2BVCA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structure of Mycobacterium Tuberculosis Glutamine Synthetase in Complex with a Transition-State Mimic Provides Functional Insights.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 157
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2bvcA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2bvcA02
1CRKA 1P52A 3JQ3A 2D3BA 4LNKA 4RF7A 5J99A 3NG0A 4LNFA 3JU5A 2GLSA 1M15A 5J9AA 3FKYA 4LNOA 4RF6A 1G0WA 3L2EA 1F1HA 4S17A 1RL9A 1I0EA 3ZXVA 1F52A 4ACFA 2WHIA 2OJWA 3DRBA 4GVYA 4AM1A 4BG4B 1FPYA 1HTQA 3JU6A 4HPPA 2UU7A 2BVCA 3DREA 4S0RA 4GVZA 3M10A 1BG0A 1QH4A 4Q2RA 4Z9MA 4BAXA 1LGRA 2WGSA 2J1QA 2QC8A 4LNIA 4GW2A 4BG4A 4LNNA 1HTOA 1U6RA 3JPZA 4XYCA 2D3CA 1QK1A 1P50A 2D3AA 3ZXRA 1VRPA 1SD0A 4RF8A 4RF9A 4GW0A 4BHLA 2CRKA 3B6RA 3L2DA 2LGSA 3L2EB
chains in the Genus database with same CATH superfamily
1MFWA 2N1VA 3ZLZA 4YSYB 3Q3OC 1TBEA 3PRPB 4JL9A 2C5LC 1VJKA 4EOYA 3QIJA 2K8HA 3GZNI 1OGWA 2WXLA 1VR9A 2SEBD 1Q0WB 4PYUA 1EWCA 1A5RA 1PGBA 3AE4B 2WDRB 2MSED 5HKHA 5D3DA 2EKEC 4W9HA 3NZ3A 3NZSA 4W9FA 3ZQ4A 3PPAA 1I4PA 3AXCA 3B2GA 3NVYA 4WAAA 5DPRA 1NDDA 2R61A 4OVUA 3R2IA 3DHHC 2NTTA 5HI1A 1GJZA 3AE8B 4GDLB 1E5WA 2JZZA 4REZA 1KFYB 2EMTA 4ZDVA 2JF5A 4JPSA 1XLOA 3UF8A 4PS3A 2D11A 4DBGA 4TKNA 3AE9B 1XCTL 1JQ4A 1WIAA 5CX3A 2K0PA 4FJYA 3HM6X 2IZVB 3NZTA 3VQIA 3KWVA 3KWLA 1V97A 3OJ4B 3W1YA 3IBEA 3ZTCA 2WXQA 2RR9A 4F7ZA 2NPTB 1E7UA 2DYBA 4ICUA 2K5PA 3IFWB 1KLGD 3V60A 3R7QA 1FO4A 3JU6A 2FBWB 3U7ZA 3EHVA 1EU4A 1WJ4A 3VRAB 4ZYNA 4M02A 4RF0A 2MBHA 1EWYC 2KQSA 1G6JA 1IUEA 1QLBB 4K3CA 2BGFA 1T0QC 4XDDA 3ZNID 3MC0B 1C78A 2AL3A 2KC1A 1CZPA 3NVZA 4EFOA 4ZHPA 1SF0A 3QA8A 3SD5A 2WU5B 1G0WA 1KF6B 2WP9B 5C1ZA 2GB1A 2BVCA 3RUIB 4FA6A 1ENFA 1EO6A 4NJ7A 5LLIA 3UQAA 2WXOA 2KHWB 3E9SA 1VRAB 2FCMA 3NUHB 2DNFA 5AZHA 4RGTA 1L0YB 4DHZB 2KFKA 2RSUA 2TSSA 3KYCD 2HTME 2LI5A 2E3TA 3TJPA 4LCDE 1EM7A 5D7GA 4GVYA 1ZUD2 2MCNB 2QILA 3MFGA 2W54A 1PQSA 2VZKD 4NZLB 4I6PA 2HDEA 2BS3B 3N1YC 1DOIA 1EU3A 4YWGG 2GBJA 3L2EB 4ANWA 1JROA 3LVWA 4TQ0A 2XK5A 2V3NA 3L13A 4WAFA 1FFVA 3Q8BA 1MI0A 2O2VA 3JYUA 3Q69A 5BYRA 1BUIC 1DOYA 3TCAA 3PLVA 4PK1A 1E6EB 4NAMA 4P16A 2WXMA 2MJ3A 1E0ZA 2KDBA 1YJ1A 2D3GA 4XE0A 4AWJA 2L0TA 1TIFA 1VZ7A 5BYQA 3U4EG 3L10B 2PIAA 1QOAA 3NVWA 1VD2A 2LGSA 4GGQA 3W9CB 4DQOC 5IP4D 3AU5A 2CJOA 2V3PA 5FR6A 4YTMB 2BB5A 2NBWB 3RCZA 3KVFB 2O6VA 4F1SA 1FPYA 1XD3B 4XGAB 3C0RB 4PS7A 5J18A 3P4PB 3SR6A 4LNNA 3JPZA 3VH3B 4RGNA 4HDQA 3EFCA 2ON8A 2JWZA 3PZ8A 4E71A 2N9LA 2H89B 2GI9A 2L8JA 1VZ8A 2DZJA 4A3OA 4ANUA 4HVBA 4IM0A 4GB9A 3P4RB 4OVVA 2KWCA 3MJWA 3DVGY 2KX0A 4EZLA 5LXHA 2VRRB 2FCNA 3PVLA 2KQ4X 2WXHA 1ZOYB 2I1JA 5JHAA 1QOGA 1NENB 1I4QA 4GMVA 4LNKA 2QCZA 1L0XB 1Z5SB 2KWUB 4TQ1A 2ZVOA 3RZFA 3SDLC 1R4MB 2FCSA 1K51A 2PEAA 4BZAA 5KHQA 3PRMB 3V6CB 3HK0A 2WYQA 4MM3B 1IGCA 1J7AA 1TT4A 3H8HA 2AYOB 1F1HA 3DVGX 4H2AA 1HQRD 3DVNV 3R66C 2LUEA 2IGGA 1JW9D 4Q2RA 4ZYSA 1LGRA 1P7FA 2KWVB 1T0SC 1IGDA 3DBRI 4FBJB 1V5OA 1YQ4B 3QJZA 1FIQA 4FLHA 1WJNA 1YN4A 3MHSD 3ZRFA 3M3JA 2HTHA 3LYYA 2LXCA 2INNE 3TIXA 2MP2B 3NY5A 4DXFA 5E6PA 1A70A 4AJYB 2L0FA 2ZVNA 1UF0A 3JSVB 2V3SA 2FUHB 1E8YA 4USAA 1YJJA 4RF7A 1WYWB 4YXDB 5EDSA 3P63A 4FHKA 3SHQA 2C7MB 2PTLA 4HRSA 4LJPB 4G3XB 4BG4B 2CU3A 1FMAD 2K3UA 2V4IB 3U7DA 3GOEA 4UDUC 1LO5D 4YSZB 2GOWA 1Y56A 3CF6E 3NZUA 3AH7A 2LD9A 1JRUA 2WS3B 5JH5C 1SE4A 1QK1A 3APFA 3PREA 2OHFA 4K7SA 2PPHA 3PHWB 2KWDA 3ZRCA 1XF5L 1ZGUB 1I4RA 2WDVB 3NG0A 3J9CA 4MM3A 2DAJA 2OJWA 3P42A 2KNBA 3ONSA 2AQ2B 2KMCA 3PTFC 3N9YC 4W9GA 1U6RA 2INDC 2GWCA 2BYVE 4FJVB 4KSLC 1GPXA 3DBLB 2A4ZA 3L0WB 2Q5WD 2QIEB 2WXFA 1V1PA 3ZJTA 1JWMD 3ZNHB 1V80A 1SGHA 1SB3C 2BPSA 1JCKB 1GB1A 2J1QA 4OZBA 3BY4B 1SBBB 1PUTA 4II3B 4P6VF 1C9FA 1YOVB 2IY1B 3LB8C 4PYZA 4ACFA 2KXJA 4KDIC 1RWSA 4FJZA 2JXXA 3JSVA 3VAWA 2KKCA 2V0GA 2A5UA 1NVID 3DDCB 4EZKA 1KOTA 2MEKA 3RN9C 2Z0DB 2R2QA 1C4CA 5IAAC 2WGSA 4IC7B 1I4GA 3JW0X 2BTEA 3W2DA 4MH0E 