2BVCA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structure of Mycobacterium Tuberculosis Glutamine Synthetase in Complex with a Transition-State Mimic Provides Functional Insights.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 157
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2bvcA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2bvcA02
1FPYA 2LGSA 4LNNA 4BHLA 2WGSA 2D3AA 4S0RA 1U6RA 2D3BA 1SD0A 3L2DA 3ZXRA 1I0EA 2J1QA 4RF9A 4GW2A 2UU7A 1HTQA 1HTOA 1F52A 4BG4A 4BAXA 2WHIA 4GVYA 2CRKA 3DRBA 3NG0A 3JU6A 2QC8A 4RF7A 4XYCA 4LNFA 1G0WA 1RL9A 4RF8A 1P52A 3JPZA 3JQ3A 4AM1A 2OJWA 4BG4B 5J9AA 4GVZA 1LGRA 4S17A 4GW0A 5J99A 4LNIA 4ACFA 1QK1A 3DREA 1M15A 3L2EA 3M10A 1CRKA 3JU5A 2BVCA 3ZXVA 1F1HA 2GLSA 2D3CA 4Q2RA 4RF6A 4Z9MA 4LNKA 1BG0A 4LNOA 1QH4A 1P50A 4HPPA 3B6RA 3L2EB 1VRPA 3FKYA
chains in the Genus database with same CATH superfamily
4JE3B 2A5UA 2DENB 2LASA 3VHTC 3H6NA 2KJHB 5KHOA 1V5TA 2MRPA 4ZHOA 4DDID 1OEYJ 2GI9A 3DHGC 3SD5A 2M19A 1I4RA 2SAKA 5D3IB 1SJHD 3NZTA 1KTKA 4M0WB 2I2YA 4YSZB 4JWSC 2IGHA 3LDZE 4ICUA 3W1YA 1E9MA 5EE0A 2R2QA 4ICVA 2GOWA 3HM3A 3Q8CA 1TGZB 3NHEB 3RT3B 4ZRPA 3URYA 3ZDMC 5FR6A 1JRPA 4PK1A 3AEFB 1YMHE 2L32A 4LLGM 1GUAB 3AM9A 4YTMB 4FJZA 4II3B 4A3OA 2ON8A 1S3SG 3NVWA 1QOAA 3LVWA 1L0XB 1UGMA 1GJZA 4M8MA 1TS2A 1FCCC 3X23A 2R2OA 4MGKE 3AV8A 4DBGA 3L10B 1R4MB 1JWSD 1IBXB 2BS2B 4K7SA 4NJ7A 2PIAA 5KHQA 2N0SB 1WYWB 2MJ3A 2M56B 2IY0B 4GB9A 4IUMB 1SE9A 1AWDA 1C9FA 2BB5A 3C8YA 3U7DA 2DYBA 1Y56A 2PTLA 4GSWA 1JROA 3DRBA 3V61A 3UI3A 4WIPA 1HZ6A 1UBIA 2ZCBA 2NPTA 1I7HA 1GG3A 1V49A 2WDTB 2KMAA 4CHKA 1YQ4B 1VZ6A 3IAM1 1MHHE 2MJDA 1HQRD 1IGCA 1PUTA 4DHZB 1TBEA 4GLSC 2FCQA 3CMMB 3KUZA 1FEHA 4A55A 1U4AA 1I4XA 4F7ZA 1JWBD 1NI2A 3TEXA 1SIJA 4KGTA 1PQSA 3IG3A 3PRZA 3KWVA 3TCAA 1ZPSA 1YJIA 4HK2A 4GIVA 1FXTB 1M94A 5GXGB 1N61A 2JWZA 3NY5A 1HTQA 4BFRA 3IG5A 2QEJC 2DYOA 3BVGA 1F2RC 2LXAA 1WMHA 2MX2A 2HE7A 4Z9MA 4HLEA 3DDCB 5DCNA 4Q2JA 4XGAB 2JX5A 2J1QA 4WAAA 3DHHC 2BYTA 1K52A 3AEGB 2K0PA 1N60A 4WURA 3BY4B 2HJ8A 4ZYSA 2N1VA 2DBYA 2BKFA 1TKGA 1F0ZA 1L0VB 4BKSA 3DWMA 1C4CA 1AYFA 4MM3A 1MG4A 1D4BA 1V6EA 3MC8A 2WS3B 2JXTA 3U8ZA 4BBNC 2W3SA 3L0WB 1C4PA 2MBOA 2O6VA 1B1ZA 1T6BX 2INCC 2LHEA 2LRWA 4RF1A 4E3CA 3AE6B 1CRKA 1WM2A 1NVID 2RGFA 3M62B 3WAOA 4KVGB 4GDKA 1N5XA 1VJKA 3GE3C 2KQSA 3SU8X 4RCOA 3QJZA 1FXAA 2UWQA 3IXSA 4RGOS 4GW2A 1RYJA 2BKRB 3ZTDA 3VAWA 2N4FA 3HUIA 2VZKD 2GBRA 2JRIB 2JZZA 3V05A 1JALA 4ZHPA 1JCKB 2G3QB 2KTFA 1BUIC 5BMGA 5TSSA 2CJNA 2IGGA 2QJLA 5J2RA 1DOYA 5BYSA 2OJRA 3Q69A 1VRPA 2C7HA 3L4PA 1FIQA 4C00A 1I4QA 3KH0A 4A9AA 1Q10A 2LUMA 4RF7A 5AEKB 1C79A 4R3DA 1WIAA 2J42A 2IO1B 1CK1A 5L83A 4MT5A 2JYTA 3I57A 3EGRA 1GOZA 3FILB 2IDYA 1FNUA 5AUKA 1NBFC 5IKCM 2KN4A 2DHZA 2CJOA 4RGMA 3QAQA 2J53A 2WDVB 3OAWA 4MH0E 1EU4A 2MP2A 3NS8A 1IBXA 1XD3B 3NUHB 3NVYA 4TSSA 3QCAA 3M10A 4FADA 4AQ7A 4HPLB 1ET9A 2BT6A 4HXDA 1Z2MA 2V3PA 4TUUA 2M0AA 4RF0A 2KFKB 2AQ3B 1SD0A 2EELA 1ET6A 5HI1A 1T0SC 2KDMA 1P9DU 1PGBA 3W5UB 3C19A 2AL6A 4KZCA 3L13A 4J6IA 1L4DB 1OQRA 1V1OA 4CQNA 4P1CC 4YSYB 1KM7A 3OLMD 1VR9A 1T0QC 1VZ8A 3RUIB 2V4IB 3K9OB 5LXIB 2L0FA 2KVZA 4W9DA 3ZJVA 4KSKC 2EMTA 1XEEA 4ANWA 1YN5A 1TS5A 3A1QB 2Z0EB 1UNSA 2ZW1A 2JSVX 2LGDA 1I42A 1LO5D 2KT7A 4LDTD 4AJWA 2DWQA 4JLCA 2J0KA 2DLBA 2BYEA 4MJSA 2WDQB 1OTRB 3D32A 2FCSA 3VTUA 3VTWA 1C76A 2VH2A 4G50A 2JQRB 3HVZA 3PVLA 1XCQL 2JWUA 1SXTA 2KANA 5CHFA 2KWUB 3AE7B 3CF6E 3PTFC 4Q2RA 1V86A 4ANVA 3ECIA 3DQVA 3W2DA 3B0AA 2D10A 3PLVA 3JPZA 2LJ5A 2AL3A 4AWJA 1MHXA 4MGYE 3ZO5B 4GW0A 1N62A 2KMCA 2WP9B 5JZEB 1JRUA 3DBSA 4TMAB 4AJYB 2EKEC 1WYGA 2INDC 1AW7A 4JL9A 1P50A 2EMSA 3RN9C 3DBRB 1N63A 3R2TA 3GOEA 2G9HD 1MPEA 2WXJA 1HTOA 3BIID 1TJEA 2QDFA 1CQVA 4IWPA 3JVZX 3A9JA 3AE8B 1QK1A 1M15A 1F2RI 3AE4B 3CSTA 5BO4B 2K8BA 3CSFA 2TSSA 1D3ZA 1D6EC 1QOGA 2CU3A 1WX9A 3ZRCA 4B95A 1E8XA 3VR8B 5IN7A 2RDGA 3MP9A 1V4GA 2D2QA 2FUG1 4KIKA 2G4SA 1Z5SB 4BKGA 4C7ZA 3APCA 3NVVA 2X8XX 