2BVCA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structure of Mycobacterium Tuberculosis Glutamine Synthetase in Complex with a Transition-State Mimic Provides Functional Insights.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 157
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2bvcA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2bvcA02
1F1HA 4GW0A 5J9AA 4LNNA 4RF8A 4ACFA 4GVZA 4GVYA 3ZXVA 2CRKA 4RF7A 3JU6A 1HTQA 4BG4B 3DRBA 2D3CA 2QC8A 4S17A 3L2EB 1FPYA 4LNOA 1BG0A 4LNKA 1M15A 2D3BA 2D3AA 1RL9A 1HTOA 3NG0A 2UU7A 4LNFA 1G0WA 1P52A 1QK1A 3L2DA 4HPPA 2BVCA 4Q2RA 1QH4A 2LGSA 1F52A 1VRPA 3DREA 5J99A 4LNIA 4BHLA 3JQ3A 1I0EA 1P50A 3ZXRA 2GLSA 1LGRA 4GW2A 4AM1A 4BG4A 2WHIA 2J1QA 4RF9A 4RF6A 4S0RA 3M10A 4Z9MA 2WGSA 3JU5A 4BAXA 3B6RA 1CRKA 3L2EA 2OJWA 1SD0A 1U6RA 3JPZA 4XYCA 3FKYA
chains in the Genus database with same CATH superfamily
3UIPB 3PHXB 2ICIA 2KFKB 2KDEB 1L4ZB 5KHQA 2LJIA 3ECIA 3X23A 3ENEA 5EE3A 5EDSA 1YJJA 2V9HA 1MG8A 1N6ZA 2JRIB 1ACCA 3APFA 1SJED 2WXKA 2LVPA 4RNAA 4AUQC 3R3MA 4RF8A 1FCLA 2BKRB 1S3SG 4KDLB 3IG3A 4W9LA 4AS1A 1WMHA 1YX5B 2AL6A 2FIDA 2WXGA 2ZVNA 1C79A 1QH4A 5CX3A 5FR6A 1WRDB 3JW0X 2IO3B 1R4NI 2OJWA 2M17A 4W9IA 3CMMB 2M4NA 5FK9C 1FNWA 1LFDA 1YOVB 2KQ4X 3NHEB 4N59A 2JPHA 4A9AA 2WXPA 2QILA 2JWUA 4CO7A 4URKA 4KKJA 4MT5A 2KD0A 4X57B 4IWOA 2KHWB 1I4GA 1JRUA 3GOEA 4IWPA 4Z9MA 5L83A 1SBBB 3UGBB 1OEYJ 2ZZPB 4W9DA 4A6QA 4B0MA 2K39A 1FM0D 4NQKE 3RYTA 1E0ZA 3T3OA 5JHBA 1PGBA 2I2YA 4RF7A 5DCNA 4K7WA 3VDZA 1KLUD 2K3UA 4KSLC 2BPSA 2J53A 3P63A 4ANXA 1D5XC 1KH0A 3LDZE 4ZRKA 2KJ6A 2WHIA 2BW2A 1Y56A 2KAJA 4LNNA 2CJOA 5EE1A 3HUIA 4RGMA 3LB8C 1AWDA 4DWFA 5FKAC 1MHHE 3M3JA 3Q8EA 2W3RA 4HROA 3DREA 4REZA 1OEYA 1VZ8A 4ANVA 4XE0A 3NOBA 2V0GA 3AECB 3PV1A 5C23A 2LUMA 3KW5B 5JH5C 3ZJUA 3L13A 2XBBC 5CTRC 1PUTA 1L0XB 1QF6A 4M0WB 2KWUB 5IN7A 2ZW1A 3RPFC 4JWUC 3PZ7A 1WX9A 1VJKA 2C60A 1ESFA 2PPHA 2NR2A 1U4AA 2FIFA 4A3PA 4KGRA 3AE3B 3WA0A 5C3JB 3A9JB 3PLVA 3AE4B 3TIXA 2CS4A 2IY1B 3AXCA 1IPGA 1FXAA 2UWQA 1N5XA 1WYGA 3DDCB 4EZJA 4K81A 3QQ8B 1H4RA 1AARA 2BS3B 2KWDA 3PSEB 1HE8A 1YMHE 2HJ8A 1D3ZA 2LZ6A 3W9CB 2MBBB 3ZNHB 1ZDXA 1ZUD2 5IKCM 1WXSA 1NVID 1E7VA 2WXRA 3AEFB 4BG4A 2RMMA 4KZCA 1N63A 2FBWB 2B3AA 1MJDA 1WE6A 4RGNA 2D10A 2ON8A 1Q5WB 2MP2B 3BWUD 2LFIA 3JVZX 4PS3A 1KM7A 1YN5A 4P1CC 2LVOA 4HJGE 1UWXA 2A5UA 2PLPA 4ZOHC 2LRWA 5H8YE 4P1BC 3URYA 4OHJA 1JW9D 2BYEA 2NMQA 3B9JA 2AQ2B 5J2RA 3OJ4B 3R7RA 3Q6BA 1TIFA 2D2QA 3IT4B 1WXMA 1E10A 3QHTA 1BUIC 2BKFA 1VRPA 1KOTA 4A3OA 2B76B 4OW0A 3M63B 1WF9A 4W9EA 2FCSA 1OFFA 4WQOB 2JX5A 3JSVA 2JWZA 3TMPB 3HVDA 1JCKB 2INCC 4JL9A 3EUB2 2ZPYA 3N3KB 2JRHA 4C4VA 3ZJTA 1SSNA 3Q8AA 1DOXA 3ABVB 4KZ0A 1JROA 1TYGB 2LHEA 1ZW7A 2I1JA 4YSZB 2AX5A 1L2NA 2KMAA 1WGGA 3V3XA 4RFBA 2JY6A 5LLIA 4L23A 3DQVA 2REXA 1UWMA 1XF5L 2DAFA 5CHVC 2D32A 2DWQA 1L4DB 4GDKB 1GOZA 1J8CA 2Z59B 2WGSA 4MM3B 2K6DB 2KT7A 2KANA 2L7RA 1TT5B 1LQBA 1GUAB 2KJHB 1HZ6A 3M62B 1TTNA 3PRMB 2MJEA 3PLUA 1YIWA 1ZOYB 2LHDA 3ZRFA 1ZGUB 4ARIA 4W9GA 1P1AA 2JXTA 2PKOA 1UZXB 4C7ZA 2WDRB 2DHZA 1JRPA 1YN4A 1WR6E 1RYJA 2X38A 4YSXB 2RDBC 4KV2A 3V6EB 2R2OA 3RNCC 1E8ZA 1IP9A 4I6PA 3W5VB 3PREA 1FNUA 1KFYB 3O65B 1L7YA 4G0NB 1T0YA 3BK2A 2PMVA 2M8SA 4M8MA 2AL3A 2M0XA 1WR1A 1WGKA 1WJ4A 1P50A 4GW2A 2KFKA 2J1QA 1SIFA 3ZDMC 2J4XA 2K25A 4FHKA 4I6NB 4I6LB 2N9EB 4RCOA 3WCQA 4HCNB 4ACFA 4NY0A 2PJHA 3P2BA 4M01A 2X8XX 4AOFA 3GZNI 3L2DA 4XWWA 1C77A 3EA6A 4BHLA 2ZCCA 2KC1A 4NJ7A 4HPMB 1FD6A 1SXTA 4ZYNA 1LGRA 1FNVA 2FCQA 3C8YA 3FILB 1N61A 3RNEC 4TUUA 1GJZA 2AWTA 2L00B 1NYQA 1JQ4A 2JT4B 2KVZA 2LXAA 3CSTA 3VUXA 3HIZA 2KFJA 2BVCA 1TBEA 1SE2A 2LD9A 4MSMB 4JPSA 2LI5A 3IAM1 2BB6A 4RF1A 2RSUA 3DBSA 4WWPA 3PRZA 2NS5A 1T6BX 5HKHA 3KUCB 1B9RA 3OWEB 2BT6A 2CJNA 4AJWA 1VZ6A 4RF0A 4LJPB 4K7SA 3MJWA 1EO6A 3IFWB 4M8NA 2K0PA 1I35A 1JALA 3TEZA 5BYQA 5AZGA 2ZW0A 2N9LA 3MJ5A 4HCPB 2M1MA 4GW0A 4UDUC 2G3QB 1WYWB 1BXTA 4AWJA 1C4CA 3L08A 1WZ0A 3UINB 2LXCA 