2W82A 1WWTA 3KUZA 3MC9A 4CHKA 4GSWA 2HE7A 1MG8A 1IYFA 4A20A 2KTFA 3RMKC 1WZ0A 4XX5A 2FUG1 4N6EB 3FAHA 2MW5A 4Q2JA 2WDQB 3L4PA 3V6EB 1WRDB 4KKIA 1RFKA 3A9KB 1YNTE 3IHPC 1FXIA 1N62A 3BYTB 3P4QB 2ZW0A 4DHJB 1TZ1A 4MACA 2GLSA 3ZW3A 1E7PB 4ANXA 4NAWB 4BKSD 1FXTB 2ZZPB 3DREA 3RNGC 1HA5A 5FK9C 2WLBA 1XLPA 3AV8A 5IN7A 4XYCA 1SJED 3Q8CA 2GBKA 3R7RA 3ZJUA 1ET9A 3W5UB 1OFFA 2XN9C 2IBIB 1K53A 5GMVA 2EMSA 4CO7A 4P1CC 4KVGB 3TEZA 3VDZA 1V1OA 2MBEA 2MRPA 1VRPA 2KTRB 2X38A 5BYSA 2KOXA 3WALA 4BBNC 1PYWD 2IGDA 5DPWA 4GDKB 1OQRA 4MEMA 4IW0A 1V4GA 3PGEA 3PO0A 1WE7A 4WJPA 1WSPA 4HPMB 1JWBD 2JYEA 4BAXA 1CQVA 1HXYD 2DENB 1E10A 4MELA 4AS1A 3SFDB 1DGJA 3SU8X 1J7CA 4MH8A 2B3AA 1PDXA 3CSFA 2M0XA 1S3SG 3ML9A 1HZ5A 1T6BX 3UQBA 3PS6A 1WGDA 2JY6A 3M95A 5EE1A 3QCAA 3O13A 3Q3JA 4ZOHC 4P7IA 3Q8AA 4AM1A 1XO3A 5L83A 1YN5A 4NAWA 4RF1A 3BVMA 1C3TA 1TYGB 1XT9B 1K50A 2CHZA 3KUDB 2NCNA 2IDYA 3T8MA 4E74A 3BWUD 2LVPA 3FILA 4DHZE 4AOFA 4KGTA 3HVDA 2ACZB 1E8WA 4HCNB 5FKAC 2KDEB 2H88B 1WMHB 3ZO5B 2CKHB 5IA7A 4XC2A 5D94A 3VTWA 4DK5A 4BKTA 1FD6A 3I63C 4QAYA 4AUQC 4LNFA 2IJ0A 3BZDB 4F8CB 2DZIA 2NR2A 3ECIA 3ZDTA 1F9JA 4C56C 3AE6B 4HPPA 4IDIA 3N20C 1P98A 3B1LX 1D6EC 3LN7A 3VHTC 3B08A 2G1EA 4I6LB 3IXSA 2N9PC 4IUMB 3EUB2 3V05A 1WGHA 2KMMA 2LMCA 3QQ8B 4II2B 2NTSA 2D07B 2J52A 1OEYA 3AE3B 1V5TA 2J0MA 1NI3A 2BB6A 2HJ1A 2N9XA 1WX8A 1YX5B 4GVZA 2C7NB 3VUXA 2PW9A 2N4FA 4MSMB 3VR9B 2D3AA 4DXAB 1T3QA 3PRZA 3UI3A 2D2QA 3DOWA 4ARCA 2L76A 3EECA 2BBCA 3RFZB 1WM2A 1V49A 4W9KA 1P1AA 2LGXA 1WJ6A 3GB1A 4MDKE 2DLBA 4US9A 1JMLA 3U30A 1H8CA 2ZPNA 1E90A 2M4NA 4FULA 4ARIA 1KM7A 4GDLA 2AQ1B 2M1MA 4NQKE 4TSSA 4NNJB 2WXGA 1MHHE 4W9CA 2WHIA 1ESFA 1Z2MA 2JZPA 1SE2A 3ZDMC 2VH2A 4HXDA 3DBHI 1TS5A 3I9V1 2VH1A 2KJRA 3X0WA 2Z8LA 3RNEC 2QEJC 4OW0A 4RNAA 1RM6C 3RNAC 2NPTA 4JWUC 2NMQA 3ZXVA 2LWPA 3UIOB 4JWSC 1TY0A 2K6QA 4TUUA 3CMMB 3MC8A 3OG5A 2CHXA 3H6NA 4WJNA 4YT0B 4DHJD 1OQYA 4WWOA 3AEDB 3WAPA 3WA0A 3C8YA 1BMLC 3RZWC 1ISNA 5J2RA 5J9AA 1T5XD 1QOBA 2V4LA 2BKFA 1FNWA 1YMHE 3E56A 3MTNB 1ROEA 1QKZA 1DOXA 4CYEA 4EEWA 3L16A 3IT6B 2IO2B 4K3BA 4W9LA 2M19A 2MHJA 1D3ZA 2WWZA 2MQJA 3LXFA 1P0RA 1PFDA 2WNMA 4AP4C 2KZRA 4Z9MA 3P1MA 4JGHB 4ZHOA 2AX5A 1RLFA 1FRRA 2PMVA 2QDFA 1KH0A 3AEGB 4G50A 4K7UA 2N7DA 3Q3FA 3PLUA 2CRKA 5BMHA 3X23A 1YD8U 5EE9A 1P52A 4LNOA 4RF6A 3QAQA 3L2EA 4B0MA 1R4NI 1E8XA 2PVOD 1VDVA 1DYQA 1L4DB 2W3SA 3Q2AC 3PZDA 1I4HA 1FXAA 1WXVA 2K25A 3GZNB 2IY0B 2KVRA 3HVZA 2RD0A 1P50A 1F0ZA 2LGDA 3KW5B 5IOIA 4RF9A 1V9JA 2MH7A 3GE8C 1C79A 5DPSA 1SE3A 1RFAA 1FNUA 1D5MC 2K6DB 1M15A 5CTRC 2OEDA 1TKGA 1QF6A 4MGZE 2Y5CA 1GOZA 3ABVB 5MPOA 2RDBC 2CR5A 3W1SA 4DXGA 4ZRIA 4A90A 4N59A 2MBOA 1FFUA 1YQBA 4LDTB 3ZNGC 3NOBA 3TMPB 5H92C 1VZ6A 2MBQA 2FIDA 4BBNF 2DWQA 3N32A 2WXPA 4RM9A 2IO3B 4DDID 1NBFC 4G11A 3FKYA 5IO9A 5T8IA 1EF5A 1C76A 2N7EA 3EFUA 2I1KA 2RGFA 4WH4A 5CHFA 2PLPA 3DCGA 1FRDA 3P4SB 4OHJA 2YEPB 4FHJA 5EE3A 2J53A 1WM3A 3RNCC 4BKSA 4MGIE 3VUWA 3DWGC 2KLCA 3AEFB 5FR3A 1J0GA 2BYEA 1TJEA 3R3MA 4BFRA 4URKA 1NEKB 2L83A 4O1NA 3O65B 2QJLA 3N3KB 1UBIA 1YQ3B 1YX6B 3QHTA 3BK1A 1WJUA 3AM9A 3NRZA 2WXNA 2HJ8A 4JIOU 3RNFC 1FEHA 1F2RC 4LJOB 1QQRA 4HK2A 1RRBA 2KD0A 2WX1A 3CWIA 2PVGC 1UELA 2GRIA 3ZJVA 3B6RA 3JQ3A 3WAMA 3KLSX 1K8RB 2LJIA 3AULA 2KDIA 1I7HA 2IGHA 2WXIA 3AE2B 1I42A 5EE0A 2Y5BB 4OZAA 3M10A 3IT4B 4ICVA 2BS4B 2Z59B 3ZNZB 2D3CA 3W1SC 1SD0A 3H7PB 5JZEB 1HZ6A 1FM0D 4ZRQA 4HJGE 2KFJA 4KKJA 5JXVA 2LUMA 1R8GA 4LK0M 4S17A 2BW2A 1F52A 3IAS1 1IBXB 4ZRKA 1ZPSA 4IOIE 3IAM1 4IWQA 2N0SB 2MP2A 4WIPA 4HCPB 1AN8A 3OWEB 3U2SC 3C19A 4K81A 4GN1A 1Y8RC 1SSNA 2DHZA 1B1ZA 4KGSA 3LN6A 4IM2A 4JE3B 3ENEA 1PGXA 4BG4A 2W3RA 4RH6A 4YTPB 5DCNA 3AMZA 4KGRA 1TKYA 2L32A 2PE9A 1LFDA 2LFIA 1MG4A 1RL9A 1I0EA 4D2KA 2LASA 4HJKA 3ZVVA 4C7ZA 3HIZA 2BQQA 3TUOA 2WDTB 2L52A 4P1BC 1SE9A 5AEKB 3Q3NC 5E6OA 3PV1A 2GBRA 2W9NA 1WR1A 3UGBB 2JWUA 1NI2A 1N61A 1C4AA 3W5VB 2FCQA 2BWES 4MJSB 3DQVA 2AQ3B 4IKGA 3SFEB 1IBXA 3Q3MC 2ASQA 5LXIB 1STEA 