK A;  3ZVV A;  1KLG D;  1C77 A;  3U7D A;  1HE8 A;  2KFK A;  1B1Z A;  2BF8 B;  2AYO B;  3ZRF A;  2LZ6 A;  4ANV A;  2WDQ B;  1LM8 B;  1R4M I;  2LUM A;  1WR1 A;  3IFW B;  2KC2 A;  2RPV A;  4I6P A;  4IUM B;  2L0T A;  3T3N A;  1YQ3 B;  4IDI A;  2MH7 A;  3AEC B;  4RNA A;  1E8X A;  2N4F A;  2V3S A;  3I63 C;  3MFG A;  1YMH E;  2V3P A;  3CF6 E;  1ET6 A;  2BKF A;  3ZXR A;  3EFU A;  3UGB B;  1BG0 A;  5EE3 A;  2M0A A;  3MC9 A;  2KAJ A;  2D10 A;  1P50 A;  2DEN B;  3RN9 C;  3RD2 A;  2AX5 A;  5D3D A;  3N1Z C;  3MHZ A;  1V1P B;  3QIJ A;  3N32 A;  3APD A;  3DWM A;  3AE9 B;  2KWC A;  1SD0 A;  1PQS A;  4E3C A;  3A9J A;  2HDE A;  1NDD A;  3AE3 B;  2BS2 B;  2N1W A;  2M17 A;  2BVC A;  2GI9 A;  4DXF A;  4NQL B;  3VTW A;  2MBB B;  1RM6 C;  1Q10 A;  1WH3 A;  2QDF A;  1VZ6 A;  2LRW A;  4JLC A;  3AE4 B;  3DVN V;  1SE3 A;  1P9D U;  2MP2 B;  3BYT B;  2LVO A;  4Q2J A;  4WQM A;  4GDL A;  3WAM A;  4LNN A;  4A6Q A;  1SF0 A;  1V5T A;  1JQ4 A;  3ZXV A;  1CJE A;  4EOY A;  2LFI A;  4G11 A;  1QKZ A;  1MHH E;  1T5X D;  3A33 B;  4ANW A;  4L2Y A;  2E3T A;  3Q2A C;  2GBJ A;  4DK5 A;  1SJH D;  3TCA A;  1P0R A;  4FBJ B;  4FUL A;  1I4Q A;  3SR6 A;  3VUW A;  3ZRC A;  2JYT A;  2ZVN A;  4NJ7 A;  3RUI B;  4KGT A;  2PMV A;  2D3G A;  2QHO A;  3BVZ A;  1VDV A;  4RH6 A;  2KFK B;  3ML8 A;  4G3X B;  2H89 B;  1ZE3 D;  4AJW A;  2DAF A;  1FXT B;  5IOI A;  3C19 A;  1WE7 A;  2Z0D B;  4JWU C;  1G6J A;  3DBH I;  2BB5 A;  3IG8 A;  1SSN A;  5E6O A;  4BVU C;  3IAM 1;  5E6P A;  5LNK 1;  3ZDT A;  2CHZ A;  3GZN I;  1EO6 A;  3JPZ A;  1PGA A;  2KVR A;  2XK5 B;  3MJW A;  2MBE A;  3VR8 B;  3VRB B;  2SAK A;  4I6L B;  4DQO C;  5BYR A;  2ZPY A;  4BBN C;  2DZK A;  4KZ0 A;  4RM9 A;  2MJ3 A;  4H2A A;  3LN7 A;  1KFY B;  4P16 A;  3EC8 A;  4ZRK A;  4W9I A;  1IUE A;  4K7W A;  3IG3 A;  2BPS A;  1QLB B;  1ZDX A;  3QWZ B;  1MFW A;  2LVP A;  5JZE B;  2W3R A;  3LN6 A;  1V9J A;  1C78 A;  4JPS A;  3B9J A;  3R7R A;  2JSV X;  4XZ4 A;  1WZ0 A;  1T0Q C;  3ZJT A;  1WI0 A;  1IBX B;  3VR9 B;  2WHI A;  2Y5P A;  1QOA A;  2J7Q B;  3RNG C;  2N9K A;  1Y56 A;  2JU6 X;  3I3T B;  2J42 A;  3TEZ A;  3PT2 B;  3NY5 A;  1WM3 A;  2K1F A;  1L4Z B;  1A5R A;  4TQ1 A;  3P1M A;  1WXS A;  4TMA B;  4DHJ D;  1FMA D;  4OVU