2IDYA 1RWSA 4IOIE 5IP4D 1SB3C 2D33A 1ET6A 1T0RC 1GNUA 2GB1A 3A9KB 1M94A 2Q5WD 1NI3A 3JPZA 1NYRA 3MC9A 4C4VB 4Q2RA 3VH3B 2W54A 3IT6B 2VRRB 2GBNA 2JVCA 3P4RB 2EKEC 2N4FA 2D3AA 1G0WA 2MW5A 1E9MA 4LNIA 2CKHB 2PEAA 3O13A 3ZNID 1UGMA 1ZPSA 3MC0B 4M0WA 3APDA 4HRSA 1FRRA 2QHOA 2NCNA 3ZXVA 2MJDA 1JWSD 2DBYA 1L6UA 3IBEA 3I5JC 3LXFA 2MBOA 3AB5A 3N1YC 1V49A 1J7CA 3QARA 1L5PA 2K8BA 3BYTB 4GLSC 5D2MB 1P7FA 3ML8A 1C4AA 2R61A 1Z5SB 3VQIA 3KLSX 4FADA 1J19A 1GC6A 2DZJA 4TQ0A 4J3OD 4II3B 2QCZA 2G1EA 2MBEA 2N9XA 3W2DA 1YX6B 4ZRIA 3WAPA 2ONQA 3V05A 1A5RA 5D6JB 3DWMA 1WX7A 1QQRA 2BB5A 5TSSA 2C7NB 2O2VB 1TY0A 4EZLA 1QOGA 1SIJA 4IDIA 3V6CB 3PTFC 3W1YA 3HVZA 2ZJDA 4S17A 1NENB 5C1ZA 1WM2A 2D3BA 4K1RB 2JF5A 1MVKA 2MWSB 5LNK1 1D6EC 2L52A 2MSED 1TS3A 2WXMA 1FCCC 4KGSA 2QDFA 3L10B 3Q3MC 2V3NA 2JYEA 4YT0B 4IM3A 3DCGA 2MP2A 2WS3B 3ZRCA 3NUHB 2LVQA 1P9DU 1T0SC 1HXYD 1V5OA 1WSPA 2KLCA 3IG5A 2K5PA 3H7SA 2MCNB 1MG4A 4DHZB 2YVCA 3BINA 3MTNB 2FUG1 2LGXA 2K8CA 1V4GA 1A70A 2MH7A 1KJTA 2NBWB 5G5HA 5D7GA 3VUWA 3D32A 4EKUA 4DHJB 1PGAA 3FKYA 4B95A 4BBNC 3VR9B 4GVZA 3NVZA 3AE7B 3EFUA 5EE0A 5JHAA 1R7SA 1WWTA 3AN1A 3GP7A 1WIAA 1I4XA 2BQQA 3R2TA 4KVGB 5J99A 1C76A 1J7BA 1VDVA 1WGHA 4RGOS 3PGEA 4MELA 4HK2A 4KIKB 2CU3A 1CQVA 1FFVA 2HDEA 3H1UA 3NS8A 1E90A 1WJ6A 4GXBA 1F1HA 1Q1OA 2KWCA 2RGFA 1X1MA 5CHFA 3FC4A 3AEDB 3IG8A 1SE3A 5AUIA 4W9HA 5HFYA 3ZGZA 1AYFA 2HTHA 3EHVA 2IGGA 2W3SA 3DHHC 3P4SB 4A90A 5BO4B 1WH3A 2IBIB 2WXHA 5G2NA 2Y3AA 1L0YB 1D5ZC 4IKGA 4GDKA 2C7MB 3AU5A 3ZTDA 1YNTE 4BKTA 3KUZA 2JYTA 4DBGA 1I42A 4FJZA 1K50A 4MM3A 5IAAC 1WE7A 2N7DA 3WALA 1E7PB 2H88B 2MLBA 4XDDA 3NZTA 2XK5B 1D5MC 3WAOA 2LRUA 2FAZA 2V3PA 3SEBA 3AE8B 2VH1A 2ZNVC 2M56B 3TSSA 2J0JA 4NAWB 3VFKA 4FA6A 3TEYA 2NBUA 4D2KA 4MGZE 2L3ZA 1WM3A 4E3CA 5LXIB 2WU5B 4GIVA 2KMMA 4FXCA 1Q0WB 5JZEB 2OHFA 3SHQA 2MRPA 3MFGA 4IW0A 2JZ3B 4FULA 1GG3A 4C00A 4JGHB 5E6PA 4US9A 3AH7A 5E6JA 4W9FA 2KDFB 1V1OA 1WFYA 4RM9A 1CK1A 3LN6A 1RL9A 1C3TA 4GB9A 2HE7A 3EECA 3DWGC 3A4SC 2HTME 2M19A 1TGZB 1XO3A 3RN9C 4TMAB 2JZPA 2BYVE 4N58A 2WXFA 3Q69A 4BVUC 4GMVA 4RMAA 2OJRA 2R2QA 1F77A 4RGTA 1TZOA 2N1WA 2SAKA 3M10A 3FILA 2INPE 4ZRJA 2J7QB 2A4ZA 3PPAA 3L17A 3H8HA 1N60A 4YXDB 2PVOD 2GI9A 1PFDA 2BS2B 3Q3NC 4WWMA 4USAA 3VTWA 1E8YA 4FBJB 1WGDA 2VH2A 2G45B 3DBLI 2GBJA 3KVFB 4OZAA 4G50A 4ITKA 1WX8A 3N9YC 3ZLZA 1RM6C 3X0WA 1KLGD 2Z8LA 4HDQA 3DVGY 4M02A 3DHGC 5J17A 4DXGA 4XZ4A 1P98A 1OTRB 3QJZA 1J0GA 3P42A 2GBMA 2H89B 2KDIA 2WWZA 1VA6A 1TKYA 2Y5CA 1P52A 4YTPB 1R8GA 3U30A 2WXLA 1S1QB 4P6VF 5BYSA 4RF9A 1WXAA 2W55A 3AMZA 4MH8A 1KRHA 3U2SC 1WGRA 2DYMA 1I4RA 4E74A 3A9KA 4F7ZA 2YLMA 3BYYB 4L1BA 5GXGB 2WXJA 2N1VA 5HHDG 3BVMA 3NVVA 1LO5D 4QAYA 4LDTB 3GS2A 2J0MA 4RM8A 2WYQA 5AUKA 2I1KA 5DPSA 2LGIA 3NZUA 3ZYYX 3UIOB 1OGWA 1V80A 1TJEA 1GB4A 1RFKA 3ZNZB 3H9DA 2IPKD 4WJOA 4XC2A 3TCAA 3U4EG 3HK0A 1XEEA 1OQYA 3SR6A 4LJOB 4KGTA 4NZLB 2C7HA 2E3TA 3AV8A 4OZBA 2DYBA 2PIAA 3AE1B 3RZWC 4PT5A 2DZMA 4DHJD 4KX6B 4S0RA 1EWYC 4WURA 1FIQA 2MBQA 4PYZA 4WJQA 3BY4B 2WXOA 2XN9C 1V8CA 3AEBB 2LGYA 2W82A 3TBLD 1UNSA 4NNJB 1WZ3A 1B1ZA 5BMIA 1ZXHA 1XCQL 2ZVOA 2CHWA 2O2VA 1ET9A 3DOWA 5D94A 5TR5A 3ML9A 2DX5B 2G9HD 2BF8B 3JU5A 3V61A 4GDLB 3BZDB 4IG7B 3RNBC 4ZHOA 1D4BA 3ZKJC 5JXVA 3JYUA 1HTOA 2KC2A 4P16A 1QK1A 3VHTC 4WAFA 2LUEA 4KDIC 2L83A 3KUDB 4PS8A 3EC8A 3DHIC 1QOBA 3RNFC 2KTRA 1QLBB 1SJHD 1Z2MA 1E7UA 3U7ZA 1V2YA 3QAQA 3Q8CA 4EUTA 3ZQ4A 4DXFA 1YN3A 3VR8B 3Q3FA 4HXDA 1E8WA 3KYDD 4FN2A 1VCBA 4BKGA 2ZNVB 2UU7A 4DHZE 1YQBA 2WLBA 3DVNV 4JE3B 2GLSA 2KLGA 4WH4A 5HI1A 1SE9A 4H2AA 4WIPA 3N30A 1FFUA 2JSVX 2SEBD 2QEJC 1ZP0B 1I4PA 2D5GA 2TSSA 4YSYB 4F1SA 2AQ1B 1VRAB 1FXTB 4KIKA 4CYEA 1BG0A 5DPTA 4ZRQA 3VTUA 4C7YA 1OQRA 3GZNB 3UQAA 2WXIA 4IM2A 1K52A 3RNAC 1UBIA 2BS4B 3HM6X 4XDCA 3B6RA 1GB1A 1SD0A 4P7IA 1LXDA 3BVGA 4HEA1 4HJKA 1PDXA 1MHXA 3P1MA 3L2EB 2RDHA 2WDQB 3NG0A 2NTSA 3AM9A 4DQOC 1ENFA 2N9PC 1MFWA 1XT9B 4A20A 5AEKB 3LN7A 3ZDTA 1XQQA 2BBCA 3W1SC 4MGIE 2YEPB 