1UELA 3BINA 2AQ1B 3DBHI 5CHWA 3SEBA 1WGKA 3H1UA 1PGXA 1SJED 3TSSA 1AN8A 2NPTB 2NTTA 1WR1A 4QAYA 1PDXA 3VUYA 2BWES 2K3UA 5D2MB 1AARA 3ZIMA 3VRAB 1YX5B 2NR2A 1SF0A 4MDKE 1E6EB 1FFUA 5LLIA 1F9JA 1SEBD 4E74A 2ZNVC 3IHPC 5J18A 1K8RB 1XLQA 2DZJA 2GRIA 2K25A 3OWEB 2R61A 2KVRA 3Q3NC 2OOBB 3ALBA 4G3XB 2KQ4X 1SBBB 2KX3A 1E8WA 2I38A 2M4NA 1ISNA 4M00A 3AE3B 3N3KB 2BBCA 1OGWA 4EEWA 2OEDA 3P63A 2CRKA 4RMAA 2NCNA 3E9SA 3L54A 3ZDTA 3WIMA 5J99A 3NS1A 5T8IA 4BKTA 1IYFA 1L2NA 2LXCA 3PZ7A 1E7VA 1PYWD 3ZNHB 1P7EA 2D32A 2DNFA 2PMVA 2PJHA 5J17A 2UU7A 2M17A 3KLSX 4YWGG 4AP4C 4JX1C 2PE6B 4RH6A 4DHJD 4C56C 3V6EB 1WXVA 2H88B 4KZ0A 2BYVE 2ZPYA 1WGYA 2BF8B 2LGSA 3I63C 1XCTL 4MM3B 1OQQA 4IWOA 1D5ZC 2QC8A 3QA8A 1GB4A 3DVNU 3I5JC 4KKJA 1TS4A 5HHDG 2YVCA 3AE9B 3T3OA 4WWNA 2O6VB 2KNBA 1BT0A 4K1RB 3ZVVA 1JWMD 2N9LA 1WRDB 4GDKB 1TYGB 2AQ2B 3N32A 4W9HA 3WAPA 5FR3A 3EFUA 5H92C 3J9CA 3Q2AC 2CS4A 2FBWB 3JYUA 2AX5A 2D5GA 3OG5A 1BXTA 1P98A 4IC7B 2G4DB 3KQ4A 3K9PB 3P4QB 1R4NI 1WXAA 1EM7A 1I4HA 2D3AA 2MJEA 4TQ1A 4ZYNA 1WE6A 1E7UA 2XN9C 4HDQA 4KSLC 1KFYB 1QILA 4PS7A 2N7EA 3ZLZA 4WQMA 4YTNB 2ACZB 2KXJA 3AN1A 3VR9B 3CWIA 4ASWC 1X1MA 2KD0A 2D3CA 2K39A 1ZKHA 4GXBA 1J0GA 3RFZB 4W9JA 3ZXRA 2HTHA 1YOVB 3QX1A 3DVGX 2W54A 2KX0A 2VH1A 3Q8AA 2LD9A 3IT4B 3RNBC 1WJUA 1WX8A 1E10A 4F8CB 2MP2B 2BVCA 4C4VA 4I6PA 4WWOA 3M3JA 1BG0A 3BVZA 1DYQA 2JZPA 3KUCB 1XLPA 2ZVNA 1VZ7A 3EFCA 1ZDXA 2W55A 2MA9B 2WXNA 2WXRA 3OJ3A 3O13A 2MQJA 3A33B 4A6QA 2KDEB 4FHJA 2QILA 5D94A 4TV3A 4ZOHC 4JIOU 2V0GA 4P16A 3ZGZA 3SHQA 4RF6A 1E7PB 2KDIA 2KWDA 2PVOD 2K6QA 1YD8U 2A4ZA 1ZUD2 2N9PC 3DVNV 2KZRA 3U2SC 2WXQA 1RRBA 4K81A 1EU3A 4O1NA 3KYDD 1VDVA 3UIPB 3MHSD 3AE1B 5BYQA 5CX3A 3NZSA 4N6EB 1CJEA 3PRMB 2BWFA 3ZW3A 1OQYA 5HG2A 4HVBA 5E6OA 4XWWA 2FE8A 2MBHA 4MJSB 2E6XA 1EF1A 3N9YC 1C78A 3ZNGC 1ZW7A 4OZCA 2Z59B 1XO3A 1WM3A 4GOCA 3APDA 3EA6A 4HCPB 3BYTB 3LB8C 2MW5A 3RNFC 4S0RA 4B6WA 4NJ6A 4BG4A 1KOTA 4PS8A 3WA0A 2MSED 4NZLB 2LWPA 1JW9D 4HPMB 2D11A 2LGYA 3HM6X 2N1WA 1UGJA 2MBBB 5DPSA 4EUTA 4W9FA 3B9JA 4J3OD 2RPVA 4MELA 2V3SA 2M1MA 2KC2A 2DZIA 3ZJUA 1M4VA 1UF0A 4LCDE 2XEWA 2UYZB 5CTRC 3QWZB 4B9KA 3SDLC 2GWCA 2NMQA 2YEPB 4LJOB 1GC6A 3A9JB 4IWQA 2B3AA 1FPYA 1MVKA 1MFWA 3MJWA 1D5XC 3HK0A 1ZXIA 1Q1OA 1NI3A 3GE8C 3AEDB 3RNCC 5D7GA 1P52A 2ZVOA 5GMVA 4K3CA 4EE2A 4KIKB 4LK0M 2DAJA 3Q6BA 3L2EA 2GWDA 1UD7A 4PS3A 4IKGA 4OZBA 3ZNZB 4K7WA 1WH3A 2VZKB 1GC7A 2Y3AA 1J7AA 4XX5A 2LFIA 5IAAC 1KLUD 4DHZE 2WLBA 3C0RB 5EE3A 3PZ8A 3JW0X 5G2NA 2KO3A 2LVPA 3UGBB 2NVUI 1WGHA 4JWUC 5MPOA 1SGHA 4YT0B 2IYDB 3OJ4B 1VRAB 2BYFA 2GLSA 2JPHA 3DWGC 4XE0A 1Y8RC 1NYQA 1UH6A 3U7ZA 3L2DA 5L95C 4BOSC 1RWSA 3KUDB 4ZRQA 2MBEA 3ETRA 4MGZE 2I1JA 1IP9A 2H89B 3B2FA 3A9KA 3EHVA 4NQLB 1SE2A 2WNMA 1QF6A 3Q14C 4DQOC 1HZ5A 1VLBA 1EO6A 2ONQA 2IO3B 4AS1A 5JHAA 1H8CA 1NYRA 2HTME 2M0XA 1C3TA 3MFGA 1RL9A 4WJNA 5BMHA 3AI5A 5LXHA 1P0RA 1Q0WB 4YTPB 4WJOA 1VCBA 2ZJDA 5C23A 2O2VA 4ANUA 1E0ZA 2MHJA 3UINB 3B6RA 4C7YA 2GBKA 2REXA 3T9LA 3W9CB 4TQ0A 1FNVA 3N20C 2KWVB 2KJ6A 2ZNVB 2QCZA 3H7PA 1OEYA 3VTVA 1XXGA 3HVDA 3P4SB 5E6NA 3RPFC 1RFKA 3P1MA 3BK1A 4LJPB 2FNJB 2Y5PA 2WYQA 2Y5BB 3AEAB 4LDTB 5E6JA 2LGIA 2KHWB 3DPDA 1LFDA 5JHBA 2NBWB 2KDFB 2NBVB 2C7NB 1DOIA 1HE8A 1V1PA 4LTUA 4A8XC 2IO2B 5BYRA 4L1BA 3NOBA 2FIDA 2WXLA 1F77A 5HKHA 1V2YA 3P42A 3DCGA 3TJPA 3R7QA 2KJRA 3BWUD 2WXIA 4GVYA 2ZCCA 4HEA1 4G11A 2EKIA 4GVZA 3R3MA 1WSPA 3LVVA 1KLVA 2JRHA 4AUQC 3PLUA 2LZ6A 2RR9A 1P3QU 4GDLA 2G45B 1T5XD 3ZRFA 2OHFA 3N1ZC 4BAXA 1TY2A 4I6NB 2MBQA 4IM0A 3RCZA 2L05A 2KFJA 5DPWA 4JPSA 3R2IA 3AH7A 4W9CA 2LEKA 2KMMA 1FRRA 1E8ZA 1FMAD 1TZOA 1C1YB 2C60A 3RZFA 4C4VB 1WFYA 2JT4B 4XDCA 5DPTA 4II2B 3X0WA 1CMXB 3QK0A 4KDIC 1YQ3B 1ENFA 3LN7A 2BB6A 1WGRA 3TEZA 1V97A 3L16A 2W9NA 3Q8FA 4PT5A 2MCNB 2RDHA 1I0EA 1K53A 2WHIA 3B08A 2V4LA 2LI5A 1UWXA 1YN3A 4NQKE 1SB3C 4L2YA 4XC2A 1TZ1A 4AOFA 3QC8B 2QHOA 4XWTA 3ZTCA 2XBBC 3TIXA 4WH4A 2Z0DB 1I35A 4LNOA 1WRIA 4CYEA 1IGDA 4LNNA 4EZKA 4N9F4 4US9A 