A;  2L52 A;  3H1U A;  2KQ7 A;  1L6V A;  4ACF A;  4F7Z A;  1PGB A;  5LXI B;  4GDK A;  1AW7 A;  3W9C B;  4II3 B;  1TS4 A;  3I9V 1;  3LVW A;  3Q8A A;  1JWS D;  1P7E A;  5T8I A;  1WRI A;  3SFE B;  2KDF B;  1UWM A;  4RF0 A;  4EZL A;  2JUO A;  1FO4 A;  2HJ1 A;  2KQS A;  4KGS A;  3ZNG C;  1FPY A;  3SDL C;  2KWU B;  1QQR A;  4HJG E;  3VQI A;  2KQ4 X;  5BMH A;  3C8Y A;  4L23 A;  2KYW A;  3ZNH B;  2PJH A;  3ETR A;  5J2R A;  3PPA A;  4WJQ A;  2LGD A;  5AZG A;  1ZPS A;  2KLG A;  3QAR A;  4AS1 A;  4KGR A;  1F2R I;  2LEK A;  2IND C;  3BZD B;  3BYY B;  1UD7 A;  5H8Y E;  1I4G A;  2EMT A;  1J7B A;  4WWN A;  3TEX A;  5AUK A;  2QC8 A;  3L10 B;  3AN1 A;  1S3S G;  1WXQ A;  2D32 A;  4C4V B;  2IO0 B;  3KLS X;  1TYG B;  2JX5 A;  4ASW C;  3EA6 A;  3TIX A;  4AM1 A;  1EF1 A;  3W5U B;  3FAH A;  1GPX A;  4E71 A;  2MJD A;  2YVC A;  4JIO U;  4DXA B;  2LRU A;  2K6D B;  1UF0 A;  3U30 A;  3AE8 B;  5KHO A;  3PRE A;  1F0Z A;  4B0E A;  4KZC A;  1XCQ L;  3RNA C;  5C2T B;  2HTM E;  1T3Q A;  3W1S A;  1I4H A;  2VH1 A;  1RAX A;  4AJY B;  3TJP A;  2G1E A;  1L4D B;  1OFF A;  1P1A A;  2XBB C;  2O6V B;  3R2T A;  1I0E A;  2W82 A;  1JWA D;  4NJ6 A;  2NR2 A;  2WYQ A;  1SE2 A;  1NYR A;  1BXT A;  2LHE A;  2N9P C;  1TS2 A;  3PHW B;  2KHW B;  2GBN A;  5HHD G;  1XO3 A;  3ECI A;  1YIW A;  1LXD A;  2OED A;  3DBL I;  3VAW A;  1JAL A;  2R2Q A;  3APC A;  3QHT A;  4J3O D;  1E8W A;  4G0N B;  5CX3 A;  3NG0 A;  2K8C A;  1JRP A;  3UIO B;  2K8B A;  3EUB 2;  1R7S A;  2AQ2 B;  2DLB A;  2D33 A;  1WM2 A;  2J52 A;  2QCZ A;  2EEL A;  2RDB C;  3H7P A;  4BG4 A;  1V49 A;  3BWU D;  4W9K A;  3NVY A;  3VHT C;  4DDG D;  2N7D A;  2DAJ A;  1ZP0 B;  4LK0 M;  2D5G A;  1SXT A;  1E9M A;  1GC7 A;  1YD8 U;  2WP9 B;  2IO1 B;  2RDG A;  4XC2 A;  1GAQ B;  1L0V B;  1PYW D;  2ZW1 A;  2BQQ A;  1TT4 A;  1E8Z A;  4US9 A;  1QOB A;  1ACC A;  2CHW A;  3NVW A;  3IXS A;  4GDK B;  4K3C A;  4HCP B;  2WLB A;  4MSM B;  2OOB B;  2BWE S;  2DZJ A;  3PZD A;  3TL5 A;  2FCS A;  1CZP A;  1E8Y A;  4W9D A;  2GBK A;  2MEK A;  3BY4 B;  1TJE A;  2RGF A;  3B0A A;  2K6Q A;  2RMM A;  3H8H A;  3ZYY X;  4FA6 A;  1YOV B;  1UUP A;  2FCN A;  4ZYN A;  5C3J B;  3OJ3 A;  2CJO A;  2LHD A;  2ON8 A;  3NS1 A;  2C7M B;  2IY1 B;  3PZ8 A;  