4OVZA 1TS2A 5BMGA 4WWNA 2BYFA 2XK5A 2LWPA 4R3DA 1EUVB 4BKSD 3LJ3A 2BWFA 2FUHB 5D3IB 2FCMA 1FMAD 4LNFA 2K1FA 2CHZA 4BFRA 4NAWA 3QA8A 1V97A 3R7QA 1XLNA 4LCDE 1VLBA 4C80A 3PZDA 5IOIA 4BOSC 5GMVA 1F2RI 2D11A 5KHOA 2DZIA 1AW7A 3S2AA 2O6VB 2DENB 4HPLB 3IVFA 2IZVB 2MQJA 3VRAB 3Q8FA 2WXNA 2WX1A 2WDTB 4WQMA 3AE5B 1I0EA 2YEPF 2EELA 3DBHB 1LM8B 2KN4A 4LTUA 1EF5A 3SFEB 1UELA 1MPEA 1WI0A 3OLMD 4F8CB 4GU2A 2N0SB 3R2IA 1CJEA 4M00A 1HTQA 1VZ7A 4ARCA 2GMIC 3SDLC 3Q8BA 1TKEA 1V81A 4TV3A 3AEGB 4K3CA 4ZHPA 1E6EB 2GOWA 4MACA 4XWTA 1G6JA 4N9F4 4EE2A 4J6IA 1DYQA 3NY5A 5T8IA 3Q14C 3W1SA 3MHZA 3KWLA 4HKZE 2IJ0A 4A8XC 4BKSA 3DRBA 2OOBB 4WWOA 5H92C 4IWQA 2M0AA 4LDTD 4L2YA 1L0VB 2QMTA 2CU1A 4IM0A 2WQYB 3DVNU 3N1XC 4RH6A 3WANA 3DBRB 3ZTCA 3TEXA 3A1QB 1R4MB 3LYYA 4JLCA 4EFOA 2W9NA 2KTRB 1QKZA 3U8ZA 3VAWA 1SGHA 1TZ1A 2ZPNA 4MEMA 4YL8A 5IO9A 1CMXB 2Z0DB 3RNGC 1V6EA 1UUPA 3RD2A 3AE2B 1CZPA 1J7AA 4XYCA 4JWSC 1IGCA 4FJVB 3T9LA 2WNMA 3K9PB 5E6OA 3WAMA 2L05A 3PZ8A 2LGDA 3AI5A 3MP9A 4WJPA 2C9WB 3HM3A 1XD3B 4CHKA 1VR9A 1P7EA 1SE4A 2INDC 4MGKE 1RRBA 1RAXA 2L32A 4ZYSA 3L0WB 1XLQA 4MDKE 3R66C 3L54A 2V3SA 3KQ4A 1EF1A 3E56A 5EE9A 2Z0EB 3CSFA 3H6NA 2MBHA 3VVWB 1N62A 5BYRA 4KSKC 4BZAA 1IUEA 1NI2A 3V60A 3NZSA 3PHWB 4RF6A 1KLVA 4GSWA 1AN8A 2JUOA 4EEWA 4NQLB 2WX0A 2IYDB 2G4DB 1R4NB 1RLFA 2PW9A 1N5WA 2L0TA 3TL5A 5D3DA 4YTMB 1UGJA 3CIRB 1EU3A 4XX5A 1IGDA 3ZUNA 2N7JA 4MSQB 1ZE3D 3HHMA 1EU4A 3QWZB 1C9FA 4MH0E 3ZW3A 1JWMD 2BTEA 1NEKB 1VD2A 5MPOA 1EWCA 4GVYA 3BK1A 3OJ3A 4ZRPA 1M15A 2KWVB 2LGSA 2IGDA 2HJ1A 3H7PB 2IO2B 4W9KA 3ZXRA 4AQ7A 1HZ5A 2V4LA 1CRKA 3VTVA 2CHXA 3R8BA 3VXWA 3LVWA 2AQ3B 2PTLA 1K8RB 1V1PB 3VH4B 3RZFA 2DLBA 4YTNB 2PVGC 1QOAA 2NTTA 1FPYA 4O1NA 2RD0A 3Q3JA 2MEKA 1KTKA 1DOYA 1WGYA 3HRDD 3TEWA 3IXSA 4GDLA 3NJTA 4GOCA 1UF0A 1C4PA 4NJ6A 2RR9A 1YJ1A 2QJLA 2ZCBA 1MI0A 2AYOB 3C19A 1JWBD 1T3QA 1NDDA 3SFDB 3JU6A 2NPTB 1V86A 4II2B 3PVLA 4PK1A 2QIEB 1BMLC 4MJSB 3B2GA 5E6NA 1JWUD 2QSDA 5AZHA 1HA5A 3PO0A 3JQ3A 1XLPA 3B2FA 4PS7A 3ZIMA 1T0QC 2VZKB 2DYOA 1FEHA 2FE8A 1JMLA 1IBXA 4WJNA 1YJIA 2WU2B 1QOFA 2K9XA 1TT4A 2LJ5A 1F52A 2LMCA 1FRDA 2JU6X 2DNFA 1ZKHA 2O6VD 3QX1A 2V1YA 2KQ7A 3VUYA 4B6WA 1FXIA 1ISNA 3NVYA 3B08A 4DXAB 2MX2A 4EOYA 1WXVA 4LNKA 5BMHA 3MHSD 5L95C 2J52A 1YD8U 4E71A 3PT2B 2KOXA 4NAMA 4AM1A 3T8MA 3L2EA 1WMHB 4BOZB 1I4HA 3AEEB 3TUOA 3PRPB 3I63C 3MC8A 2KDBA 1SEBD 2KN5A 4HKQA 2PE6B 2OEDA 1T5XD 3AE9B 1K53A 1C1YB 1YQ3B 1SF0A 4N6EB 1GC7A 2J0KA 1F2RC 3DBLB 4PYUA 1V9JA 4TQ1A 3U7DA 3ZVVA 1DOIA 1JWAD 4G11A 3NVWA 3I3TB 2DAJA 2KX3A 3L16A 3U52E 3ALBA 3GE3C 1IYFA 2INNE 3EGRA 1ZDVA 3GE8C 4HLEA 2MJ3A 2O6VA 3UQBA 2IY0B 4GN1A 2EMSA 4K7UA 1TKGA 5J9AA 1QT9A 4DDID 3NRZA 2CRKA 1DGJA 4NPNA 4DDGD 4W9JA 1PGXA 1Q10A 3IHPC 2V4IB 4JIOU 1QILA 1UBQA 1E8XA 2FCNA 4MGYE 1KF6B 3PS6A 2RPVA 3K9OB 3AU4A 2NVUI 1K51A 4IC7B 2KACA 1YQ4B 3P4QB 1Y8RC 3A33B 2HD5B 1F0ZA 3QIJA 2JZZA 3RFZB 2LASA 3B0AA 1P3QU 1HEZE 3OAWA 4ANUA 3ETRA 4OZCA 1P0RA 2C5LC 2I38A 2BWES 1XXGA 1WRIA 2KYWA 3RMKC 3P4PB 3V62A 1GAQB 4K3BA 3TJPA 4BBNF 3RUIB 4US8A 3N32A 5J18A 2WP9B 1PQSA 4LLGM 1TS4A 5AZFA 1WY8A 2KK8A 4AJYB 3KWVA 4ASWC 2EMTA 3CWIA 4FLHA 3A1QA 4BAXA 4ICVA 2G4SA 2JXXA 1WJNA 2XEWA 3RCZA 4JQWC 2L8JA 2GWCA 4OVUA 4IUMB 1TY2A 4HDOA 1IBXB 4OVVA 2KDMA 3I9V1 1L6VA 5CHWA 3LVVA 1F9JA 2XNAC 4ZDVA 4CQNA 1XCTL 3ZNGC 4JX1C 1TS5A 1C78A 3N1ZC 3Q2AC 1QZEA 3RT3B 3SD5A 2CR5A 4BG4B 3L4PA 2LEKA 4FJYA 2KXJA 2K6QA 4C56C 3FAHA 1EM7A 5IA7A 3KYCD 4YWGG 2JQRB 3WIMA 3W5UB 4TSSA 2N9KA 5G55A 5C2TB 2EKIA 1UH6A 2GBRA 2WXQA 3M95A 2D07B 4A55A 1HQRD 4G3XB 3E9SA 4NJCA 4WAAA 2KNBA 4LNOA 2NBVB 1BT0A 1WXQA 3OG5A 4Q2JA 2L0FA 3N20C 2ZEQA 2MA9B 2UYZB 2KZRA 4XGAB 4B0EA 3C0RB 3BIID 3SU8X 3DVGX 4KKIA 3T3NA 2KO3A 4ICUA 2GWDA 1U6RA 2D3GA 3IAS1 2BYTA 2E6XA 3ONSA 2ASQA 2MHJA 1FO4A 1ZXIA 3JSVB 3QCAA 1I7HA 1ROEA 5DPRA 4DK5A 4AP4C 2VZKD 2KX0A 2WDVB 3DBHI 3I57A 2ACZB 2PE9A 3AULA 2GRIA 3AE6B 3NZ3A 3QC8B 4EZKA 2K22A 1STEA 1V5TA 3DPDA 3H7PA 1OQQA 2GBKA 3A4RA 4W9CA 2QC8A 2N7EA 2AEHA 3VRBB 3RI7C 4HPPA 1PYWD 1GPXA 4FHJA 2DZKA 1RFAA 3NS1A 1NBFC 1V1PA 2K8HA 4ANWA 3AEAB 3J9CA 1WJUA 3APCA 2KKCA 2Y5PA 3UF8A 2L1AA 3CF6E 5G5GA 5I4DA 2BGFA 4LK0M 2KTFA 5LXHA 2IO0B 2IO1B 3RULA 1H8CA 2RPQA 4GGQA 4B9KA 1UD7A 3UI3A 3EFCA 2KJRA 2NPTA 2KMCA 5HG2A 3DBRI 3BVZA 1XLOA 3A9JA 4TKNA 4MJSA 1R4MI 3B1LX 2Y5BB 3ZJVA 4HVBA 2KQSA 5FR3A 2D3CA 3QK0A 3GB1A 1M4VA 3ZO5B 3KH0A 4HWIB 2L76A 2J42A 5DPWA 1I4QA 2RDGA 2FNJB 2IGHA 3Q3OC 1E5WA 2KVRA