1NDDA 2ZEQA 2BTEA 1QKZA 1RAXA 1H4RA 4FA6A 4PYUA 1L7YA 1LGRA 3MTNB 3NZUA 1R4MI 1RFAA 5EE1A 2ASQA 2GBMA 3E56A 1I4PA 3I3TB 2KOXA 1T3QA 1F1HA 2QSDA 1YJJA 2Z8LA 4HPPA 4XDDA 4GN1A 2W82A 2GB1A 1L6UA 3L08A 1FRDA 2V3NA 3EC8A 4NAWB 2HJ1A 2WWZA 1GPXA 2C7MB 4LNFA 3KYCD 4OW0A 2G1EA 3ONSA 2L8JA 4BG4B 4A90A 2KWCA 2X38A 3JU5A 4A20A 2K9XA 4FLHA 4GU2A 1TT5B 2K5PA 2MWSB 2CKHB 3M63B 4FBJB 4ZDVA 1YIWA 4DHJB 2WX0A 3W5VB 4MEMA 5H8YE 4FXCA 3DVGY 5AUIA 4C80A 3HHMA 1WZ3A 3JU6A 4ARIA 1G0WA 3NRZA 4OVVA 2DZKA 3ZQ4A 4US8A 2N9EB 3R66C 3DBLI 2IZVB 3W1SC 2D3GA 3ZNID 2PLPA 3EUB2 2BS4B 1HXYD 2L76A 3NG0A 2BGFA 2WX1A 2WU5B 3PPAA 3BYYB 1S1QB 3MC9A 3KVFB 4KX6B 1EWYC 4F1SA 3FAHA 3ZXVA 1EWCA 1L4ZB 3S2AA 1J7CA 4MSQB 3N1XC 4BBNF 3L2EB 4WQOB 4PYZA 2M8SA 4YL8A 3H8HA 1E5WA 2QIEB 2DZMA 2JYEA 3RMKC 4XYCA 3P2BA 3DBHB 2DYMA 4OVUA 4MH8A 3UF8A 3H7SA 4S17A 3NVZA 4NPNA 3ENEA 4HJGE 3AU5A 4W9IA 2KYWA 2HDEA 3MC0B 3VVWB 1GNUA 3IFWB 3LXFA 1SE3A 1WZ0A 1TT4A 1V80A 3QARA 3Q3FA 4M8NA 2GBNA 2J52A 2PVGC 1FFVA 2XNAC 3LJ3A 3W1SA 1ESFA 5JXVA 2JU6X 3DOWA 4M01A 4HWIB 3KWLA 3A9KB 2PEAA 5FKAC 3VH4B 1UZXB 2L00B 4ANXA 1DGJA 4B0MA 5BMIA 1V8CA 3Q3MC 3A4RA 1WF9A 2K8CA 2B76B 2WXGA 1B9RA 4LNKA 2O2VB 2WQYB 2CHWA 3FKYA 3ZYYX 2KTRA 3UQBA 4L23A 1R8GA 4DK5A 5C3JB 3MHZA 3AU4A 1ZOYB 3JSVA 4NNJB 1LQBA 5AZHA 5TR5A 1SSNA 1CZPA 4ZRIA 5CHVC 3H7PB 3T8MA 1K51A 3FC4A 4RM9A 1J7BA 4HROA 1YX6B 2D33A 2K8HA 3WCQA 2NBUA 1HEZE 4MSMB 1JQ4A 3RNGC 2L0TA 1T0YA 3ZKJC 1MI0A 1P1AA 4ARCA 1OFFA 1I4GA 3GZNI 4BOZB 4YSXB 1EF5A 2N9XA 3DBLB 1V1PB 3QQ8B 5C2TB 4OHJA 3ML9A 1XLOA 4NAWA 3AE2B 3PZDA 3TUOA 1T0RC 2D07B 2XK5A 2YEPF 3JQ3A 1JWUD 4ZRJA 2OJWA 3SR6A 4RNAA 1ZP0B 4ITKA 1L6VA 3HIZA 2LJIA 1LXDA 1YN4A 1R4NB 3KW5B 2E3TA 3MJ5A 4HRSA 1HA5A 2WDRB 3VFKA 3DHIC 2GMIC 2RSUA 4BZAA 2KDBA 2JY6A 4IM3A 3GS2A 4MACA 4GDLB 3UQAA 2N7JA 3HRDD 1KLGD 4EZJA 4KKIA 2KLGA 3B2GA 3WAMA 3QIJA 3PO0A 1LM8B 4W9LA 4WJQA 1XQQA 1WE7A 4HJKA 2K6DB 3H9DA 4TKNA 3ABVB 2FIFA 4M02A 4DDGD 2I1KA 4BHLA 4UDUC 4WJPA 1R7SA 2L52A 4EZLA 2J0JA 4EFOA 4WWPA 4B0EA 4CO7A 1PFDA 2JF5A 4KGRA 2MLBA 4I6LB 1JWAD 4MGIE 2PE9A 2WXOA 3A4SC 1KH0A 3PT2B 3T3NA 1TKYA 4X57B 2INNE 2BPSA 2C5LC 2LMCA 1IPGA 2CHXA 3WANA 4NAMA 2KN5A 1PGAA 3P4PB 4DXFA 2V9HA 1KRHA 2RD0A 1YJ1A 4P1BC 3CIRB 3AE5B 5EDSA 2J7QB 1SE4A 3O65B 2WXFA 4M0WA 3SFEB 4KGSA 1QT9A 1FD6A 1FM0D 2JXXA 4HKZE 2V1YA 1FNWA 2LRUA 2YLMA 3VRBB 1WX7A 1QLBB 4GMVA 1WJ4A 3GP7A 5E6PA 2W3RA 1Q5WB 2FUHB 3DBRI 2LVQA 2AWTA 2WXHA 5G55A 1V5OA 3RZWC 3Q8BA 2CU1A 1TY0A 4KDLB 1WWTA 1V81A 2DAFA 3V6CB 5EE9A 2KLCA 1ZDVA 4NY0A 1P7FA 3GB1A 1SIFA 2J0MA 3WALA 4N59A 2N7DA 2CHZA 1NEKB 4GGQA 2KK8A 4RF9A 1ZXHA 2AYOB 3AEBB 3GZNB 3SFDB 3IG8A 2Y5CA 2AEHA 4LNIA 4IDIA 4WWMA 1KJTA 1WJNA 2JZ3B 4FN2A 2IBIB 1EUVB 1QQRA 2C9WB 4DXGA 3B1LX 1TS3A 3AXCA 3EECA 2BS3B 1G6JA 1L0YB 1FO4A 1XLNA 4K7UA 2PPHA 1WJ6A 1TIFA 1UBQA 2L3ZA 4OVZA 3TL5A 3BK2A 4YXDB 2KAJA 4H2AA 1L5PA 3RD2A 2JVCA 3VUWA 1ZE3D 3N30A 5D3DA 1ACCA 1XF5L 4IM2A 3V60A 3AULA 4HKQA 3DREA 3AMZA 3QHTA 3VH3B 2Q5WD 4WAFA 2IGDA 4FJYA 2J4XA 1J19A 1J8CA 3U30A 3APFA 4G0NB 4N58A 3RI7C 3TEWA 5G5HA 3RNEC 3BZDB 2PW9A 3NZ3A 4USAA 1RLFA 3M95A 4A3PA 5I4DA 2CR5A 2QMTA 3VQIA 1YQBA 3PHXB 2WGSA 1U6RA 4RFBA 3P4RB 2KQ7A 4URKA 3PREA 1JMLA 1K50A 2BW2A 2SEBD 1UWMA 5IA7A 2INPE 1E8YA 5J9AA 3IVFA 5LNK1 1ROEA 4KV2A 5IOIA 1XT9B 1GAQB 5D6JB 2MEKA 3VDZA 2D3BA 3L17A 1N5WA 2RPQA 4W9EA 1E90A 4D2KA 3U4EG 3TEYA 4XZ4A 2WXPA 3IT6B 2PKOA 1VD2A 2WXKA 4RGNA 1STEA 2IPKD 5JH5C 1GB1A 2HD5B 1UUPA 1QOBA 5IP4D 1KF6B 2DX5B 3AB5A 2LHDA 2IO0B 2KACA 5C1ZA 1BMLC 3PHWB 2L1AA 2KTRB 3I9V1 2LUEA 3ZUNA 3PSEB 1MJDA 1N6ZA 1WGDA 4DXAB 2L83A 4JQWC 1A70A 2FCMA 4K3BA 2ZPNA 1IUEA 3JSVB 3TBLD 4JGHB 3NJTA 5AZFA 4P7IA 2ZZPB 1DOXA 3ZJTA 3U52E 5FK9C 2L7RA 2FCNA 4ZRKA 1TKEA 1TTNA 1C4AA 1WXMA 3Q8EA 1F52A 4E71A 3AECB 1C77A 4REZA 4RF8A 2FAZA 1QZEA 2ICIA 2IJ0A 3TMPB 4ACFA 1RM6C 3FILA 5AZGA 3PV1A 2ZW0A 1D5MC 4RM8A 3R7RA 3ML8A 4IW0A 3UIOB 5IO9A 3AEEB 3IAS1 4IG7B 1QOFA 2KKCA 4FULA 2XK5B 4DWFA 3PS6A 5G5GA 3V3XA 2KFKA 1WY8A 4W9GA 1V9JA 3Q3OC 1WMHB 1WI0A 3PGEA 4EOYA 3LYYA 1WXQA 1A5RA 4BVUC 2BQQA 4OZAA 3IBEA 2WXMA 3V62A 1WGGA 4W9KA 2NS5A 4NJCA 4EKUA 3PRPB 2LVOA 2K1FA 4AM1A 4BKSD 1ZGUB 3Q3JA 4RGTA 5HFYA 4HDOA 2JUOA 3RNAC 1QH4A 2GBJA 1NENB 1WXSA 1YNTE 1FXIA 1VA6A 1FCLA 2KC1A 3A1QA 2IY1B 4P6VF 2LGXA 4HCNB 1MG8A 2O6VD 1WR6E 2K22A 4FJVB 2WU2B 2N9KA 3VUXA 3RULA 3LN6A 3N1YC 4FHKA 2RDBC 2RMMA 3RYTA 4IOIE 5DPRA 3VXWA 2VRRB 2MH7A 2NTSA 3R8BA 3BVMA