4J3OD 1UGMA 1EUVB 2G45B 1WE6A 1EF1A 2BWFA 2FIFA 1UZXB 2R2OA 2LZ6A 4B9KA 2I38A 1VA6A 3VVWB 3B0AA 3VTVA 3VXWA 1YIWA 3LDZE 1OTRB 4BKGA 3RI7C 3NS1A 2KYWA 2AWTA 2DBYA 3PZ7A 4W9DA 2KN5A 2LGYA 1V81A 4KDLB 3TBLD 1UNSA 5GXGB 4KIKB 1LXDA 5AUIA 2LVQA 4LDTD 4TMAB 2JYTA 3T3OA 1BT0A 2UWQA 2QHOA 2I2YA 2JXTA 2CHWA 1C77A 1T0RC 2N9EB 1VLBA 2FAZA 1KTKA 1SEBD 4XWWA 3ALBA 1WGRA 3DBRB 3A9KA 1TS3A 1WI0A 3LVVA 2Y3AA 2KVZA 5TR5A 3WIMA 4A8XC 2GWDA 3AEAB 4K7WA 1TT5B 4DWFA 1V86A 1P9DU 2AL6A 2JZ3B 4E3CA 4EZJA 1SXTA 4NPNA 3P2BA 5TSSA 3ZKJC 1V8CA 2KC2A 1ZXHA 3ZTDA 4OVZA 1OQQA 2ICIA 1CMXB 3A1QB 4RMAA 3Q8FA 3L54A 3FC4A 3OJ3A 2JQRB 5BO4B 1WY8A 3A4RA 5C23A 1WR6E 2AEHA 3A9JB 4C00A 1E8ZA 1UBQA 2RPQA 4N58A 2KJ6A 1WXMA 2QSDA 4PT5A 2MJDA 2V9HA 5C2TB 1XQQA 3QC8B 3NS8A 2KX3A 4NJCA 2LRUA 5BMIA 1L6UA 4GXBA 2LHDA 3AU4A 2KTRA 3KQ4A 4WURA 1JWAD 1R4MI 2V1YA 3R8BA 4CQNA 4GDKA 3GP7A 3APCA 2LVOA 4KIKA 4S0RA 2J0KA 1AW7A 3LJ3A 1IPGA 3TEWA 3A4SC 4X57B 5G5HA 5H8YE 2KFKB 3L08A 5G2NA 1S1QB 3IVFA 1P3QU 4EKUA 2K8CA 1XLQA 5AZFA 2K8BA 2WU2B 2MBBB 1CK1A 2M56B 2QMTA 2N7JA 3AI5A 3KUCB 5DPTA 3PSEB 1D5XC 3OAWA 4GW0A 1YJIA 2EELA 2XK5B 1ZE3D 4HPLB 2KT7A 2G9HD 2O2VB 4L2YA 1WZ3A 1XEEA 3AN1A 3A1QA 4KSKC 4L23A 2KN4A 4WWNA 5HG2A 1I35A 3A9JA 2YVCA 1WMHA 1XLNA 1WYGA 4B0EA 3ZUNA 3M62B 3ZXRA 1N5WA 1SJHD 3H7SA 2WQYB 3NJTA 4RGOS 3DVNU 1TKEA 3D32A 4W9EA 2KO3A 3BYYB 3TL5A 3AECB 5IKCM 1QT9A 4HEA1 1LQBA 2M0AA 2PE6B 2RPVA 3VR8B 1KJTA 4HLEA 3MHZA 2L00B 1GNUA 1ZW7A 4HKZE 2Z0EB 2IO1B 2XNAC 5HFYA 2UYZB 2ZCCA 1UWMA 2JT4B 4M8MA 1N60A 2O6VB 3QWZB 2DAFA 3B9JA 3AEEB 2X8XX 1ZXIA 4RGMA 5J17A 2C9WB 4C7YA 1UWXA 3DBLI 1WF9A 1R7SA 2QC8A 1D5ZC 1HTOA 2D32A 3I5JC 4NY0A 3RPFC 3HM3A 4C80A 4B95A 1AWDA 3WCQA 2ZW1A 2IO0B 1SIFA 4JQWC 4A3PA 2MX2A 1WX9A 2KQ7A 3K9PB 4OZCA 2LRWA 2KAJA 3K9OB 2DZKA 2Y5PA 2B76B 4DDGD 5CHWA 1KRHA 4RCOA 2KMAA 1QZEA 3ETRA 2BYFA 4M01A 1N5XA 3WAOA 1JRPA 1TZOA 2RMMA 4M00A 1XXGA 2REXA 1ET6A 1ZDVA 5G55A 2XBBC 1C4PA 2K22A 2BYTA 2ONQA 3VRBB 2D33A 1WGYA 2LXAA 3Q6BA 2JRHA 4WQMA 5HHDG 4MGYE 3VFKA 3CSTA 4W9IA 2KJHB 4G0NB 3OLMD 1FCCC 4NJ6A 2IPKD 4LTUA 1V6EA 3A33B 2D10A 1LM8B 1C1YB 1GG3A 2E6XA 4XZ4A 2EKIA 1GB4A 3VH4B 5D3IB 2J7QB 3T9LA 2PKOA 3BVZA 4K1RB 1K52A 3HRDD 1L6VA 1XCQL 4IWPA 1L2NA 3NHEB 2YEPF 2LEKA 1MJDA 3KH0A 4RM8A 4EUTA 3TEYA 1WFYA 2JUOA 4HKQA 3AE5B 1TTNA 1MVKA 1E9MA 1N63A 4GOCA 3DPDA 3I57A 4MSQB 4ZRJA 4XWTA 1J19A 3SEBA 3JVZX 1N6ZA 4WWMA 4KX6B 1QILA 5L95C 1TY2A 3GE3C 4XDCA 2MWSB 1GC6A 2MA9B 4W9JA 2BT6A 3QARA 4FN2A 3TSSA 5AZGA 3NVVA 2HD5B 2NVUI 4GU2A 2WXJA 3TEXA 3DHIC 5D6JB 3DWMA 3IG8A 5LNK1 2IYDB 2ZEQA 3V62A 3ZYYX 3DRBA 2RDHA 1MHXA 1ACCA 1J7BA 3VUYA 2C60A 4JLCA 3UIPB 1KLVA 4NQLB 3V3XA 1AARA 4AQ7A 3BVGA 2L1AA 5JHBA 1V1PB 2JVCA 4GLSC 1TS4A 2G4SA 4L1BA 1UUPA 3H9DA 4KV2A 4WJOA 3WANA 4C4VB 2ZNVB 2W55A 2JX5A 1L4ZB 2NBUA 2GBMA 2L3ZA 1NYRA 2BKRB 2RDGA 2MJEA 4M8NA 1WXSA 4MT5A 3ML8A 2ZPYA 1SIJA 3U52E 5J99A 1MPEA 4N9F4 4PS8A 4IM3A 4ASWC 4B6WA 1L7YA 3CIRB 2DYMA 4FADA 5C3JB 1J8CA 1WGKA 1QOFA 2DYOA 1JWUD 2OJRA 2K39A 3BK2A 3EA6A 2L7RA 1V2YA 1WXAA 4I6NB 1UD7A 2L05A 2JSVX 2K1FA 2LGIA 4BOSC 3L2DA 4YSXB 3EC8A 2PJHA 2CS4A 4M0WB 3DBHB 5AUKA 1TS2A 2CU1A 3B2FA 1UGJA 4US8A 4HWIB 2KDMA 1FNVA 1WH3A 1GC7A 4JX1C 2NS5A 4BVUC 2WXRA 3AE7B 1HEZE 1WRIA 2O6VD 2NBVB 1YN3A 4AJWA 5CHVC 1F77A 2KK8A 1VCBA 1WXQA 2N1WA 2D5GA 2LJ5A 2C7HA 3AE1B 5BMGA 4KZCA 4WQOB 5G5GA 1HE8A 4C4VA 3RNBC 3GS2A 4YL8A 3ZIMA 5I4DA 4WWPA 2KDFB 2INCC 4LNIA 1Q10A 3N30A 3HUIA 1CJEA 4HDOA 2JRIB 3URYA 1IP9A 2BS2B 2DZMA 4GIVA 1OEYJ 2G4DB 1PGAA 2J42A 4R3DA 2D3BA 3N1ZC 3JU5A 1JALA 1P7EA 2WX0A 3S2AA 3Q14C 1JWSD 2J0JA 3KYDD 1RAXA 3L17A 4IWOA 5E6JA 1QH4A 4A6QA 2K9XA 2M8SA 2JU6X 4ZRPA 3AEBB 3PHXB 4RF8A 1AYFA 2XEWA 2ZCBA 5KHOA 2J4XA 2OOBB 1NYQA 4BOZB 1M94A 2VZKB 1X1MA 4J6IA 4A9AA 4LLGM 2G3QB 4HROA 3H7PA 2WXKA 1TGZB 2BF8B 3QX1A 1FCLA 2FE8A 4M0WA 1D4BA 1GAQB 3IG5A 4MGKE 3IG3A 1R4NB 2LHEA 4ITKA 3DHGC 2SAKA 1F2RI 3AB5A 5E6NA 3RYTA 4A55A 3N1XC 3BINA 3RD2A 4EE2A 3HHMA 3Q8EA 1GUAB 2KACA 2ZJDA 1HTQA 2UU7A 1M4VA 1WGGA 1ZDXA 4FXCA 2KANA 2M17A 1L0VB 4YTNB 3FILB 1RYJA 3MP9A 1E7VA 3UINB 1UH6A 3APDA 1CRKA 2DX5B 3EGRA 3M63B 2FNJB 3RT3B 3H1UA 4WJQA 3ZGZA 2KLGA 2CJNA 4TV3A 2GBNA 1BXTA 2GMIC 1KLUD 3VTUA 2ZNVC 4GW2A 2MLBA 3BIID 3R2TA 5D2MB 1B9RA 1ZKHA 4KZ0A 3V61A 1Q1OA 3T3NA 4RFBA 2YLMA 1I4XA 1WX7A 3QK0A 4IG7B 2INPE 3PT2B 1Q5WB 1T0YA 1BG0A 3RULA 1ZP0B 3MJ5A 2N9KA 4MJSA 1L5PA 3U8ZA 4ANVA 1H4RA 2JPHA 3DBSA 3I3TB 4BHLA 1U4AA