chains in the Genus database with same CATH topology
1F1HA 4GW0A 5J9AA 4LNNA 4RF8A 4ACFA 4GVZA 4GVYA 3ZXVA 2CRKA 4RF7A 3JU6A 1HTQA 4BG4B 3DRBA 2D3CA 2QC8A 4S17A 3L2EB 1FPYA 4LNOA 1BG0A 4LNKA 1M15A 2D3BA 2D3AA 1RL9A 1HTOA 3NG0A 2UU7A 4LNFA 1G0WA 1P52A 1QK1A 3L2DA 4HPPA 2BVCA 4Q2RA 1QH4A 2LGSA 1F52A 1VRPA 3DREA 5J99A 4LNIA 4BHLA 3JQ3A 1I0EA 1P50A 3ZXRA 2GLSA 1LGRA 4GW2A 4AM1A 4BG4A 2WHIA 2J1QA 4RF9A 4RF6A 4S0RA 3M10A 4Z9MA 2WGSA 3JU5A 4BAXA 3B6RA 1CRKA 3L2EA 2OJWA 1SD0A 1U6RA 3JPZA 4XYCA 3FKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1H A;  4GW0 A;  5J9A A;  4LNN A;  4RF8 A;  4ACF A;  4GVZ A;  4GVY A;  3ZXV A;  2CRK A;  4RF7 A;  3JU6 A;  1HTQ A;  4BG4 B;  3DRB A;  2D3C A;  2QC8 A;  4S17 A;  3L2E B;  1FPY A;  4LNO A;  1BG0 A;  4LNK A;  1M15 A;  2D3B A;  2D3A A;  1RL9 A;  1HTO A;  3NG0 A;  2UU7 A;  4LNF A;  1G0W A;  1P52 A;  1QK1 A;  3L2D A;  4HPP A;  2BVC A;  4Q2R A;  1QH4 A;  2LGS A;  1F52 A;  1VRP A;  3DRE A;  5J99 A;  4LNI A;  4BHL A;  3JQ3 A;  1I0E A;  1P50 A;  3ZXR A;  2GLS A;  1LGR A;  4GW2 A;  4AM1 A;  4BG4 A;  2WHI A;  2J1Q A;  4RF9 A;  4RF6 A;  4S0R A;  3M10 A;  4Z9M A;  2WGS A;  3JU5 A;  4BAX A;  3B6R A;  1CRK A;  3L2E A;  2OJW A;  1SD0 A;  1U6R A;  3JPZ A;  4XYC A;  3FKY A; 
#chains in the Genus database with same CATH topology
 3UIP B;  3PHX B;  2ICI A;  2KFK B;  2KDE B;  1L4Z B;  5KHQ A;  2LJI A;  3ECI A;  3X23 A;  3ENE A;  5EE3 A;  5EDS A;  1YJJ A;  2V9H A;  1MG8 A;  1N6Z A;  2JRI B;  1ACC A;  3APF A;  1SJE D;  2WXK A;  2LVP A;  4RNA A;  4AUQ C;  3R3M A;  4RF8 A;  1FCL A;  2BKR B;  1S3S G;  4KDL B;  3IG3 A;  4W9L A;  4AS1 A;  1WMH A;  1YX5 B;  2AL6 A;  2FID A;  2WXG A;  2ZVN A;  1C79 A;  1QH4 A;  5CX3 A;  5FR6 A;  1WRD B;  3JW0 X;  2IO3 B;  1R4N I;  2OJW A;  2M17 A;  4W9I A;  3CMM B;  2M4N A;  5FK9 C;  1FNW A;  1LFD A;  1YOV B;  2KQ4 X;  3NHE B;  4N59 A;  2JPH A;  4A9A A;  2WXP A;  2QIL A;  2JWU A;  4CO7 A;  4URK A;  4KKJ A;  4MT5 A;  2KD0 A;  4X57 B;  4IWO A;  2KHW B;  1I4G A;  1JRU A;  3GOE A;  4IWP A;  4Z9M A;  5L83 A;  1SBB B;  3UGB B;  1OEY J;  2ZZP B;  4W9D A;  4A6Q A;  4B0M A;  2K39 A;  1FM0 D;  4NQK E;  3RYT A;  1E0Z A;  3T3O A;  5JHB A;  1PGB A;  2I2Y A;  4RF7 A;  5DCN A;  4K7W A;  3VDZ A;  1KLU D;  2K3U A;  4KSL C;  2BPS A;  2J53 A;  3P63 A;  4ANX A;  1D5X C;  1KH0 A;  3LDZ E;  4ZRK A;  2KJ6 A;  2WHI A;  2BW2 A;  1Y56 A;  2KAJ A;  4LNN A;  2CJO A;  5EE1 A;  3HUI A;  4RGM A;  3LB8 C;  1AWD A;  4DWF A;  5FKA C;  1MHH E;  3M3J A;  3Q8E A;  2W3R A;  4HRO A;  3DRE A;  4REZ A;  1OEY A;  1VZ8 A;  4ANV A;  4XE0 A;  3NOB A;  2V0G A;  3AEC B;  3PV1 A;  5C23 A;  2LUM A;  3KW5 B;  5JH5 C;  3ZJU A;  3L13 A;  2XBB C;  5CTR C;  1PUT A;  1L0X B;  1QF6 A;  4M0W B;  2KWU B;  5IN7 A;  2ZW1 A;  3RPF C;  4JWU C;  3PZ7 A;  1WX9 A;  1VJK A;  2C60 A;  1ESF A;  2PPH A;  2NR2 A;  1U4A A;  2FIF A;  4A3P A;  4KGR A;  3AE3 B;  3WA0 A;  5C3J B;  3A9J B;  3PLV A;  3AE4 B;  3TIX A;  2CS4 A;  2IY1 B;  3AXC A;  1IPG A;  1FXA A;  2UWQ A;  1N5X A;  1WYG A;  3DDC B;  4EZJ A;  4K81 A;  3QQ8 B;  1H4R A;  1AAR A;  2BS3 B;  2KWD A;  3PSE B;  1HE8 A;  1YMH E;  2HJ8 A;  1D3Z A;  2LZ6 A;  3W9C B;  2MBB B;  3ZNH B;  1ZDX A;  1ZUD 2;  5IKC M;  1WXS A;  1NVI D;  1E7V A;  2WXR A;  3AEF B;  4BG4 A;  2RMM A;  4KZC A;  1N63 A;  2FBW B;  2B3A A;  1MJD A;  1WE6 A;  4RGN A;  2D10 A;  2ON8 A;  1Q5W B;  2MP2 B;  3BWU D;  2LFI A;  3JVZ X;  4PS3 A;  1KM7 A;  1YN5 A;  