chains in the Genus database with same CATH topology
1FPYA 2LGSA 4LNNA 4BHLA 2WGSA 2D3AA 4S0RA 1U6RA 2D3BA 1SD0A 3L2DA 3ZXRA 1I0EA 2J1QA 4RF9A 4GW2A 2UU7A 1HTQA 1HTOA 1F52A 4BG4A 4BAXA 2WHIA 4GVYA 2CRKA 3DRBA 3NG0A 3JU6A 2QC8A 4RF7A 4XYCA 4LNFA 1G0WA 1RL9A 4RF8A 1P52A 3JPZA 3JQ3A 4AM1A 2OJWA 4BG4B 5J9AA 4GVZA 1LGRA 4S17A 4GW0A 5J99A 4LNIA 4ACFA 1QK1A 3DREA 1M15A 3L2EA 3M10A 1CRKA 3JU5A 2BVCA 3ZXVA 1F1HA 2GLSA 2D3CA 4Q2RA 4RF6A 4Z9MA 4LNKA 1BG0A 4LNOA 1QH4A 1P50A 4HPPA 3B6RA 3L2EB 1VRPA 3FKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPY A;  2LGS A;  4LNN A;  4BHL A;  2WGS A;  2D3A A;  4S0R A;  1U6R A;  2D3B A;  1SD0 A;  3L2D A;  3ZXR A;  1I0E A;  2J1Q A;  4RF9 A;  4GW2 A;  2UU7 A;  1HTQ A;  1HTO A;  1F52 A;  4BG4 A;  4BAX A;  2WHI A;  4GVY A;  2CRK A;  3DRB A;  3NG0 A;  3JU6 A;  2QC8 A;  4RF7 A;  4XYC A;  4LNF A;  1G0W A;  1RL9 A;  4RF8 A;  1P52 A;  3JPZ A;  3JQ3 A;  4AM1 A;  2OJW A;  4BG4 B;  5J9A A;  4GVZ A;  1LGR A;  4S17 A;  4GW0 A;  5J99 A;  4LNI A;  4ACF A;  1QK1 A;  3DRE A;  1M15 A;  3L2E A;  3M10 A;  1CRK A;  3JU5 A;  2BVC A;  3ZXV A;  1F1H A;  2GLS A;  2D3C A;  4Q2R A;  4RF6 A;  4Z9M A;  4LNK A;  1BG0 A;  4LNO A;  1QH4 A;  1P50 A;  4HPP A;  3B6R A;  3L2E B;  1VRP A;  3FKY A; 
#chains in the Genus database with same CATH topology
 4JE3 B;  2A5U A;  2DEN B;  2LAS A;  3VHT C;  3H6N A;  2KJH B;  5KHO A;  1V5T A;  2MRP A;  4ZHO A;  4DDI D;  1OEY J;  2GI9 A;  3DHG C;  3SD5 A;  2M19 A;  1I4R A;  2SAK A;  5D3I B;  1SJH D;  3NZT A;  1KTK A;  4M0W B;  2I2Y A;  4YSZ B;  4JWS C;  2IGH A;  3LDZ E;  4ICU A;  3W1Y A;  1E9M A;  5EE0 A;  2R2Q A;  4ICV A;  2GOW A;  3HM3 A;  3Q8C A;  1TGZ B;  3NHE B;  3RT3 B;  4ZRP A;  3URY A;  3ZDM C;  5FR6 A;  1JRP A;  4PK1 A;  3AEF B;  1YMH E;  2L32 A;  4LLG M;  1GUA B;  3AM9 A;  4YTM B;  4FJZ A;  4II3 B;  4A3O A;  2ON8 A;  1S3S G;  3NVW A;  1QOA A;  3LVW A;  1L0X B;  1UGM A;  1GJZ A;  4M8M A;  1TS2 A;  1FCC C;  3X23 A;  2R2O A;  4MGK E;  3AV8 A;  4DBG A;  3L10 B;  1R4M B;  1JWS D;  1IBX B;  2BS2 B;  4K7S A;  4NJ7 A;  2PIA A;  5KHQ A;  2N0S B;  1WYW B;  2MJ3 A;  2M56 B;  2IY0 B;  4GB9 A;  4IUM B;  1SE9 A;  1AWD A;  1C9F A;  2BB5 A;  3C8Y A;  3U7D A;  2DYB A;  1Y56 A;  2PTL A;  4GSW A;  1JRO A;  3DRB A;  3V61 A;  3UI3 A;  4WIP A;  1HZ6 A;  1UBI A;  2ZCB A;  2NPT A;  1I7H A;  1GG3 A;  1V49 A;  2WDT B;  2KMA A;  4CHK A;  1YQ4 B;  1VZ6 A;  3IAM 1;  1MHH E;  2MJD A;  1HQR D;  1IGC A;  1PUT A;  4DHZ B;  1TBE A;  4GLS C;  2FCQ A;  3CMM B;  3KUZ A;  1FEH A;  4A55 A;  1U4A A;  1I4X A;  4F7Z A;  1JWB D;  1NI2 A;  3TEX A;  1SIJ A;  4KGT A;  1PQS A;  3IG3 A;  3PRZ A;  3KWV A;  3TCA A;  1ZPS A;  1YJI A;  4HK2 A;  4GIV A;  1FXT B;  1M94 A;  5GXG B;  1N61 A;  2JWZ A;  3NY5 A;  1HTQ A;  4BFR A;  3IG5 A;  2QEJ C;  2DYO A;  3BVG A;  1F2R C;  2LXA A;  1WMH A;  2MX2 A;  2HE7 A;  4Z9M A;  4HLE A;  3DDC B;  5DCN A;  4Q2J A;  4XGA B;  2JX5 A;  2J1Q A;  4WAA A;  3DHH C;  2BYT A;  1K52 A;  3AEG B;  2K0P A;  1N60 A;  4WUR A;  3BY4 B;  2HJ8 A;  4ZYS A;  2N1V A;  2DBY A;  2BKF A;  1TKG A;  1F0Z A;  1L0V B;  4BKS A;  3DWM A;  1C4C A;  1AYF A;  4MM3 A;  1MG4 A;  1D4B A;  1V6E A;  3MC8 A;  2WS3 B;  2JXT A;  3U8Z A;  4BBN C;  2W3S A;  3L0W B;  1C4P A;  2MBO A;  2O6V A;  1B1Z A;  1T6B X;  2INC C;  2LHE A;  2LRW A;  4RF1 A;  4E3C A;  3AE6 B;  1CRK A;  1WM2 A;  1NVI D;  2RGF A;  3M62 B;  3WAO A;  4KVG B;  4GDK A;  1N5X A;  1VJK A;  3GE3 C;  