chains in the Genus database with same CATH topology
1CRKA 1P52A 3JQ3A 2D3BA 4LNKA 4RF7A 5J99A 3NG0A 4LNFA 3JU5A 2GLSA 1M15A 5J9AA 3FKYA 4LNOA 4RF6A 1G0WA 3L2EA 1F1HA 4S17A 1RL9A 1I0EA 3ZXVA 1F52A 4ACFA 2WHIA 2OJWA 3DRBA 4GVYA 4AM1A 4BG4B 1FPYA 1HTQA 3JU6A 4HPPA 2UU7A 2BVCA 3DREA 4S0RA 4GVZA 3M10A 1BG0A 1QH4A 4Q2RA 4Z9MA 4BAXA 1LGRA 2WGSA 2J1QA 2QC8A 4LNIA 4GW2A 4BG4A 4LNNA 1HTOA 1U6RA 3JPZA 4XYCA 2D3CA 1QK1A 1P50A 2D3AA 3ZXRA 1VRPA 1SD0A 4RF8A 4RF9A 4GW0A 4BHLA 2CRKA 3B6RA 3L2DA 2LGSA 3L2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRK A;  1P52 A;  3JQ3 A;  2D3B A;  4LNK A;  4RF7 A;  5J99 A;  3NG0 A;  4LNF A;  3JU5 A;  2GLS A;  1M15 A;  5J9A A;  3FKY A;  4LNO A;  4RF6 A;  1G0W A;  3L2E A;  1F1H A;  4S17 A;  1RL9 A;  1I0E A;  3ZXV A;  1F52 A;  4ACF A;  2WHI A;  2OJW A;  3DRB A;  4GVY A;  4AM1 A;  4BG4 B;  1FPY A;  1HTQ A;  3JU6 A;  4HPP A;  2UU7 A;  2BVC A;  3DRE A;  4S0R A;  4GVZ A;  3M10 A;  1BG0 A;  1QH4 A;  4Q2R A;  4Z9M A;  4BAX A;  1LGR A;  2WGS A;  2J1Q A;  2QC8 A;  4LNI A;  4GW2 A;  4BG4 A;  4LNN A;  1HTO A;  1U6R A;  3JPZ A;  4XYC A;  2D3C A;  1QK1 A;  1P50 A;  2D3A A;  3ZXR A;  1VRP A;  1SD0 A;  4RF8 A;  4RF9 A;  4GW0 A;  4BHL A;  2CRK A;  3B6R A;  3L2D A;  2LGS A;  3L2E B; 
#chains in the Genus database with same CATH topology
 1MFW A;  2N1V A;  3ZLZ A;  4YSY B;  3Q3O C;  1TBE A;  3PRP B;  4JL9 A;  2C5L C;  1VJK A;  4EOY A;  3QIJ A;  2K8H A;  3GZN I;  1OGW A;  2WXL A;  1VR9 A;  2SEB D;  1Q0W B;  4PYU A;  1EWC A;  1A5R A;  1PGB A;  3AE4 B;  2WDR B;  2MSE D;  5HKH A;  5D3D A;  2EKE C;  4W9H A;  3NZ3 A;  3NZS A;  4W9F A;  3ZQ4 A;  3PPA A;  1I4P A;  3AXC A;  3B2G A;  3NVY A;  4WAA A;  5DPR A;  1NDD A;  2R61 A;  4OVU A;  3R2I A;  3DHH C;  2NTT A;  5HI1 A;  1GJZ A;  3AE8 B;  4GDL B;  1E5W A;  2JZZ A;  4REZ A;  1KFY B;  2EMT A;  4ZDV A;  2JF5 A;  4JPS A;  1XLO A;  3UF8 A;  4PS3 A;  2D11 A;  4DBG A;  4TKN A;  3AE9 B;  1XCT L;  1JQ4 A;  1WIA A;  5CX3 A;  2K0P A;  4FJY A;  3HM6 X;  2IZV B;  3NZT A;  3VQI A;  3KWV A;  3KWL A;  1V97 A;  3OJ4 B;  3W1Y A;  3IBE A;  3ZTC A;  2WXQ A;  2RR9 A;  4F7Z A;  2NPT B;  1E7U A;  2DYB A;  4ICU A;  2K5P A;  3IFW B;  1KLG D;  3V60 A;  3R7Q A;  1FO4 A;  3JU6 A;  2FBW B;  3U7Z A;  3EHV A;  1EU4 A;  1WJ4 A;  3VRA B;  4ZYN A;  4M02 A;  4RF0 A;  2MBH A;  1EWY C;  2KQS A;  1G6J A;  1IUE A;  1QLB B;  4K3C A;  2BGF A;  1T0Q C;  4XDD A;  3ZNI D;  3MC0 B;  1C78 A;  2AL3 A;  2KC1 A;  1CZP A;  3NVZ A;  4EFO A;  4ZHP A;  1SF0 A;  3QA8 A;  3SD5 A;  2WU5 B;  1G0W A;  1KF6 B;  2WP9 B;  5C1Z A;  2GB1 A;  2BVC A;  3RUI B;  4FA6 A;  1ENF A;  1EO6 A;  4NJ7 A;  5LLI A;  3UQA A;  2WXO A;  2KHW B;  3E9S A;  1VRA B;  2FCM A;  3NUH B;  2DNF A;  5AZH A;  4RGT A;  1L0Y B;  4DHZ B;  2KFK A;  2RSU A;  2TSS A;  3KYC D;  2HTM E;  2LI5 A;  2E3T A;  3TJP A;  4LCD E;  1EM7 A;  5D7G A;  4GVY A;  1ZUD 2;  2MCN B;  2QIL A;  3MFG A;  2W54 A;  1PQS A;  2VZK D;  4NZL B;  4I6P A;  2HDE A;  2BS3 B;  3N1Y C;  1DOI A;  1EU3 A;  4YWG G;  2GBJ A;  3L2E B;  4ANW A;  1JRO A;  3LVW A;  4TQ0 A;  2XK5 A;  2V3N A;  3L13 A;  4WAF A;  1FFV A;  3Q8B A;  1MI0 A;  2O2V A;  3JYU A;  3Q69 A;  5BYR A;  1BUI C;  1DOY A;  3TCA A;  3PLV A;  4PK1 A;  1E6E B;  4NAM A;  4P16 A;  2WXM A;  2MJ3 A;  1E0Z A;  2KDB A;  1YJ1 A;  2D3G A;  4XE0 A;  4AWJ A;  2L0T A;  1TIF A;  1VZ7 A;  5BYQ A;  3U4E G;  3L10 B;  2PIA A;  1QOA A;  3NVW A;  1VD2 A;  2LGS A;  4GGQ A;  3W9C B;  