4P1C C;  2LVO A;  4HJG E;  1UWX A;  2A5U A;  2PLP A;  4ZOH C;  2LRW A;  5H8Y E;  4P1B C;  3URY A;  4OHJ A;  1JW9 D;  2BYE A;  2NMQ A;  3B9J A;  2AQ2 B;  5J2R A;  3OJ4 B;  3R7R A;  3Q6B A;  1TIF A;  2D2Q A;  3IT4 B;  1WXM A;  1E10 A;  3QHT A;  1BUI C;  2BKF A;  1VRP A;  1KOT A;  4A3O A;  2B76 B;  4OW0 A;  3M63 B;  1WF9 A;  4W9E A;  2FCS A;  1OFF A;  4WQO B;  2JX5 A;  3JSV A;  2JWZ A;  3TMP B;  3HVD A;  1JCK B;  2INC C;  4JL9 A;  3EUB 2;  2ZPY A;  3N3K B;  2JRH A;  4C4V A;  3ZJT A;  1SSN A;  3Q8A A;  1DOX A;  3ABV B;  4KZ0 A;  1JRO A;  1TYG B;  2LHE A;  1ZW7 A;  2I1J A;  4YSZ B;  2AX5 A;  1L2N A;  2KMA A;  1WGG A;  3V3X A;  4RFB A;  2JY6 A;  5LLI A;  4L23 A;  3DQV A;  2REX A;  1UWM A;  1XF5 L;  2DAF A;  5CHV C;  2D32 A;  2DWQ A;  1L4D B;  4GDK B;  1GOZ A;  1J8C A;  2Z59 B;  2WGS A;  4MM3 B;  2K6D B;  2KT7 A;  2KAN A;  2L7R A;  1TT5 B;  1LQB A;  1GUA B;  2KJH B;  1HZ6 A;  3M62 B;  1TTN A;  3PRM B;  2MJE A;  3PLU A;  1YIW A;  1ZOY B;  2LHD A;  3ZRF A;  1ZGU B;  4ARI A;  4W9G A;  1P1A A;  2JXT A;  2PKO A;  1UZX B;  4C7Z A;  2WDR B;  2DHZ A;  1JRP A;  1YN4 A;  1WR6 E;  1RYJ A;  2X38 A;  4YSX B;  2RDB C;  4KV2 A;  3V6E B;  2R2O A;  3RNC C;  1E8Z A;  1IP9 A;  4I6P A;  3W5V B;  3PRE A;  1FNU A;  1KFY B;  3O65 B;  1L7Y A;  4G0N B;  1T0Y A;  3BK2 A;  2PMV A;  2M8S A;  4M8M A;  2AL3 A;  2M0X A;  1WR1 A;  1WGK A;  1WJ4 A;  1P50 A;  4GW2 A;  2KFK A;  2J1Q A;  1SIF A;  3ZDM C;  2J4X A;  2K25 A;  4FHK A;  4I6N B;  4I6L B;  2N9E B;  4RCO A;  3WCQ A;  4HCN B;  4ACF A;  4NY0 A;  2PJH A;  3P2B A;  4M01 A;  2X8X X;  4AOF A;  3GZN I;  3L2D A;  4XWW A;  1C77 A;  3EA6 A;  4BHL A;  2ZCC A;  2KC1 A;  4NJ7 A;  4HPM B;  1FD6 A;  1SXT A;  4ZYN A;  1LGR A;  1FNV A;  2FCQ A;  3C8Y A;  3FIL B;  1N61 A;  3RNE C;  4TUU A;  1GJZ A;  2AWT A;  2L00 B;  1NYQ A;  1JQ4 A;  2JT4 B;  2KVZ A;  2LXA A;  3CST A;  3VUX A;  3HIZ A;  2KFJ A;  2BVC A;  1TBE A;  1SE2 A;  2LD9 A;  4MSM B;  4JPS A;  2LI5 A;  3IAM 1;  2BB6 A;  4RF1 A;  2RSU A;  3DBS A;  4WWP A;  3PRZ A;  2NS5 A;  1T6B X;  5HKH A;  3KUC B;  1B9R A;  3OWE B;  2BT6 A;  2CJN A;  4AJW A;  1VZ6 A;  4RF0 A;  4LJP B;  4K7S A;  3MJW A;  1EO6 A;  3IFW B;  4M8N A;  2K0P A;  1I35 A;  1JAL A;  3TEZ A;  5BYQ A;  5AZG A;  2ZW0 A;  2N9L A;  3MJ5 A;  4HCP B;  2M1M A;  4GW0 A;  4UDU C;  2G3Q B;  1WYW B;  1BXT A;  4AWJ A;  1C4C A;  3L08 A;  1WZ0 A;  3UIN B;  2LXC A;  2IDY A;  1RWS A;  4IOI E;  5IP4 D;  1SB3 C;  2D33 A;  1ET6 A;  1T0R C;  1GNU A;  2GB1 A;  3A9K B;  1M94 A;  2Q5W D;  1NI3 A;  3JPZ A;  1NYR A;  3MC9 A;  4C4V B;  4Q2R A;  3VH3 B;  2W54 A;  3IT6 B;  2VRR B;  2GBN A;  2JVC A;  3P4R B;  2EKE C;  2N4F A;  2D3A A;  1G0W A;  2MW5 A;  1E9M A;  4LNI A;  2CKH B;  2PEA A;  3O13 A;  3ZNI D;  1UGM A;  1ZPS A;  3MC0 B;  4M0W A;  3APD A;  4HRS A;  1FRR A;  2QHO A;  2NCN A;  3ZXV A;  2MJD A;  1JWS D;  2DBY A;  1L6U A;  3IBE A;  3I5J C;  3LXF A;  2MBO A;  3AB5 A;  3N1Y C;  1V49 A;  1J7C A;  3QAR A;  1L5P A;  2K8B A;  3BYT B;  4GLS C;  5D2M B;  1P7F A;  3ML8 A;  1C4A A;  2R61 A;  1Z5S B;  3VQI A;  3KLS X;  4FAD A;  1J19 A;  1GC6 A;  2DZJ A;  4TQ0 A;  4J3O D;  4II3 B;  2QCZ A;  2G1E A;  2MBE A;  2N9X A;  3W2D A;  1YX6 B;  4ZRI A;  3WAP A;  2ONQ A;  3V05 A;  1A5R A;  5D6J B;  3DWM A;  1WX7 A;  1QQR A;  2BB5 A;  5TSS A;  2C7N B;  2O2V B;  1TY0 A;  4EZL A;  1QOG A;  1SIJ A;  4IDI A;  3V6C B;  3PTF C;  3W1Y A;  3HVZ A;  2ZJD A;  4S17 A;  1NEN B;  5C1Z A;  1WM2 A;  2D3B A;  4K1R B;  2JF5 A;  1MVK A;  2MWS B;  5LNK 1;  1D6E C;  2L52 A;  2MSE D;  1TS3 A;  2WXM A;  1FCC C;  4KGS A;  2QDF A;  3L10 B;  3Q3M C;  2V3N A;  2JYE A;  4YT0 B;  4IM3 A;  3DCG A;  2MP2 A;  2WS3 B;  3ZRC A;  3NUH B;  2LVQ A;  1P9D U;  1T0S C;  1HXY D;  1V5O A;  1WSP A;  2KLC A;  3IG5 A;  2K5P A;  3H7S A;  2MCN B;  1MG4 A;  4DHZ B;  2YVC A;  3BIN A;  3MTN B;  2FUG 1;  2LGX A;  2K8C A;  1V4G A;  1A70 A;  2MH7 A;  1KJT A;  2NBW B;  5G5H A;  5D7G A;  3VUW A;  3D32 A;  4EKU A;  4DHJ B;  1PGA A;  3FKY A;  4B95 A;  4BBN C;  3VR9 B;  4GVZ A;  3NVZ A;  3AE7 B;  3EFU A;  5EE0 A;  5JHA A;  1R7S A;  1WWT A;  3AN1 A;  3GP7 A;  1WIA A;  1I4X A;  2BQQ A;  3R2T A;  4KVG B;  5J99 A;  1C76 A;  1J7B A;  1VDV A;  1WGH A;  4RGO S;  3PGE A;  4MEL A;  4HK2 A;  4KIK B;  2CU3 A;  1CQV A;  1FFV A;  2HDE A;  3H1U A;  3NS8 A;  1E90 A;  1WJ6 A;  4GXB A;  1F1H A;  1Q1O A;  2KWC A;  2RGF A;  1X1M A;  5CHF A;  3FC4 A;  3AED B;  3IG8 A;  1SE3 A;  5AUI A;  4W9H A;  5HFY A;  3ZGZ A;  1AYF A;  2HTH A;  3EHV A;  2IGG A;  2W3S A;  3DHH C;  3P4S B;  4A90 A;  5BO4 B;  1WH3 A;  2IBI B;  2WXH A;  5G2N A;  2Y3A A;  1L0Y B;  1D5Z C;  4IKG A;  4GDK A;  2C7M B;  3AU5 A;  3ZTD A;  1YNT E;  4BKT A;  3KUZ A;  2JYT A;  4DBG A;  1I42 A;  4FJZ A;  1K50 A;  4MM3 A;  5IAA C;  1WE7 A;  2N7D A;  3WAL A;  1E7P B;  2H88 B;  2MLB A;  4XDD A;  3NZT A;  2XK5 B;  1D5M C;  3WAO A;  2LRU A;  2FAZ A;  2V3P A;  3SEB A;  3AE8 B;  2VH1 A;  2ZNV C;  2M56 B;  3TSS A;  2J0J A;  4NAW B;  3VFK A;  4FA6 A;  3TEY A;  2NBU A;  4D2K A;  4MGZ E;  2L3Z A;  1WM3 A;  4E3C A;  5LXI B;  2WU5 B;  4GIV A;  2KMM A;  4FXC A;  1Q0W B;  5JZE B;  2OHF A;  3SHQ A;  2MRP A;  3MFG A;  4IW0 A;  2JZ3 B;  4FUL A;  1GG3 A;  4C00 A;  4JGH B;  5E6P A;  4US9 A;  3AH7 A;  5E6J A;  4W9F A;  2KDF B;  1V1O A;  1WFY A;  4RM9 A;  1CK1 A;  3LN6 A;  1RL9 A;  1C3T A;  4GB9 A;  2HE7 A;  3EEC A;  3DWG C;  3A4S C;  2HTM E;  2M19 A;  1TGZ B;  1XO3 A;  3RN9 C;  4TMA B;  2JZP A;  2BYV E;  4N58 A;  2WXF A;  3Q69 A;  4BVU C;  4GMV A;  4RMA A;  2OJR A;  2R2Q A;  1F77 A;  4RGT A;  1TZO A;  2N1W A;  2SAK A;  3M10 A;  3FIL A;  2INP E;  4ZRJ A;  2J7Q B;  2A4Z A;  3PPA A;  3L17 A;  3H8H A;  1N60 A;  4YXD B;  2PVO D;  2GI9 A;  1PFD A;  2BS2 B;  3Q3N C;  4WWM A;  4USA A;  3VTW A;  1E8Y A;  4FBJ B;  1WGD A;  2VH2 A;  2G45 B;  3DBL I;  2GBJ A;  3KVF B;  4OZA A;  4G50 A;  4ITK A;  1WX8 A;  3N9Y C;  3ZLZ A;  1RM6 C;  3X0W A;  1KLG D;  2Z8L A;  4HDQ A;  3DVG Y;  4M02 A;  3DHG C;  5J17 A;  4DXG A;  4XZ4 A;  1P98 A;  1OTR B;  3QJZ A;  1J0G A;  3P42 A;  2GBM A;  2H89 B;  2KDI A;  2WWZ A;  1VA6 A;  1TKY A;  2Y5C A;  1P52 A;  4YTP B;  1R8G A;  3U30 A;  2WXL A;  1S1Q B;  4P6V F;  5BYS A;  4RF9 A;  1WXA A;  2W55 A;  3AMZ A;  4MH8 A;  1KRH A;  3U2S C;  1WGR A;  2DYM A;  1I4R A;  4E74 A;  3A9K A;  4F7Z A;  2YLM A;  3BYY B;  4L1B A;  5GXG B;  2WXJ A;  2N1V A;  5HHD G;  3BVM A;  3NVV A;  1LO5 D;  4QAY A;  4LDT B;  3GS2 A;  2J0M A;  4RM8 A;  2WYQ A;  5AUK A;  2I1K A;  5DPS A;  2LGI A;  3NZU A;  3ZYY X;  3UIO B;  1OGW A;  1V80 A;  1TJE A;  1GB4 A;  1RFK A;  3ZNZ B;  3H9D A;  2IPK D;  4WJO A;  4XC2 A;  3TCA A;  3U4E G;  3HK0 A;  1XEE A;  1OQY A;  3SR6 A;  4LJO B;  4KGT A;  4NZL B;  2C7H A;  2E3T A;  3AV8 A;  4OZB A;  2DYB A;  2PIA A;  3AE1 B;  3RZW C;  4PT5 A;  2DZM A;  4DHJ D;  4KX6 B;  4S0R A;  1EWY C;  4WUR A;  1FIQ A;  2MBQ A;  4PYZ A;  4WJQ A;  3BY4 B;  2WXO A;  2XN9 C;  1V8C A;  3AEB B;  2LGY A;  2W82 A;  3TBL D;  1UNS A;  4NNJ B;  1WZ3 A;  1B1Z A;  5BMI A;  1ZXH A;  1XCQ L;  2ZVO A;  2CHW A;  2O2V A;  1ET9 A;  3DOW A;  5D94 A;  5TR5 A;  3ML9 A;  2DX5 B;  2G9H D;  2BF8 B;  3JU5 A;  3V61 A;  4GDL B;  3BZD B;  4IG7 B;  3RNB C;  4ZHO A;  1D4B A;  3ZKJ C;  5JXV A;  3JYU A;  1HTO A;  2KC2 A;  4P16 A;  1QK1 A;  3VHT C;  4WAF A;  2LUE A;  4KDI C;  2L83 A;  3KUD B;  4PS8 A;  3EC8 A;  3DHI C;  1QOB A;  3RNF C;  2KTR A;  1QLB B;  1SJH D;  1Z2M A;  1E7U A;  3U7Z A;  1V2Y A;  3QAQ A;  3Q8C A;  4EUT A;  3ZQ4 A;  4DXF A;  1YN3 A;  3VR8 B;  3Q3F A;  4HXD A;  1E8W A;  3KYD D;  4FN2 A;  1VCB A;  4BKG A;  2ZNV B;  2UU7 A;  4DHZ E;  1YQB A;  2WLB A;  3DVN V;  4JE3 B;  2GLS A;  2KLG A;  4WH4 A;  5HI1 A;  1SE9 A;  4H2A A;  4WIP A;  3N30 A;  1FFU A;  2JSV X;  2SEB D;  2QEJ C;  1ZP0 B;  1I4P A;  2D5G A;  2TSS A;  4YSY B;  4F1S A;  2AQ1 B;  1VRA B;  1FXT B;  4KIK A;  4CYE A;  1BG0 