2KQS A;  3SU8 X;  4RCO A;  3QJZ A;  1FXA A;  2UWQ A;  3IXS A;  4RGO S;  4GW2 A;  1RYJ A;  2BKR B;  3ZTD A;  3VAW A;  2N4F A;  3HUI A;  2VZK D;  2GBR A;  2JRI B;  2JZZ A;  3V05 A;  1JAL A;  4ZHP A;  1JCK B;  2G3Q B;  2KTF A;  1BUI C;  5BMG A;  5TSS A;  2CJN A;  2IGG A;  2QJL A;  5J2R A;  1DOY A;  5BYS A;  2OJR A;  3Q69 A;  1VRP A;  2C7H A;  3L4P A;  1FIQ A;  4C00 A;  1I4Q A;  3KH0 A;  4A9A A;  1Q10 A;  2LUM A;  4RF7 A;  5AEK B;  1C79 A;  4R3D A;  1WIA A;  2J42 A;  2IO1 B;  1CK1 A;  5L83 A;  4MT5 A;  2JYT A;  3I57 A;  3EGR A;  1GOZ A;  3FIL B;  2IDY A;  1FNU A;  5AUK A;  1NBF C;  5IKC M;  2KN4 A;  2DHZ A;  2CJO A;  4RGM A;  3QAQ A;  2J53 A;  2WDV B;  3OAW A;  4MH0 E;  1EU4 A;  2MP2 A;  3NS8 A;  1IBX A;  1XD3 B;  3NUH B;  3NVY A;  4TSS A;  3QCA A;  3M10 A;  4FAD A;  4AQ7 A;  4HPL B;  1ET9 A;  2BT6 A;  4HXD A;  1Z2M A;  2V3P A;  4TUU A;  2M0A A;  4RF0 A;  2KFK B;  2AQ3 B;  1SD0 A;  2EEL A;  1ET6 A;  5HI1 A;  1T0S C;  2KDM A;  1P9D U;  1PGB A;  3W5U B;  3C19 A;  2AL6 A;  4KZC A;  3L13 A;  4J6I A;  1L4D B;  1OQR A;  1V1O A;  4CQN A;  4P1C C;  4YSY B;  1KM7 A;  3OLM D;  1VR9 A;  1T0Q C;  1VZ8 A;  3RUI B;  2V4I B;  3K9O B;  5LXI B;  2L0F A;  2KVZ A;  4W9D A;  3ZJV A;  4KSK C;  2EMT A;  1XEE A;  4ANW A;  1YN5 A;  1TS5 A;  3A1Q B;  2Z0E B;  1UNS A;  2ZW1 A;  2JSV X;  2LGD A;  1I42 A;  1LO5 D;  2KT7 A;  4LDT D;  4AJW A;  2DWQ A;  4JLC A;  2J0K A;  2DLB A;  2BYE A;  4MJS A;  2WDQ B;  1OTR B;  3D32 A;  2FCS A;  3VTU A;  3VTW A;  1C76 A;  2VH2 A;  4G50 A;  2JQR B;  3HVZ A;  3PVL A;  1XCQ L;  2JWU A;  1SXT A;  2KAN A;  5CHF A;  2KWU B;  3AE7 B;  3CF6 E;  3PTF C;  4Q2R A;  1V86 A;  4ANV A;  3ECI A;  3DQV A;  3W2D A;  3B0A A;  2D10 A;  3PLV A;  3JPZ A;  2LJ5 A;  2AL3 A;  4AWJ A;  1MHX A;  4MGY E;  3ZO5 B;  4GW0 A;  1N62 A;  2KMC A;  2WP9 B;  5JZE B;  1JRU A;  3DBS A;  4TMA B;  4AJY B;  2EKE C;  1WYG A;  2IND C;  1AW7 A;  4JL9 A;  1P50 A;  2EMS A;  3RN9 C;  3DBR B;  1N63 A;  3R2T A;  3GOE A;  2G9H D;  1MPE A;  2WXJ A;  1HTO A;  3BII D;  1TJE A;  2QDF A;  1CQV A;  4IWP A;  3JVZ X;  3A9J A;  3AE8 B;  1QK1 A;  1M15 A;  1F2R I;  3AE4 B;  3CST A;  5BO4 B;  2K8B A;  3CSF A;  2TSS A;  1D3Z A;  1D6E C;  1QOG A;  2CU3 A;  1WX9 A;  3ZRC A;  4B95 A;  1E8X A;  3VR8 B;  5IN7 A;  2RDG A;  3MP9 A;  1V4G A;  2D2Q A;  2FUG 1;  4KIK A;  2G4S A;  1Z5S B;  4BKG A;  4C7Z A;  3APC A;  3NVV A;  2X8X X;  1UEL A;  3BIN A;  2AQ1 B;  3DBH I;  5CHW A;  3SEB A;  1WGK A;  3H1U A;  1PGX A;  1SJE D;  3TSS A;  1AN8 A;  2NPT B;  2NTT A;  1WR1 A;  4QAY A;  1PDX A;  3VUY A;  2BWE S;  2K3U A;  5D2M B;  1AAR A;  3ZIM A;  3VRA B;  1YX5 B;  2NR2 A;  1SF0 A;  4MDK E;  1E6E B;  1FFU A;  5LLI A;  1F9J A;  1SEB D;  4E74 A;  2ZNV C;  3IHP C;  5J18 A;  1K8R B;  1XLQ A;  2DZJ A;  2GRI A;  2K25 A;  3OWE B;  2R61 A;  2KVR A;  3Q3N C;  2OOB B;  3ALB A;  4G3X B;  2KQ4 X;  1SBB B;  2KX3 A;  1E8W A;  2I38 A;  2M4N A;  1ISN A;  4M00 A;  3AE3 B;  3N3K B;  2BBC A;  1OGW A;  4EEW A;  2OED A;  3P63 A;  2CRK A;  4RMA A;  2NCN A;  3E9S A;  3L54 A;  3ZDT A;  3WIM A;  5J99 A;  3NS1 A;  5T8I A;  4BKT A;  1IYF A;  1L2N A;  2LXC A;  3PZ7 A;  1E7V A;  1PYW D;  3ZNH B;  1P7E A;  2D32 A;  2DNF A;  2PMV A;  2PJH A;  5J17 A;  2UU7 A;  2M17 A;  3KLS X;  4YWG G;  4AP4 C;  4JX1 C;  2PE6 B;  4RH6 A;  4DHJ D;  4C56 C;  3V6E B;  1WXV A;  2H88 B;  4KZ0 A;  2BYV E;  2ZPY A;  1WGY A;  2BF8 B;  2LGS A;  3I63 C;  1XCT L;  4MM3 B;  1OQQ A;  4IWO A;  1D5Z C;  2QC8 A;  3QA8 A;  1GB4 A;  3DVN U;  3I5J C;  4KKJ A;  1TS4 A;  5HHD G;  2YVC A;  3AE9 B;  3T3O A;  4WWN A;  2O6V B;  2KNB A;  1BT0 A;  4K1R B;  3ZVV A;  1JWM D;  2N9L A;  1WRD B;  4GDK B;  1TYG B;  2AQ2 B;  3N32 A;  4W9H A;  3WAP A;  5FR3 A;  3EFU A;  5H92 C;  3J9C A;  3Q2A C;  2CS4 A;  2FBW B;  3JYU A;  2AX5 A;  2D5G A;  3OG5 A;  1BXT A;  1P98 A;  4IC7 B;  2G4D B;  3KQ4 A;  3K9P B;  3P4Q B;  1R4N I;  1WXA A;  1EM7 A;  1I4H A;  2D3A A;  