4DQO C;  5IP4 D;  3AU5 A;  2CJO A;  2V3P A;  5FR6 A;  4YTM B;  2BB5 A;  2NBW B;  3RCZ A;  3KVF B;  2O6V A;  4F1S A;  1FPY A;  1XD3 B;  4XGA B;  3C0R B;  4PS7 A;  5J18 A;  3P4P B;  3SR6 A;  4LNN A;  3JPZ A;  3VH3 B;  4RGN A;  4HDQ A;  3EFC A;  2ON8 A;  2JWZ A;  3PZ8 A;  4E71 A;  2N9L A;  2H89 B;  2GI9 A;  2L8J A;  1VZ8 A;  2DZJ A;  4A3O A;  4ANU A;  4HVB A;  4IM0 A;  4GB9 A;  3P4R B;  4OVV A;  2KWC A;  3MJW A;  3DVG Y;  2KX0 A;  4EZL A;  5LXH A;  2VRR B;  2FCN A;  3PVL A;  2KQ4 X;  2WXH A;  1ZOY B;  2I1J A;  5JHA A;  1QOG A;  1NEN B;  1I4Q A;  4GMV A;  4LNK A;  2QCZ A;  1L0X B;  1Z5S B;  2KWU B;  4TQ1 A;  2ZVO A;  3RZF A;  3SDL C;  1R4M B;  2FCS A;  1K51 A;  2PEA A;  4BZA A;  5KHQ A;  3PRM B;  3V6C B;  3HK0 A;  2WYQ A;  4MM3 B;  1IGC A;  1J7A A;  1TT4 A;  3H8H A;  2AYO B;  1F1H A;  3DVG X;  4H2A A;  1HQR D;  3DVN V;  3R66 C;  2LUE A;  2IGG A;  1JW9 D;  4Q2R A;  4ZYS A;  1LGR A;  1P7F A;  2KWV B;  1T0S C;  1IGD A;  3DBR I;  4FBJ B;  1V5O A;  1YQ4 B;  3QJZ A;  1FIQ A;  4FLH A;  1WJN A;  1YN4 A;  3MHS D;  3ZRF A;  3M3J A;  2HTH A;  3LYY A;  2LXC A;  2INN E;  3TIX A;  2MP2 B;  3NY5 A;  4DXF A;  5E6P A;  1A70 A;  4AJY B;  2L0F A;  2ZVN A;  1UF0 A;  3JSV B;  2V3S A;  2FUH B;  1E8Y A;  4USA A;  1YJJ A;  4RF7 A;  1WYW B;  4YXD B;  5EDS A;  3P63 A;  4FHK A;  3SHQ A;  2C7M B;  2PTL A;  4HRS A;  4LJP B;  4G3X B;  4BG4 B;  2CU3 A;  1FMA D;  2K3U A;  2V4I B;  3U7D A;  3GOE A;  4UDU C;  1LO5 D;  4YSZ B;  2GOW A;  1Y56 A;  3CF6 E;  3NZU A;  3AH7 A;  2LD9 A;  1JRU A;  2WS3 B;  5JH5 C;  1SE4 A;  1QK1 A;  3APF A;  3PRE A;  2OHF A;  4K7S A;  2PPH A;  3PHW B;  2KWD A;  3ZRC A;  1XF5 L;  1ZGU B;  1I4R A;  2WDV B;  3NG0 A;  3J9C A;  4MM3 A;  2DAJ A;  2OJW A;  3P42 A;  2KNB A;  3ONS A;  2AQ2 B;  2KMC A;  3PTF C;  3N9Y C;  4W9G A;  1U6R A;  2IND C;  2GWC A;  2BYV E;  4FJV B;  4KSL C;  1GPX A;  3DBL B;  2A4Z A;  3L0W B;  2Q5W D;  2QIE B;  2WXF A;  1V1P A;  3ZJT A;  1JWM D;  3ZNH B;  1V80 A;  1SGH A;  1SB3 C;  2BPS A;  1JCK B;  1GB1 A;  2J1Q A;  4OZB A;  3BY4 B;  1SBB B;  1PUT A;  4II3 B;  4P6V F;  1C9F A;  1YOV B;  2IY1 B;  3LB8 C;  4PYZ A;  4ACF A;  2KXJ A;  4KDI C;  1RWS A;  4FJZ A;  2JXX A;  3JSV A;  3VAW A;  2KKC A;  2V0G A;  2A5U A;  1NVI D;  3DDC B;  4EZK A;  1KOT A;  2MEK A;  3RN9 C;  2Z0D B;  2R2Q A;  1C4C A;  5IAA C;  2WGS A;  4IC7 B;  1I4G A;  3JW0 X;  2BTE A;  3W2D A;  4MH0 E;  2W82 A;  1WWT A;  3KUZ A;  3MC9 A;  4CHK A;  4GSW A;  2HE7 A;  1MG8 A;  1IYF A;  4A20 A;  2KTF A;  3RMK C;  1WZ0 A;  4XX5 A;  2FUG 1;  4N6E B;  3FAH A;  2MW5 A;  4Q2J A;  2WDQ B;  3L4P A;  3V6E B;  1WRD B;  4KKI A;  1RFK A;  3A9K B;  1YNT E;  3IHP C;  1FXI A;  1N62 A;  3BYT B;  3P4Q B;  2ZW0 A;  4DHJ B;  1TZ1 A;  4MAC A;  2GLS A;  3ZW3 A;  1E7P B;  4ANX A;  4NAW B;  4BKS D;  1FXT B;  2ZZP B;  3DRE A;  3RNG C;  1HA5 A;  5FK9 C;  2WLB A;  1XLP A;  3AV8 A;  5IN7 A;  4XYC A;  1SJE D;  3Q8C A;  2GBK A;  3R7R A;  3ZJU A;  1ET9 A;  3W5U B;  1OFF A;  2XN9 C;  2IBI B;  1K53 A;  5GMV A;  2EMS A;  4CO7 A;  4P1C C;  4KVG B;  3TEZ A;  3VDZ A;  1V1O A;  2MBE A;  2MRP A;  1VRP A;  2KTR B;  2X38 A;  5BYS A;  2KOX A;  3WAL A;  4BBN C;  1PYW D;  2IGD A;  5DPW A;  4GDK B;  1OQR A;  4MEM A;  4IW0 A;  1V4G A;  3PGE A;  3PO0 A;  1WE7 A;  4WJP A;  1WSP A;  4HPM B;  1JWB D;  2JYE A;  4BAX A;  1CQV A;  1HXY D;  2DEN B;  1E10 A;  4MEL A;  4AS1 A;  3SFD B;  1DGJ A;  3SU8 X;  1J7C A;  4MH8 A;  2B3A A;  1PDX A;  3CSF A;  2M0X A;  1S3S G;  3ML9 A;  1HZ5 A;  1T6B X;  3UQB A;  3PS6 A;  1WGD A;  2JY6 A;  3M95 A;  5EE1 A;  3QCA A;  3O13 A;  3Q3J A;  4ZOH C;  4P7I A;  3Q8A A;  4AM1 A;  1XO3 A;  5L83 A;  1YN5 A;  4NAW A;  4RF1 A;  3BVM A;  1C3T A;  1TYG B;  1XT9 B;  1K50 A;  2CHZ A;  3KUD B;  2NCN A;  2IDY A;  3T8M A;  4E74 A;  3BWU D;  2LVP A;  3FIL A;  4DHZ E;  4AOF A;  4KGT A;  3HVD A;  2ACZ B;  1E8W A;  4HCN B;  5FKA C;  2KDE B;  2H88 B;  1WMH B;  3ZO5 B;  2CKH B;  