A;  5DPT A;  4ZRQ A;  3VTU A;  4C7Y A;  1OQR A;  3GZN B;  3UQA A;  2WXI A;  4IM2 A;  1K52 A;  3RNA C;  1UBI A;  2BS4 B;  3HM6 X;  4XDC A;  3B6R A;  1GB1 A;  1SD0 A;  4P7I A;  1LXD A;  3BVG A;  4HEA 1;  4HJK A;  1PDX A;  1MHX A;  3P1M A;  3L2E B;  2RDH A;  2WDQ B;  3NG0 A;  2NTS A;  3AM9 A;  4DQO C;  1ENF A;  2N9P C;  1MFW A;  1XT9 B;  4A20 A;  5AEK B;  3LN7 A;  3ZDT A;  1XQQ A;  2BBC A;  3W1S C;  4MGI E;  2YEP B;  4OVZ A;  1TS2 A;  5BMG A;  4WWN A;  2BYF A;  2XK5 A;  2LWP A;  4R3D A;  1EUV B;  4BKS D;  3LJ3 A;  2BWF A;  2FUH B;  5D3I B;  2FCM A;  1FMA D;  4LNF A;  2K1F A;  2CHZ A;  4BFR A;  4NAW A;  3QA8 A;  1V97 A;  3R7Q A;  1XLN A;  4LCD E;  1VLB A;  4C80 A;  3PZD A;  5IOI A;  4BOS C;  5GMV A;  1F2R I;  2D11 A;  5KHO A;  2DZI A;  1AW7 A;  3S2A A;  2O6V B;  2DEN B;  4HPL B;  3IVF A;  2IZV B;  2MQJ A;  3VRA B;  3Q8F A;  2WXN A;  2WX1 A;  2WDT B;  4WQM A;  3AE5 B;  1I0E A;  2YEP F;  2EEL A;  3DBH B;  1LM8 B;  2KN4 A;  4LTU A;  1EF5 A;  3SFE B;  1UEL A;  1MPE A;  1WI0 A;  3OLM D;  4F8C B;  4GU2 A;  2N0S B;  3R2I A;  1CJE A;  4M00 A;  1HTQ A;  1VZ7 A;  4ARC A;  2GMI C;  3SDL C;  3Q8B A;  1TKE A;  1V81 A;  4TV3 A;  3AEG B;  4K3C A;  4ZHP A;  1E6E B;  2GOW A;  4MAC A;  4XWT A;  1G6J A;  4N9F 4;  4EE2 A;  4J6I A;  1DYQ A;  3NY5 A;  5T8I A;  3Q14 C;  3W1S A;  3MHZ A;  3KWL A;  4HKZ E;  2IJ0 A;  4A8X C;  4BKS A;  3DRB A;  2OOB B;  4WWO A;  5H92 C;  4IWQ A;  2M0A A;  4LDT D;  4L2Y A;  1L0V B;  2QMT A;  2CU1 A;  4IM0 A;  2WQY B;  3DVN U;  3N1X C;  4RH6 A;  3WAN A;  3DBR B;  3ZTC A;  3TEX A;  3A1Q B;  1R4M B;  3LYY A;  4JLC A;  4EFO A;  2W9N A;  2KTR B;  1QKZ A;  3U8Z A;  3VAW A;  1SGH A;  1TZ1 A;  2ZPN A;  4MEM A;  4YL8 A;  5IO9 A;  1CMX B;  2Z0D B;  3RNG C;  1V6E A;  1UUP A;  3RD2 A;  3AE2 B;  1CZP A;  1J7A A;  4XYC A;  4JWS C;  1IGC A;  4FJV B;  3T9L A;  2WNM A;  3K9P B;  5E6O A;  3WAM A;  2L05 A;  3PZ8 A;  2LGD A;  3AI5 A;  3MP9 A;  4WJP A;  2C9W B;  3HM3 A;  1XD3 B;  4CHK A;  1VR9 A;  1P7E A;  1SE4 A;  2IND C;  4MGK E;  1RRB A;  1RAX A;  2L32 A;  4ZYS A;  3L0W B;  1XLQ A;  4MDK E;  3R66 C;  3L54 A;  2V3S A;  3KQ4 A;  1EF1 A;  3E56 A;  5EE9 A;  2Z0E B;  3CSF A;  3H6N A;  2MBH A;  3VVW B;  1N62 A;  5BYR A;  4KSK C;  4BZA A;  1IUE A;  1NI2 A;  3V60 A;  3NZS A;  3PHW B;  4RF6 A;  1KLV A;  4GSW A;  1AN8 A;  2JUO A;  4EEW A;  4NQL B;  2WX0 A;  2IYD B;  2G4D B;  1R4N B;  1RLF A;  2PW9 A;  1N5W A;  2L0T A;  3TL5 A;  5D3D A;  4YTM B;  1UGJ A;  3CIR B;  1EU3 A;  4XX5 A;  1IGD A;  3ZUN A;  2N7J A;  4MSQ B;  1ZE3 D;  3HHM A;  1EU4 A;  3QWZ B;  1C9F A;  4MH0 E;  3ZW3 A;  1JWM D;  2BTE A;  1NEK B;  1VD2 A;  5MPO A;  1EWC A;  4GVY A;  3BK1 A;  3OJ3 A;  4ZRP A;  1M15 A;  2KWV B;  2LGS A;  2IGD A;  2HJ1 A;  3H7P B;  2IO2 B;  4W9K A;  3ZXR A;  4AQ7 A;  1HZ5 A;  2V4L A;  1CRK A;  3VTV A;  2CHX A;  3R8B A;  3VXW A;  3LVW A;  2AQ3 B;  2PTL A;  1K8R B;  1V1P B;  3VH4 B;  3RZF A;  2DLB A;  4YTN B;  2PVG C;  1QOA A;  2NTT A;  1FPY A;  4O1N A;  2RD0 A;  3Q3J A;  2MEK A;  1KTK A;  1DOY A;  1WGY A;  3HRD D;  3TEW A;  3IXS A;  4GDL A;  3NJT A;  4GOC A;  1UF0 A;  1C4P A;  4NJ6 A;  2RR9 A;  1YJ1 A;  2QJL A;  2ZCB A;  1MI0 A;  2AYO B;  3C19 A;  1JWB D;  1T3Q A;  1NDD A;  3SFD B;  3JU6 A;  2NPT B;  1V86 A;  4II2 B;  3PVL A;  4PK1 A;  2QIE B;  1BML C;  4MJS B;  3B2G A;  5E6N A;  1JWU D;  2QSD A;  5AZH A;  1HA5 A;  3PO0 A;  3JQ3 A;  1XLP A;  3B2F A;  4PS7 A;  3ZIM A;  1T0Q C;  2VZK B;  2DYO A;  1FEH A;  2FE8 A;  1JML A;  1IBX A;  4WJN A;  1YJI A;  2WU2 B;  1QOF A;  2K9X A;  1TT4 A;  2LJ5 A;  1F52 A;  2LMC A;  1FRD A;  2JU6 X;  2DNF A;  1ZKH A;  2O6V D;  3QX1 A;  2V1Y A;  2KQ7 A;  3VUY A;  4B6W A;  1FXI A;  1ISN A;  3NVY A;  3B08 A;  4DXA B;  2MX2 A;  4EOY A;  1WXV A;  4LNK A;  5BMH A;  3MHS D;  5L95 C;  2J52 A;  1YD8 U;  4E71 A;  3PT2 B;  2KOX A;  4NAM A;  4AM1 A;  3T8M A;  3L2E A;  1WMH B;  4BOZ B;  1I4H A;  3AEE B;  3TUO A;  