2MJE A;  4TQ1 A;  4ZYN A;  1WE6 A;  1E7U A;  2XN9 C;  4HDQ A;  4KSL C;  1KFY B;  1QIL A;  4PS7 A;  2N7E A;  3ZLZ A;  4WQM A;  4YTN B;  2ACZ B;  2KXJ A;  3AN1 A;  3VR9 B;  3CWI A;  4ASW C;  1X1M A;  2KD0 A;  2D3C A;  2K39 A;  1ZKH A;  4GXB A;  1J0G A;  3RFZ B;  4W9J A;  3ZXR A;  2HTH A;  1YOV B;  3QX1 A;  3DVG X;  2W54 A;  2KX0 A;  2VH1 A;  3Q8A A;  2LD9 A;  3IT4 B;  3RNB C;  1WJU A;  1WX8 A;  1E10 A;  4F8C B;  2MP2 B;  2BVC A;  4C4V A;  4I6P A;  4WWO A;  3M3J A;  1BG0 A;  3BVZ A;  1DYQ A;  2JZP A;  3KUC B;  1XLP A;  2ZVN A;  1VZ7 A;  3EFC A;  1ZDX A;  2W55 A;  2MA9 B;  2WXN A;  2WXR A;  3OJ3 A;  3O13 A;  2MQJ A;  3A33 B;  4A6Q A;  2KDE B;  4FHJ A;  2QIL A;  5D94 A;  4TV3 A;  4ZOH C;  4JIO U;  2V0G A;  4P16 A;  3ZGZ A;  3SHQ A;  4RF6 A;  1E7P B;  2KDI A;  2KWD A;  2PVO D;  2K6Q A;  1YD8 U;  2A4Z A;  1ZUD 2;  2N9P C;  3DVN V;  2KZR A;  3U2S C;  2WXQ A;  1RRB A;  4K81 A;  1EU3 A;  4O1N A;  3KYD D;  1VDV A;  3UIP B;  3MHS D;  3AE1 B;  5BYQ A;  5CX3 A;  3NZS A;  4N6E B;  1CJE A;  3PRM B;  2BWF A;  3ZW3 A;  1OQY A;  5HG2 A;  4HVB A;  5E6O A;  4XWW A;  2FE8 A;  2MBH A;  4MJS B;  2E6X A;  1EF1 A;  3N9Y C;  1C78 A;  3ZNG C;  1ZW7 A;  4OZC A;  2Z59 B;  1XO3 A;  1WM3 A;  4GOC A;  3APD A;  3EA6 A;  4HCP B;  3BYT B;  3LB8 C;  2MW5 A;  3RNF C;  4S0R A;  4B6W A;  4NJ6 A;  4BG4 A;  1KOT A;  4PS8 A;  3WA0 A;  2MSE D;  4NZL B;  2LWP A;  1JW9 D;  4HPM B;  2D11 A;  2LGY A;  3HM6 X;  2N1W A;  1UGJ A;  2MBB B;  5DPS A;  4EUT A;  4W9F A;  3B9J A;  4J3O D;  2RPV A;  4MEL A;  2V3S A;  2M1M A;  2KC2 A;  2DZI A;  3ZJU A;  1M4V A;  1UF0 A;  4LCD E;  2XEW A;  2UYZ B;  5CTR C;  3QWZ B;  4B9K A;  3SDL C;  2GWC A;  2NMQ A;  2YEP B;  4LJO B;  1GC6 A;  3A9J B;  4IWQ A;  2B3A A;  1FPY A;  1MVK A;  1MFW A;  3MJW A;  1D5X C;  3HK0 A;  1ZXI A;  1Q1O A;  1NI3 A;  3GE8 C;  3AED B;  3RNC C;  5D7G A;  1P52 A;  2ZVO A;  5GMV A;  4K3C A;  4EE2 A;  4KIK B;  4LK0 M;  2DAJ A;  3Q6B A;  3L2E A;  2GWD A;  1UD7 A;  4PS3 A;  4IKG A;  4OZB A;  3ZNZ B;  4K7W A;  1WH3 A;  2VZK B;  1GC7 A;  2Y3A A;  1J7A A;  4XX5 A;  2LFI A;  5IAA C;  1KLU D;  4DHZ E;  2WLB A;  3C0R B;  5EE3 A;  3PZ8 A;  3JW0 X;  5G2N A;  2KO3 A;  2LVP A;  3UGB B;  2NVU I;  1WGH A;  4JWU C;  5MPO A;  1SGH A;  4YT0 B;  2IYD B;  3OJ4 B;  1VRA B;  2BYF A;  2GLS A;  2JPH A;  3DWG C;  4XE0 A;  1Y8R C;  1NYQ A;  1UH6 A;  3U7Z A;  3L2D A;  5L95 C;  4BOS C;  1RWS A;  3KUD B;  4ZRQ A;  2MBE A;  3ETR A;  4MGZ E;  2I1J A;  1IP9 A;  2H89 B;  3B2F A;  3A9K A;  3EHV A;  4NQL B;  1SE2 A;  2WNM A;  1QF6 A;  3Q14 C;  4DQO C;  1HZ5 A;  1VLB A;  1EO6 A;  2ONQ A;  2IO3 B;  4AS1 A;  5JHA A;  1H8C A;  1NYR A;  2HTM E;  2M0X A;  1C3T A;  3MFG A;  1RL9 A;  4WJN A;  5BMH A;  3AI5 A;  5LXH A;  1P0R A;  1Q0W B;  4YTP B;  4WJO A;  1VCB A;  2ZJD A;  5C23 A;  2O2V A;  4ANU A;  1E0Z A;  2MHJ A;  3UIN B;  3B6R A;  4C7Y A;  2GBK A;  2REX A;  3T9L A;  3W9C B;  4TQ0 A;  1FNV A;  3N20 C;  2KWV B;  2KJ6 A;  2ZNV B;  2QCZ A;  3H7P A;  1OEY A;  3VTV A;  1XXG A;  3HVD A;  3P4S B;  5E6N A;  3RPF C;  1RFK A;  3P1M A;  3BK1 A;  4LJP B;  2FNJ B;  2Y5P A;  2WYQ A;  2Y5B B;  3AEA B;  4LDT B;  5E6J A;  2LGI A;  2KHW B;  3DPD A;  1LFD A;  5JHB A;  2NBW B;  2KDF B;  2NBV B;  2C7N B;  1DOI A;  1HE8 A;  1V1P A;  4LTU A;  4A8X C;  2IO2 B;  5BYR A;  4L1B A;  3NOB A;  2FID A;  2WXL A;  1F77 A;  5HKH A;  1V2Y A;  3P42 A;  3DCG A;  3TJP A;  3R7Q A;  2KJR A;  3BWU D;  2WXI A;  4GVY A;  2ZCC A;  4HEA 1;  4G11 A;  2EKI A;  4GVZ A;  3R3M A;  1WSP A;  3LVV A;  1KLV A;  2JRH A;  4AUQ C;  3PLU A;  2LZ6 A;  2RR9 A;  1P3Q U;  4GDL A;  2G45 B;  1T5X D;  3ZRF A;  2OHF A;  3N1Z C;  4BAX A;  1TY2 A;  4I6N B;  2MBQ A;  4IM0 A;  3RCZ A;  2L05 A;  2KFJ A;  5DPW A;  4JPS A;  3R2I A;  3AH7 A;  4W9C A;  2LEK A;  2KMM A;  1FRR A;  1E8Z A;  1FMA D;  1TZO A;  1C1Y B;  2C60 A;  3RZF A;  4C4V B;  1WFY A;  2JT4 B;  4XDC A;  5DPT A;  4II2 B;  3X0W A;  1CMX