5IA7 A;  4XC2 A;  5D94 A;  3VTW A;  4DK5 A;  4BKT A;  1FD6 A;  3I63 C;  4QAY A;  4AUQ C;  4LNF A;  2IJ0 A;  3BZD B;  4F8C B;  2DZI A;  2NR2 A;  3ECI A;  3ZDT A;  1F9J A;  4C56 C;  3AE6 B;  4HPP A;  4IDI A;  3N20 C;  1P98 A;  3B1L X;  1D6E C;  3LN7 A;  3VHT C;  3B08 A;  2G1E A;  4I6L B;  3IXS A;  2N9P C;  4IUM B;  3EUB 2;  3V05 A;  1WGH A;  2KMM A;  2LMC A;  3QQ8 B;  4II2 B;  2NTS A;  2D07 B;  2J52 A;  1OEY A;  3AE3 B;  1V5T A;  2J0M A;  1NI3 A;  2BB6 A;  2HJ1 A;  2N9X A;  1WX8 A;  1YX5 B;  4GVZ A;  2C7N B;  3VUX A;  2PW9 A;  2N4F A;  4MSM B;  3VR9 B;  2D3A A;  4DXA B;  1T3Q A;  3PRZ A;  3UI3 A;  2D2Q A;  3DOW A;  4ARC A;  2L76 A;  3EEC A;  2BBC A;  3RFZ B;  1WM2 A;  1V49 A;  4W9K A;  1P1A A;  2LGX A;  1WJ6 A;  3GB1 A;  4MDK E;  2DLB A;  4US9 A;  1JML A;  3U30 A;  1H8C A;  2ZPN A;  1E90 A;  2M4N A;  4FUL A;  4ARI A;  1KM7 A;  4GDL A;  2AQ1 B;  2M1M A;  4NQK E;  4TSS A;  4NNJ B;  2WXG A;  1MHH E;  4W9C A;  2WHI A;  1ESF A;  1Z2M A;  2JZP A;  1SE2 A;  3ZDM C;  2VH2 A;  4HXD A;  3DBH I;  1TS5 A;  3I9V 1;  2VH1 A;  2KJR A;  3X0W A;  2Z8L A;  3RNE C;  2QEJ C;  4OW0 A;  4RNA A;  1RM6 C;  3RNA C;  2NPT A;  4JWU C;  2NMQ A;  3ZXV A;  2LWP A;  3UIO B;  4JWS C;  1TY0 A;  2K6Q A;  4TUU A;  3CMM B;  3MC8 A;  3OG5 A;  2CHX A;  3H6N A;  4WJN A;  4YT0 B;  4DHJ D;  1OQY A;  4WWO A;  3AED B;  3WAP A;  3WA0 A;  3C8Y A;  1BML C;  3RZW C;  1ISN A;  5J2R A;  5J9A A;  1T5X D;  1QOB A;  2V4L A;  2BKF A;  1FNW A;  1YMH E;  3E56 A;  3MTN B;  1ROE A;  1QKZ A;  1DOX A;  4CYE A;  4EEW A;  3L16 A;  3IT6 B;  2IO2 B;  4K3B A;  4W9L A;  2M19 A;  2MHJ A;  1D3Z A;  2WWZ A;  2MQJ A;  3LXF A;  1P0R A;  1PFD A;  2WNM A;  4AP4 C;  2KZR A;  4Z9M A;  3P1M A;  4JGH B;  4ZHO A;  2AX5 A;  1RLF A;  1FRR A;  2PMV A;  2QDF A;  1KH0 A;  3AEG B;  4G50 A;  4K7U A;  2N7D A;  3Q3F A;  3PLU A;  2CRK A;  5BMH A;  3X23 A;  1YD8 U;  5EE9 A;  1P52 A;  4LNO A;  4RF6 A;  3QAQ A;  3L2E A;  4B0M A;  1R4N I;  1E8X A;  2PVO D;  1VDV A;  1DYQ A;  1L4D B;  2W3S A;  3Q2A C;  3PZD A;  1I4H A;  1FXA A;  1WXV A;  2K25 A;  3GZN B;  2IY0 B;  2KVR A;  3HVZ A;  2RD0 A;  1P50 A;  1F0Z A;  2LGD A;  3KW5 B;  5IOI A;  4RF9 A;  1V9J A;  2MH7 A;  3GE8 C;  1C79 A;  5DPS A;  1SE3 A;  1RFA A;  1FNU A;  1D5M C;  2K6D B;  1M15 A;  5CTR C;  2OED A;  1TKG A;  1QF6 A;  4MGZ E;  2Y5C A;  1GOZ A;  3ABV B;  5MPO A;  2RDB C;  2CR5 A;  3W1S A;  4DXG A;  4ZRI A;  4A90 A;  4N59 A;  2MBO A;  1FFU A;  1YQB A;  4LDT B;  3ZNG C;  3NOB A;  3TMP B;  5H92 C;  1VZ6 A;  2MBQ A;  2FID A;  4BBN F;  2DWQ A;  3N32 A;  2WXP A;  4RM9 A;  2IO3 B;  4DDI D;  1NBF C;  4G11 A;  3FKY A;  5IO9 A;  5T8I A;  1EF5 A;  1C76 A;  2N7E A;  3EFU A;  2I1K A;  2RGF A;  4WH4 A;  5CHF A;  2PLP A;  3DCG A;  1FRD A;  3P4S B;  4OHJ A;  2YEP B;  4FHJ A;  5EE3 A;  2J53 A;  1WM3 A;  3RNC C;  4BKS A;  4MGI E;  3VUW A;  3DWG C;  2KLC A;  3AEF B;  5FR3 A;  1J0G A;  2BYE A;  1TJE A;  3R3M A;  4BFR A;  4URK A;  1NEK B;  2L83 A;  4O1N A;  3O65 B;  2QJL A;  3N3K B;  1UBI A;  1YQ3 B;  1YX6 B;  3QHT A;  3BK1 A;  1WJU A;  3AM9 A;  3NRZ A;  2WXN A;  2HJ8 A;  4JIO U;  3RNF C;  1FEH A;  1F2R C;  4LJO B;  1QQR A;  4HK2 A;  1RRB A;  2KD0 A;  2WX1 A;  3CWI A;  2PVG C;  1UEL A;  2GRI A;  3ZJV A;  3B6R A;  3JQ3 A;  3WAM A;  3KLS X;  1K8R B;  2LJI A;  3AUL A;  2KDI A;  1I7H A;  2IGH A;  2WXI A;  3AE2 B;  1I42 A;  5EE0 A;  2Y5B B;  4OZA A;  3M10 A;  3IT4 B;  4ICV A;  2BS4 B;  2Z59 B;  3ZNZ B;  2D3C A;  3W1S C;  1SD0 A;  3H7P B;  5JZE B;  1HZ6 A;  1FM0 D;  4ZRQ A;  4HJG E;  2KFJ A;  4KKJ A;  5JXV A;  2LUM A;  1R8G A;  4LK0 M;  4S17 A;  2BW2 A;  1F52 A;  3IAS 1;  1IBX B;  4ZRK A;  1ZPS A;  4IOI E;  3IAM 1;  4IWQ A;  2N0S B;  2MP2 A;  4WIP A;  4HCP B;  1AN8 A;  3OWE B;  3U2S C;  3C19 A;  4K81 A;  4GN1 A;  1Y8R C;  1SSN A;  2DHZ A;  1B1Z A;  4KGS A;  3LN6 A;  4IM2 A;  4JE3 B;  3ENE A;  1PGX A;  4BG4 A;  2W3R A;  4RH6 A;  4YTP B;  5DCN A;  3AMZ A;  4KGR A;  1TKY A;  2L32 A;  2PE9 A;  1LFD A;  2LFI A;  1MG4 A;  1RL9 A;  1I0E A;  4D2K A;  2LAS A;  4HJK A;  3ZVV A;  4C7Z A;  3HIZ A;  2BQQ A;  3TUO A;  2WDT B;  2L52 A;  4P1B C;  1SE9 A;  5AEK B;  3Q3N C;  5E6O A;  3PV1 A;  2GBR A;  2W9N A;  1WR1 A;  3UGB B;  2JWU A;  1NI2 A;  1N61 A;  1C4A A;  3W5V B;  2FCQ A;  2BWE S;  4MJS B;  3DQV A;  2AQ3 B;  4IKG A;  3SFE B;  1IBX A;  3Q3M C;  2ASQ A;  5LXI B;  1STE A;  4J3O D;  1UGM A;  1EUV B;  2G45 B;  1WE6 A;  1EF1 A;  2BWF A;  2FIF A;  1UZX B;  2R2O A;  2LZ6 A;  4B9K A;  2I38 A;  1VA6 A;  3VVW B;  3B0A A;  3VTV A;  3VXW A;  1YIW A;  3LDZ E;  1OTR B;  4BKG A;  3RI7 C;  3NS1 A;  2KYW A;  2AWT A;  2DBY A;  3PZ7 A;  4W9D A;  2KN5 A;  2LGY A;  1V81 A;  4KDL B;  3TBL D;  1UNS A;  5GXG B;  4KIK B;  1LXD A;  5AUI A;  2LVQ A;  4LDT D;  4TMA B;  2JYT A;  3T3O A;  1BT0 A;  2UWQ A;  2QHO A;  2I2Y A;  2JXT A;  2CHW A;  1C77 A;  1T0R C;  2N9E B;  1VLB A;  2FAZ A;  1KTK A;  1SEB D;  4XWW A;  3ALB A;  1WGR A;  3DBR B;  3A9K A;  1TS3 A;  1WI0 A;  3LVV A;  2Y3A A;  2KVZ A;  5TR5 A;  3WIM A;  4A8X C;  2GWD A;  3AEA B;  4K7W A;  1TT5 B;  4DWF A;  1V86 A;  1P9D U;  2AL6 A;  2JZ3 B;  4E3C A;  4EZJ A;  1SXT A;  4NPN A;  3P2B A;  5TSS A;  3ZKJ C;  1V8C A;  2KC2 A;  1ZXH A;  3ZTD A;  4OVZ A;  1OQQ A;  2ICI A;  1CMX B;  3A1Q B;  4RMA A;  3Q8F A;  3L54 A;  3FC4 A;  3OJ3 A;  2JQR B;  5BO4 B;  1WY8 A;  3A4R A;  5C23 A;  1WR6 E;  2AEH A;  3A9J B;  4C00 A;  1E8Z A;  1UBQ A;  2RPQ A;  4N58 A;  2KJ6 A;  1WXM A;  2QSD A;  4PT5 A;  2MJD A;  2V9H A;  5C2T B;  1XQQ A;  3QC8 B;  3NS8 A;  2KX3 A;  4NJC A;  2LRU A;  5BMI A;  1L6U A;  4GXB A;  2LHD A;  3AU4 A;  2KTR A;  3KQ4 A;  4WUR A;  1JWA D;  1R4M I;  2V1Y A;  3R8B A;  4CQN A;  4GDK A;  3GP7 A;  3APC A;  2LVO A;  4KIK A;  4S0R A;  2J0K A;  1AW7 A;  3LJ3 A;  1IPG A;  3TEW A;  3A4S C;  4X57 B;  5G5H A;  5H8Y E;  2KFK B;  3L08 A;  5G2N A;  1S1Q B;  3IVF A;  1P3Q U;  4EKU A;  2K8C A;  1XLQ A;  5AZF A;  2K8B A;  2WU2 B;  2MBB B;  1CK1 A;  2M56 B;  2QMT A;  2N7J A;  3AI5 A;  3KUC B;  5DPT A;  3PSE B;  1D5X C;  3OAW A;  4GW0 A;  1YJI A;  2EEL A;  2XK5 B;  1ZE3 D;  4HPL B;  2KT7 A;  2G9H D;  2O2V B;  4L2Y A;  1WZ3 A;  1XEE A;  3AN1 A;  3A1Q A;  4KSK C;  4L23 A;  2KN4 A;  4WWN A;  5HG2 A;  1I35 A;  3A9J A;  2YVC A;  1WMH A;  1XLN A;  1WYG A;  4B0E A;  3ZUN A;  3M62 B;  3ZXR A;  1N5W A;  1SJH D;  3H7S A;  2WQY B;  3NJT A;  4RGO S;  3DVN U;  1TKE A;  3D32 A;  4W9E A;  2KO3 A;  3BYY B;  3TL5 A;  3AEC B;  5IKC M;  1QT9 A;  4HEA 1;  1LQB A;  2M0A A;  2PE6 B;  2RPV A;  3VR8 B;  1KJT A;  4HLE A;  3MHZ A;  2L00 B;  1GNU A;  1ZW7 A;  4HKZ E;  2Z0E B;  2IO1 B;  2XNA C;  5HFY A;  2UYZ B;  2ZCC A;  1UWM A;  2JT4 B;  4M8M A;  1N60 A;  2O6V B;  3QWZ B;  2DAF A;  3B9J A;  3AEE B;  2X8X X;  1ZXI A;  4RGM A;  5J17 A;  2C9W B;  4C7Y A;  1UWX A;  3DBL I;  1WF9 A;  1R7S A;  2QC8 A;  1D5Z C;  1HTO A;  2D32 A;  3I5J C;  4NY0 A;  3RPF C;  3HM3 A;  4C80 A;  4B95 A;  1AWD A;  3WCQ A;  2ZW1 A;  2IO0 B;  1SIF A;  4JQW C;  4A3P A;  2MX2 A;  1WX9 A;  2KQ7 A;  3K9P B;  4OZC A;  2LRW A;  2KAJ A;  3K9O B;  2DZK A;  2Y5P A;  2B76 B;  4DDG D;  5CHW A;  1KRH A;  4RCO A;  2KMA A;  1QZE A;  3ETR A;  2BYF A;  4M01 A;  1N5X A;  3WAO A;  1JRP A;  1TZO A;  2RMM A;  4M00 A;  1XXG A;  2REX A;  1ET6 A;  1ZDV A;  5G55 A;  2XBB C;  1C4P A;  2K22 A;  2BYT A;  2ONQ A;  3VRB B;  2D33 A;  1WGY A;  2LXA A;  3Q6B A;  2JRH A;  4WQM A;  5HHD G;  4MGY E;  3VFK A;  3CST A;  4W9I A;  2KJH B;  4G0N B;  3OLM D;  1FCC C;  4NJ6 A;  2IPK D;  4LTU A;  1V6E A;  3A33 B;  2D10 A;  1LM8 B;  1C1Y B;  1GG3 A;  2E6X A;  4XZ4 A;  2EKI A;  1GB4 A;  3VH4 B;  5D3I B;  2J7Q B;  3T9L A;  2PKO A;  3BVZ A;  4K1R B;  1K52 A;  3HRD D;  1L6V A;  1XCQ L;  4IWP A;  1L2N A;  3NHE B;  2YEP F;  2LEK A;  1MJD A;  3KH0 A;  4RM8 A;  4EUT A;  3TEY A;  1WFY A;  2JUO A;  4HKQ A;  3AE5 B;  1TTN A;  1MVK A;  1E9M A;  1N63 A;  