3PRP B;  3I63 C;  3MC8 A;  2KDB A;  1SEB D;  2KN5 A;  4HKQ A;  2PE6 B;  2OED A;  1T5X D;  3AE9 B;  1K53 A;  1C1Y B;  1YQ3 B;  1SF0 A;  4N6E B;  1GC7 A;  2J0K A;  1F2R C;  3DBL B;  4PYU A;  1V9J A;  4TQ1 A;  3U7D A;  3ZVV A;  1DOI A;  1JWA D;  4G11 A;  3NVW A;  3I3T B;  2DAJ A;  2KX3 A;  3L16 A;  3U52 E;  3ALB A;  3GE3 C;  1IYF A;  2INN E;  3EGR A;  1ZDV A;  3GE8 C;  4HLE A;  2MJ3 A;  2O6V A;  3UQB A;  2IY0 B;  4GN1 A;  2EMS A;  4K7U A;  1TKG A;  5J9A A;  1QT9 A;  4DDI D;  3NRZ A;  2CRK A;  1DGJ A;  4NPN A;  4DDG D;  4W9J A;  1PGX A;  1Q10 A;  3IHP C;  2V4I B;  4JIO U;  1QIL A;  1UBQ A;  1E8X A;  2FCN A;  4MGY E;  1KF6 B;  3PS6 A;  2RPV A;  3K9O B;  3AU4 A;  2NVU I;  1K51 A;  4IC7 B;  2KAC A;  1YQ4 B;  3P4Q B;  1Y8R C;  3A33 B;  2HD5 B;  1F0Z A;  3QIJ A;  2JZZ A;  3RFZ B;  2LAS A;  3B0A A;  1P3Q U;  1HEZ E;  3OAW A;  4ANU A;  3ETR A;  4OZC A;  1P0R A;  2C5L C;  2I38 A;  2BWE S;  1XXG A;  1WRI A;  2KYW A;  3RMK C;  3P4P B;  3V62 A;  1GAQ B;  4K3B A;  3TJP A;  4BBN F;  3RUI B;  4US8 A;  3N32 A;  5J18 A;  2WP9 B;  1PQS A;  4LLG M;  1TS4 A;  5AZF A;  1WY8 A;  2KK8 A;  4AJY B;  3KWV A;  4ASW C;  2EMT A;  3CWI A;  4FLH A;  3A1Q A;  4BAX A;  4ICV A;  2G4S A;  2JXX A;  1WJN A;  2XEW A;  3RCZ A;  4JQW C;  2L8J A;  2GWC A;  4OVU A;  4IUM B;  1TY2 A;  4HDO A;  1IBX B;  4OVV A;  2KDM A;  3I9V 1;  1L6V A;  5CHW A;  3LVV A;  1F9J A;  2XNA C;  4ZDV A;  4CQN A;  1XCT L;  3ZNG C;  4JX1 C;  1TS5 A;  1C78 A;  3N1Z C;  3Q2A C;  1QZE A;  3RT3 B;  3SD5 A;  2CR5 A;  4BG4 B;  3L4P A;  2LEK A;  4FJY A;  2KXJ A;  2K6Q A;  4C56 C;  3FAH A;  1EM7 A;  5IA7 A;  3KYC D;  4YWG G;  2JQR B;  3WIM A;  3W5U B;  4TSS A;  2N9K A;  5G55 A;  5C2T B;  2EKI A;  1UH6 A;  2GBR A;  2WXQ A;  3M95 A;  2D07 B;  4A55 A;  1HQR D;  4G3X B;  3E9S A;  4NJC A;  4WAA A;  2KNB A;  4LNO A;  2NBV B;  1BT0 A;  1WXQ A;  3OG5 A;  4Q2J A;  2L0F A;  3N20 C;  2ZEQ A;  2MA9 B;  2UYZ B;  2KZR A;  4XGA B;  4B0E A;  3C0R B;  3BII D;  3SU8 X;  3DVG X;  4KKI A;  3T3N A;  2KO3 A;  4ICU A;  2GWD A;  1U6R A;  2D3G A;  3IAS 1;  2BYT A;  2E6X A;  3ONS A;  2ASQ A;  2MHJ A;  1FO4 A;  1ZXI A;  3JSV B;  3QCA A;  1I7H A;  1ROE A;  5DPR A;  4DK5 A;  4AP4 C;  2VZK D;  2KX0 A;  2WDV B;  3DBH I;  3I57 A;  2ACZ B;  2PE9 A;  3AUL A;  2GRI A;  3AE6 B;  3NZ3 A;  3QC8 B;  4EZK A;  2K22 A;  1STE A;  1V5T A;  3DPD A;  3H7P A;  1OQQ A;  2GBK A;  3A4R A;  4W9C A;  2QC8 A;  2N7E A;  2AEH A;  3VRB B;  3RI7 C;  4HPP A;  1PYW D;  1GPX A;  4FHJ A;  2DZK A;  1RFA A;  3NS1 A;  1NBF C;  1V1P A;  2K8H A;  4ANW A;  3AEA B;  3J9C A;  1WJU A;  3APC A;  2KKC A;  2Y5P A;  3UF8 A;  2L1A A;  3CF6 E;  5G5G A;  5I4D A;  2BGF A;  4LK0 M;  2KTF A;  5LXH A;  2IO0 B;  2IO1 B;  3RUL A;  1H8C A;  2RPQ A;  4GGQ A;  4B9K A;  1UD7 A;  3UI3 A;  3EFC A;  2KJR A;  2NPT A;  2KMC A;  5HG2 A;  3DBR I;  3BVZ A;  1XLO A;  3A9J A;  4TKN A;  4MJS A;  1R4M I;  3B1L X;  2Y5B B;  3ZJV A;  4HVB A;  2KQS A;  5FR3 A;  2D3C A;  3QK0 A;  3GB1 A;  1M4V A;  3ZO5 B;  3KH0 A;  4HWI B;  2L76 A;  2J42 A;  5DPW A;  1I4Q A;  2RDG A;  2FNJ B;  2IGH A;  3Q3O C;  1E5W A;  2KVR A; 
#chains in the Genus database with same CATH homology
 1F1H A;  4GW0 A;  5J9A A;  4LNN A;  4RF8 A;  4ACF A;  4GVZ A;  4GVY A;  3ZXV A;  2CRK A;  4RF7 A;  3JU6 A;  1HTQ A;  4BG4 B;  3DRB A;  2D3C A;  2QC8 A;  4S17 A;  3L2E B;  1FPY A;  4LNO A;  1BG0 A;  4LNK A;  1M15 A;  2D3B A;  2D3A A;  1RL9 A;  1HTO A;  3NG0 A;  2UU7 A;  4LNF A;  1G0W A;  1P52 A;  1QK1 A;  3L2D A;  4HPP A;  2BVC A;  4Q2R A;  1QH4 A;  2LGS A;  1F52 A;  1VRP A;  3DRE A;  5J99 A;  4LNI A;  4BHL A;  3JQ3 A;  1I0E A;  1P50 A;  3ZXR A;  2GLS A;  1LGR A;  4GW2 A;  4AM1 A;  4BG4 A;  2WHI A;  2J1Q A;  4RF9 A;  4RF6 A;  4S0R A;  3M10 A;  4Z9M A;  2WGS A;  3JU5 A;  4BAX A;  3B6R A;  1CRK A;  3L2E A;  2OJW A;  1SD0 A;  1U6R A;  3JPZ A;  4XYC A;  3FKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...