B;  3QK0 A;  4KDI C;  1YQ3 B;  1ENF A;  3LN7 A;  2BB6 A;  1WGR A;  3TEZ A;  1V97 A;  3L16 A;  2W9N A;  3Q8F A;  4PT5 A;  2MCN B;  2RDH A;  1I0E A;  1K53 A;  2WHI A;  3B08 A;  2V4L A;  2LI5 A;  1UWX A;  1YN3 A;  4NQK E;  1SB3 C;  4L2Y A;  4XC2 A;  1TZ1 A;  4AOF A;  3QC8 B;  2QHO A;  4XWT A;  3ZTC A;  2XBB C;  3TIX A;  4WH4 A;  2Z0D B;  1I35 A;  4LNO A;  1WRI A;  4CYE A;  1IGD A;  4LNN A;  4EZK A;  4N9F 4;  4US9 A;  1NDD A;  2ZEQ A;  2BTE A;  1QKZ A;  1RAX A;  1H4R A;  4FA6 A;  4PYU A;  1L7Y A;  1LGR A;  3MTN B;  3NZU A;  1R4M I;  1RFA A;  5EE1 A;  2ASQ A;  2GBM A;  3E56 A;  1I4P A;  3I3T B;  2KOX A;  1T3Q A;  1F1H A;  2QSD A;  1YJJ A;  2Z8L A;  4HPP A;  4XDD A;  4GN1 A;  2W82 A;  2GB1 A;  1L6U A;  3L08 A;  1FRD A;  2V3N A;  3EC8 A;  4NAW B;  2HJ1 A;  2WWZ A;  1GPX A;  2C7M B;  4LNF A;  3KYC D;  4OW0 A;  2G1E A;  3ONS A;  2L8J A;  4BG4 B;  4A90 A;  2KWC A;  2X38 A;  3JU5 A;  4A20 A;  2K9X A;  4FLH A;  4GU2 A;  1TT5 B;  2K5P A;  2MWS B;  2CKH B;  3M63 B;  4FBJ B;  4ZDV A;  1YIW A;  4DHJ B;  2WX0 A;  3W5V B;  4MEM A;  5H8Y E;  4FXC A;  3DVG Y;  5AUI A;  4C80 A;  3HHM A;  1WZ3 A;  3JU6 A;  4ARI A;  1G0W A;  3NRZ A;  4OVV A;  2DZK A;  3ZQ4 A;  4US8 A;  2N9E B;  3R66 C;  3DBL I;  2IZV B;  3W1S C;  2D3G A;  3ZNI D;  2PLP A;  3EUB 2;  2BS4 B;  1HXY D;  2L76 A;  3NG0 A;  2BGF A;  2WX1 A;  2WU5 B;  3PPA A;  3BYY B;  1S1Q B;  3MC9 A;  3KVF B;  4KX6 B;  1EWY C;  4F1S A;  3FAH A;  3ZXV A;  1EWC A;  1L4Z B;  3S2A A;  1J7C A;  4MSQ B;  3N1X C;  4BBN F;  3L2E B;  4WQO B;  4PYZ A;  2M8S A;  4YL8 A;  3H8H A;  1E5W A;  2QIE B;  2DZM A;  2JYE A;  3RMK C;  4XYC A;  3P2B A;  3DBH B;  2DYM A;  4OVU A;  4MH8 A;  3UF8 A;  3H7S A;  4S17 A;  3NVZ A;  4NPN A;  3ENE A;  4HJG E;  3AU5 A;  4W9I A;  2KYW A;  2HDE A;  3MC0 B;  3VVW B;  1GNU A;  3IFW B;  3LXF A;  1SE3 A;  1WZ0 A;  1TT4 A;  1V80 A;  3QAR A;  3Q3F A;  4M8N A;  2GBN A;  2J52 A;  2PVG C;  1FFV A;  2XNA C;  3LJ3 A;  3W1S A;  1ESF A;  5JXV A;  2JU6 X;  3DOW A;  4M01 A;  4HWI B;  3KWL A;  3A9K B;  2PEA A;  5FKA C;  3VH4 B;  1UZX B;  2L00 B;  4ANX A;  1DGJ A;  4B0M A;  5BMI A;  1V8C A;  3Q3M C;  3A4R A;  1WF9 A;  2K8C A;  2B76 B;  2WXG A;  1B9R A;  4LNK A;  2O2V B;  2WQY B;  2CHW A;  3FKY A;  3ZYY X;  2KTR A;  3UQB A;  4L23 A;  1R8G A;  4DK5 A;  5C3J B;  3MHZ A;  3AU4 A;  1ZOY B;  3JSV A;  4NNJ B;  1LQB A;  5AZH A;  5TR5 A;  1SSN A;  1CZP A;  4ZRI A;  5CHV C;  3H7P B;  3T8M A;  1K51 A;  3FC4 A;  4RM9 A;  1J7B A;  4HRO A;  1YX6 B;  2D33 A;  2K8H A;  3WCQ A;  2NBU A;  1HEZ E;  4MSM B;  1JQ4 A;  3RNG C;  2L0T A;  1T0Y A;  3ZKJ C;  1MI0 A;  1P1A A;  4ARC A;  1OFF A;  1I4G A;  3GZN I;  4BOZ B;  4YSX B;  1EF5 A;  2N9X A;  3DBL B;  1V1P B;  3QQ8 B;  5C2T B;  4OHJ A;  3ML9 A;  1XLO A;  4NAW A;  3AE2 B;  3PZD A;  3TUO A;  1T0R C;  2D07 B;  2XK5 A;  2YEP F;  3JQ3 A;  1JWU D;  4ZRJ A;  2OJW A;  3SR6 A;  4RNA A;  1ZP0 B;  4ITK A;  1L6V A;  3HIZ A;  2LJI A;  1LXD A;  1YN4 A;  1R4N B;  3KW5 B;  2E3T A;  3MJ5 A;  4HRS A;  1HA5 A;  2WDR B;  3VFK A;  3DHI C;  2GMI C;  2RSU A;  4BZA A;  2KDB A;  2JY6 A;  4IM3 A;  3GS2 A;  4MAC A;  4GDL B;  3UQA A;  2N7J A;  3HRD D;  1KLG D;  4EZJ A;  4KKI A;  2KLG A;  3B2G A;  3WAM A;  3QIJ A;  3PO0 A;  1LM8 B;  4W9L A;  4WJQ A;  1XQQ A;  1WE7 A;  4HJK A;  2K6D B;  3H9D A;  4TKN A;  3ABV B;  2FIF A;  4M02 A;  4DDG D;  2I1K A;  4BHL A;  4UDU C;  4WJP A;  1R7S A;  2L52 A;  4EZL A;  2J0J A;  4EFO A;  4WWP A;  4B0E A;  4CO7 A;  1PFD A;  2JF5 A;  4KGR A;  2MLB A;  4I6L B;  1JWA D;  4MGI E;  2PE9 A;  2WXO A;  3A4S C;  1KH0 A;  3PT2 B;  3T3N A;  1TKY A;  4X57 B;  2INN E;  2BPS A;  2C5L C;  2LMC A;  1IPG A;  2CHX A;  3WAN A;  4NAM A;  2KN5 A;  1PGA A;  3P4P B;  4DXF A;  2V9H A;  1KRH A;  2RD0 A;  1YJ1 A;  4P1B C;  3CIR B;  3AE5 B;  5EDS A;  2J7Q B;  1SE4 A;  3O65 B;  2WXF A;  4M0W A;  3SFE B;  4KGS A;  1QT9 A;  1FD6 A;  1FM0 D;  2JXX A;  4HKZ E;  2V1Y A;  