1SE4 A;  2JVC A;  3HRD D;  3GE8 C;  1MVK A;  3DBS A;  2ZCB A;  2ONQ A;  4BZA A;  2LGI A;  3I57 A;  2J53 A;  3DBR I;  4FLH A;  2WXN A;  2I2Y A;  1SIF A;  1KJT A;  3QJZ A;  1N62 A;  1TS3 A;  2KK8 A;  4P6V F;  1UZX B;  4KV2 A;  5CHF A;  4MGK E;  1TS5 A;  3B1L X;  3O65 B;  4BHL A;  3PO0 A;  2MSE D;  2OJW A;  4W9E A;  5D94 A;  1XD3 B;  3BIN A;  4L1B A;  1TKY A;  4M01 A;  2I1K A;  3RNF C;  1D4B A;  4BG4 B;  1YN3 A;  1V6E A;  3VRA B;  1J19 A;  5AEK B;  3OAW A;  3VH4 B;  1K51 A;  2M8S A;  3NZT A;  3B6R A;  1N60 A;  3M63 B;  1IGD A;  2LXC A;  4RM8 A;  2BYV E;  2JT4 B;  1NEN B;  2JXT A;  1TGZ B;  4A3P A;  1P52 A;  1NBF C;  5D7G A;  4MM3 A;  2L1A A;  1E7P B;  1NYQ A;  3V62 A;  2G3Q B;  2KWD A;  2IGH A;  2V9H A;  4LJP B;  3WAO A;  2IO3 B;  3JW0 X;  4KSL C;  3V61 A;  2R2O A;  3P4P B;  3HIZ A;  2M56 B;  1V4G A;  4P7I A;  3VXW A;  2MLB A;  5E6N A;  3APF A;  2YEP B;  2ZEQ A;  1T0Y A;  5D3I B;  1WGK A;  2VH2 A;  2XNA C;  1I7H A;  3ENE A;  3MC8 A;  3RNB C;  5FK9 C;  1BML C;  4JWS C;  1YJJ A;  3AH7 A;  4URK A;  1GC6 A;  2LMC A;  4AWJ A;  2D2Q A;  1WGD A;  4OZB A;  3Q14 C;  1SB3 C;  2KC1 A;  2EMS A;  1WMH A;  4RGT A;  3VUY A;  5I4D A;  3HK0 A;  4MEM A;  5AZH A;  4NY0 A;  1TKG A;  1I4X A;  1TY0 A;  3WA0 A;  3KWL A;  3NVZ A;  4YXD B;  5MPO A;  4GXB A;  5BMI A;  3DCG A;  3LJ3 A;  2WXH A;  3BII D;  4BFR A;  3U52 E;  3A9K A;  1VZ8 A;  1WXM A;  1XCT L;  1WFY A;  1WJ6 A;  4WJN A; 
#chains in the Genus database with same CATH homology
 1F1H A;  1P52 A;  3JU5 A;  5J9A A;  2D3B A;  3L2E B;  4Q2R A;  4LNF A;  3JPZ A;  4LNN A;  1CRK A;  3FKY A;  2J1Q A;  2CRK A;  1HTQ A;  3L2E A;  3L2D A;  4RF9 A;  4AM1 A;  4GVY A;  4BG4 A;  2LGS A;  3ZXR A;  4BAX A;  2UU7 A;  4S17 A;  4BG4 B;  4HPP A;  1QH4 A;  2BVC A;  1RL9 A;  3DRB A;  3M10 A;  1BG0 A;  4GVZ A;  4Z9M A;  3JQ3 A;  3ZXV A;  5J99 A;  1G0W A;  4LNK A;  2QC8 A;  1U6R A;  1P50 A;  4RF7 A;  2D3A A;  4S0R A;  4LNI A;  4XYC A;  1I0E A;  4ACF A;  1LGR A;  3B6R A;  1HTO A;  4GW2 A;  4RF6 A;  4RF8 A;  1F52 A;  3NG0 A;  2D3C A;  1QK1 A;  1FPY A;  3DRE A;  1VRP A;  2WGS A;  4BHL A;  1M15 A;  2OJW A;  2WHI A;  2GLS A;  4GW0 A;  1SD0 A;  4LNO A;  3JU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...