4GOC A;  3DPD A;  3I57 A;  4MSQ B;  4ZRJ A;  4XWT A;  1J19 A;  3SEB A;  3JVZ X;  1N6Z A;  4WWM A;  4KX6 B;  1QIL A;  5L95 C;  1TY2 A;  3GE3 C;  4XDC A;  2MWS B;  1GC6 A;  2MA9 B;  4W9J A;  2BT6 A;  3QAR A;  4FN2 A;  3TSS A;  5AZG A;  3NVV A;  2HD5 B;  2NVU I;  4GU2 A;  2WXJ A;  3TEX A;  3DHI C;  5D6J B;  3DWM A;  3IG8 A;  5LNK 1;  2IYD B;  2ZEQ A;  3V62 A;  3ZYY X;  3DRB A;  2RDH A;  1MHX A;  1ACC A;  1J7B A;  3VUY A;  2C60 A;  4JLC A;  3UIP B;  1KLV A;  4NQL B;  3V3X A;  1AAR A;  4AQ7 A;  3BVG A;  2L1A A;  5JHB A;  1V1P B;  2JVC A;  4GLS C;  1TS4 A;  2G4S A;  4L1B A;  1UUP A;  3H9D A;  4KV2 A;  4WJO A;  3WAN A;  4C4V B;  2ZNV B;  2W55 A;  2JX5 A;  1L4Z B;  2NBU A;  2GBM A;  2L3Z A;  1NYR A;  2BKR B;  2RDG A;  2MJE A;  4M8N A;  1WXS A;  4MT5 A;  3ML8 A;  2ZPY A;  1SIJ A;  3U52 E;  5J99 A;  1MPE A;  4N9F 4;  4PS8 A;  4IM3 A;  4ASW C;  4B6W A;  1L7Y A;  3CIR B;  2DYM A;  4FAD A;  5C3J B;  1J8C A;  1WGK A;  1QOF A;  2DYO A;  1JWU D;  2OJR A;  2K39 A;  3BK2 A;  3EA6 A;  2L7R A;  1V2Y A;  1WXA A;  4I6N B;  1UD7 A;  2L05 A;  2JSV X;  2K1F A;  2LGI A;  4BOS C;  3L2D A;  4YSX B;  3EC8 A;  2PJH A;  2CS4 A;  4M0W B;  3DBH B;  5AUK A;  1TS2 A;  2CU1 A;  3B2F A;  1UGJ A;  4US8 A;  4HWI B;  2KDM A;  1FNV A;  1WH3 A;  1GC7 A;  4JX1 C;  2NS5 A;  4BVU C;  2WXR A;  3AE7 B;  1HEZ E;  1WRI A;  2O6V D;  2NBV B;  1YN3 A;  4AJW A;  5CHV C;  1F77 A;  2KK8 A;  1VCB A;  1WXQ A;  2N1W A;  2D5G A;  2LJ5 A;  2C7H A;  3AE1 B;  5BMG A;  4KZC A;  4WQO B;  5G5G A;  1HE8 A;  4C4V A;  3RNB C;  3GS2 A;  4YL8 A;  3ZIM A;  5I4D A;  4WWP A;  2KDF B;  2INC C;  4LNI A;  1Q10 A;  3N30 A;  3HUI A;  1CJE A;  4HDO A;  2JRI B;  3URY A;  1IP9 A;  2BS2 B;  2DZM A;  4GIV A;  1OEY J;  2G4D B;  1PGA A;  2J42 A;  4R3D A;  2D3B A;  3N1Z C;  3JU5 A;  1JAL A;  1P7E A;  2WX0 A;  3S2A A;  3Q14 C;  1JWS D;  2J0J A;  3KYD D;  1RAX A;  3L17 A;  4IWO A;  5E6J A;  1QH4 A;  4A6Q A;  2K9X A;  2M8S A;  2JU6 X;  4ZRP A;  3AEB B;  3PHX B;  4RF8 A;  1AYF A;  2XEW A;  2ZCB A;  5KHO A;  2J4X A;  2OOB B;  1NYQ A;  4BOZ B;  1M94 A;  2VZK B;  1X1M A;  4J6I A;  4A9A A;  4LLG M;  2G3Q B;  4HRO A;  3H7P A;  2WXK A;  1TGZ B;  2BF8 B;  3QX1 A;  1FCL A;  2FE8 A;  4M0W A;  1D4B A;  1GAQ B;  3IG5 A;  4MGK E;  3IG3 A;  1R4N B;  2LHE A;  4ITK A;  3DHG C;  2SAK A;  1F2R I;  3AB5 A;  5E6N A;  3RYT A;  4A55 A;  3N1X C;  3BIN A;  3RD2 A;  4EE2 A;  3HHM A;  3Q8E A;  1GUA B;  2KAC A;  2ZJD A;  1HTQ A;  2UU7 A;  1M4V A;  1WGG A;  1ZDX A;  4FXC A;  2KAN A;  2M17 A;  1L0V B;  4YTN B;  3FIL B;  1RYJ A;  3MP9 A;  1E7V A;  3UIN B;  1UH6 A;  3APD A;  1CRK A;  2DX5 B;  3EGR A;  3M63 B;  2FNJ B;  3RT3 B;  3H1U A;  4WJQ A;  3ZGZ A;  2KLG A;  2CJN A;  4TV3 A;  2GBN A;  1BXT A;  2GMI C;  1KLU D;  3VTU A;  2ZNV C;  4GW2 A;  2MLB A;  3BII D;  3R2T A;  5D2M B;  1B9R A;  1ZKH A;  4KZ0 A;  3V61 A;  1Q1O A;  3T3N A;  4RFB A;  2YLM A;  1I4X A;  1WX7 A;  3QK0 A;  4IG7 B;  2INP E;  3PT2 B;  1Q5W B;  1T0Y A;  1BG0 A;  3RUL A;  1ZP0 B;  3MJ5 A;  2N9K A;  4MJS A;  1L5P A;  3U8Z A;  4ANV A;  1H4R A;  2JPH A;  3DBS A;  3I3T B;  4BHL A;  1U4A A; 
#chains in the Genus database with same CATH homology
 1CRK A;  1P52 A;  3JQ3 A;  2D3B A;  4LNK A;  4RF7 A;  5J99 A;  3NG0 A;  4LNF A;  3JU5 A;  2GLS A;  1M15 A;  5J9A A;  3FKY A;  4LNO A;  4RF6 A;  1G0W A;  3L2E A;  1F1H A;  4S17 A;  1RL9 A;  1I0E A;  3ZXV A;  1F52 A;  4ACF A;  2WHI A;  2OJW A;  3DRB A;  4GVY A;  4AM1 A;  4BG4 B;  1FPY A;  1HTQ A;  3JU6 A;  4HPP A;  2UU7 A;  2BVC A;  3DRE A;  4S0R A;  4GVZ A;  3M10 A;  1BG0 A;  1QH4 A;  4Q2R A;  4Z9M A;  4BAX A;  1LGR A;  2WGS A;  2J1Q A;  2QC8 A;  4LNI A;  4GW2 A;  4BG4 A;  4LNN A;  1HTO A;  1U6R A;  3JPZ A;  4XYC A;  2D3C A;  1QK1 A;  1P50 A;  2D3A A;  3ZXR A;  1VRP A;  1SD0 A;  4RF8 A;  4RF9 A;  4GW0 A;  4BHL A;  2CRK A;  3B6R A;  3L2D A;  2LGS A;  3L2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...