1FNW A;  2LRU A;  2YLM A;  3VRB B;  1WX7 A;  1QLB B;  4GMV A;  1WJ4 A;  3GP7 A;  5E6P A;  2W3R A;  1Q5W B;  2FUH B;  3DBR I;  2LVQ A;  2AWT A;  2WXH A;  5G55 A;  1V5O A;  3RZW C;  3Q8B A;  2CU1 A;  1TY0 A;  4KDL B;  1WWT A;  1V81 A;  2DAF A;  3V6C B;  5EE9 A;  2KLC A;  1ZDV A;  4NY0 A;  1P7F A;  3GB1 A;  1SIF A;  2J0M A;  3WAL A;  4N59 A;  2N7D A;  2CHZ A;  1NEK B;  4GGQ A;  2KK8 A;  4RF9 A;  1ZXH A;  2AYO B;  3AEB B;  3GZN B;  3SFD B;  3IG8 A;  2Y5C A;  2AEH A;  4LNI A;  4IDI A;  4WWM A;  1KJT A;  1WJN A;  2JZ3 B;  4FN2 A;  2IBI B;  1EUV B;  1QQR A;  2C9W B;  4DXG A;  3B1L X;  1TS3 A;  3AXC A;  3EEC A;  2BS3 B;  1G6J A;  1L0Y B;  1FO4 A;  1XLN A;  4K7U A;  2PPH A;  1WJ6 A;  1TIF A;  1UBQ A;  2L3Z A;  4OVZ A;  3TL5 A;  3BK2 A;  4YXD B;  2KAJ A;  4H2A A;  1L5P A;  3RD2 A;  2JVC A;  3VUW A;  1ZE3 D;  3N30 A;  5D3D A;  1ACC A;  1XF5 L;  4IM2 A;  3V60 A;  3AUL A;  4HKQ A;  3DRE A;  3AMZ A;  3QHT A;  3VH3 B;  2Q5W D;  4WAF A;  2IGD A;  4FJY A;  2J4X A;  1J19 A;  1J8C A;  3U30 A;  3APF A;  4G0N B;  4N58 A;  3RI7 C;  3TEW A;  5G5H A;  3RNE C;  3BZD B;  2PW9 A;  3NZ3 A;  4USA A;  1RLF A;  3M95 A;  4A3P A;  5I4D A;  2CR5 A;  2QMT A;  3VQI A;  1YQB A;  3PHX B;  2WGS A;  1U6R A;  4RFB A;  3P4R B;  2KQ7 A;  4URK A;  3PRE A;  1JML A;  1K50 A;  2BW2 A;  2SEB D;  1UWM A;  5IA7 A;  2INP E;  1E8Y A;  5J9A A;  3IVF A;  5LNK 1;  1ROE A;  4KV2 A;  5IOI A;  1XT9 B;  1GAQ B;  5D6J B;  2MEK A;  3VDZ A;  2D3B A;  3L17 A;  1N5W A;  2RPQ A;  4W9E A;  1E90 A;  4D2K A;  3U4E G;  3TEY A;  4XZ4 A;  2WXP A;  3IT6 B;  2PKO A;  1VD2 A;  2WXK A;  4RGN A;  1STE A;  2IPK D;  5JH5 C;  1GB1 A;  2HD5 B;  1UUP A;  1QOB A;  5IP4 D;  1KF6 B;  2DX5 B;  3AB5 A;  2LHD A;  2IO0 B;  2KAC A;  5C1Z A;  1BML C;  3PHW B;  2L1A A;  2KTR B;  3I9V 1;  2LUE A;  3ZUN A;  3PSE B;  1MJD A;  1N6Z A;  1WGD A;  4DXA B;  2L83 A;  4JQW C;  1A70 A;  2FCM A;  4K3B A;  2ZPN A;  1IUE A;  3JSV B;  3TBL D;  4JGH B;  3NJT A;  5AZF A;  4P7I A;  2ZZP B;  1DOX A;  3ZJT A;  3U52 E;  5FK9 C;  2L7R A;  2FCN A;  4ZRK A;  1TKE A;  1TTN A;  1C4A A;  1WXM A;  3Q8E A;  1F52 A;  4E71 A;  3AEC B;  1C77 A;  4REZ A;  4RF8 A;  2FAZ A;  1QZE A;  2ICI A;  2IJ0 A;  3TMP B;  4ACF A;  1RM6 C;  3FIL A;  5AZG A;  3PV1 A;  2ZW0 A;  1D5M C;  4RM8 A;  3R7R A;  3ML8 A;  4IW0 A;  3UIO B;  5IO9 A;  3AEE B;  3IAS 1;  4IG7 B;  1QOF A;  2KKC A;  4FUL A;  2XK5 B;  4DWF A;  3PS6 A;  5G5G A;  3V3X A;  2KFK A;  1WY8 A;  4W9G A;  1V9J A;  3Q3O C;  1WMH B;  1WI0 A;  3PGE A;  4EOY A;  3LYY A;  1WXQ A;  1A5R A;  4BVU C;  2BQQ A;  4OZA A;  3IBE A;  2WXM A;  3V62 A;  1WGG A;  4W9K A;  2NS5 A;  4NJC A;  4EKU A;  3PRP B;  2LVO A;  2K1F A;  4AM1 A;  4BKS D;  1ZGU B;  3Q3J A;  4RGT A;  5HFY A;  4HDO A;  2JUO A;  3RNA C;  1QH4 A;  2GBJ A;  1NEN B;  1WXS A;  1YNT E;  1FXI A;  1VA6 A;  1FCL A;  2KC1 A;  3A1Q A;  2IY1 B;  4P6V F;  2LGX A;  4HCN B;  1MG8 A;  2O6V D;  1WR6 E;  2K22 A;  4FJV B;  2WU2 B;  2N9K A;  3VUX A;  3RUL A;  3LN6 A;  3N1Y C;  4FHK A;  2RDB C;  2RMM A;  3RYT A;  4IOI E;  5DPR A;  3VXW A;  2VRR B;  2MH7 A;  2NTS A;  3R8B A;  3BVM A; 
#chains in the Genus database with same CATH homology
 1FPY A;  2LGS A;  4LNN A;  4BHL A;  2WGS A;  2D3A A;  4S0R A;  1U6R A;  2D3B A;  1SD0 A;  3L2D A;  3ZXR A;  1I0E A;  2J1Q A;  4RF9 A;  4GW2 A;  2UU7 A;  1HTQ A;  1HTO A;  1F52 A;  4BG4 A;  4BAX A;  2WHI A;  4GVY A;  2CRK A;  3DRB A;  3NG0 A;  3JU6 A;  2QC8 A;  4RF7 A;  4XYC A;  4LNF A;  1G0W A;  1RL9 A;  4RF8 A;  1P52 A;  3JPZ A;  3JQ3 A;  4AM1 A;  2OJW A;  4BG4 B;  5J9A A;  4GVZ A;  1LGR A;  4S17 A;  4GW0 A;  5J99 A;  4LNI A;  4ACF A;  1QK1 A;  3DRE A;  1M15 A;  3L2E A;  3M10 A;  1CRK A;  3JU5 A;  2BVC A;  3ZXV A;  1F1H A;  2GLS A;  2D3C A;  4Q2R A;  4RF6 A;  4Z9M A;  4LNK A;  1BG0 A;  4LNO A;  1QH4 A;  1P50 A;  4HPP A;  3B6R A;  3L2E B;  1VRP A;  3FKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...