2WHIA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate.
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
476
structure length
476
Chain Sequence
EKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 156
structure length 476
sequence length 476
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2whiA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2whiA02
4S17A 4RF8A 4GW0A 3JQ3A 4GVZA 1M15A 3L2EB 4LNKA 4RF9A 4BHLA 1SD0A 2BVCA 3FKYA 3L2EA 2CRKA 3NG0A 4LNOA 1F52A 4ACFA 1QK1A 1U6RA 4Z9MA 2WHIA 2UU7A 3ZXRA 1LGRA 4S0RA 4RF7A 2D3BA 1BG0A 3B6RA 4GVYA 1HTOA 3DRBA 4BAXA 1F1HA 1P52A 3JU6A 2OJWA 1CRKA 3JU5A 2D3CA 3DREA 4LNFA 4XYCA 2QC8A 4LNNA 5J9AA 4BG4B 1P50A 3M10A 4RF6A 4GW2A 1HTQA 2GLSA 3ZXVA 1FPYA 1QH4A 4BG4A 3L2DA 4AM1A 4HPPA 1G0WA 2J1QA 4Q2RA 1VRPA 5J99A 2LGSA 1I0EA 2D3AA 3JPZA 4LNIA 1RL9A 2WGSA
chains in the Genus database with same CATH superfamily
3Q2AC 4ZYSA 1WGKA 1PGBA 1CQVA 1JRPA 2KFKB 3LB8C 1STEA 2JSVX 1NDDA 3H9DA 3OG5A 4K3CA 2J0MA 3TBLD 1OQQA 3JU5A 1E0ZA 3KQ4A 1ZGUB 2AX5A 2Y5PA 4PYZA 3VQIA 2PJHA 5IA7A 3TJPA 1FMAD 3M63B 2LRWA 3FILB 2O6VD 4M0WB 1MHHE 4A8XC 4HXDA 3ZNGC 2WXHA 4GIVA 5EE0A 2QJLA 4ZRPA 1F1HA 1V8CA 4LNFA 1ISNA 2BB5A 4RCOA 2WNMA 5FKAC 3ZXVA 2AYOB 3B9JA 3M95A 3KVFB 1MFWA 3GS2A 1J8CA 1RL9A 2DAFA 4ARIA 1YQ3B 2NTSA 2RGFA 4IWQA 3ZJVA 2RSUA 1NEKB 2PW9A 2V4LA 3UIOB 2XEWA 5IN7A 2GBMA 3C0RB 4N58A 1P52A 2N9XA 5G2NA 3I63C 5KHOA 2L00B 1D3ZA 2VZKB 3ZDMC 3QK0A 1GNUA 3BWUD 2BS2B 4BKTA 2L05A 2FUG1 4IWPA 2JU6X 1QLBB 3B1LX 1WXMA 3W1SC 2L7RA 3DVNU 1AWDA 2LVPA 1YIWA 2PTLA 1V86A 1QH4A 4EKUA 4LNIA 4NPNA 2V4IB 5BMHA 4E74A 1JWAD 1KLGD 4LJOB 1N5XA 2N9LA 3NG0A 3L16A 4IKGA 2QCZA 4R3DA 5TSSA 4PK1A 5D94A 1SE9A 1HA5A 2FCMA 4XYCA 1KTKA 3VH3B 1OEYJ 2L8JA 1R4MB 1TT4A 3P42A 3E56A 4ZRIA 3P4RB 3JPZA 4RF8A 3ZLZA 2J7QB 5I4DA 5E6PA 3DBRI 2LVOA 2BKRB 2BYEA 1IBXB 3V60A 4PYUA 1MI0A 1NYQA 2WXFA 1JWUD 4HEA1 2FCNA 3SHQA 2QEJC 3H1UA 1NVID 4HJGE 4IWOA 4NJCA 4DBGA 4YWGG 3M3JA 4RGTA 4DHZB 2ON8A 2N7DA 3K9PB 3OWEB 3VUXA 4AJWA 3A4RA 2E6XA 2G3QB 1N5WA 1FNVA 3MC8A 3MFGA 4EZLA 1DOYA 2Z59B 1Q10A 3V6EB 1HEZE 2C7HA 4ZDVA 1VRAB 1WZ0A 2RDBC 1EO6A 4WWOA 2B3AA 2HTHA 2D07B 2MCNB 2W9NA 4WQMA 3W2DA 1AW7A 1H8CA 1I7HA 1EWYC 4N59A 4HVBA 3AEGB 3VR8B 1E8YA 4YSXB 4BOSC 3DBHB 1C77A 1E7UA 4KVGB 3IT6B 2PPHA 5GMVA 3PTFC 4A90A 4RM9A 4YTPB 5LXIB 4MJSA 1E9MA 4EFOA 3Q14C 4PS3A 2QILA 3DDCB 1VDVA 4HK2A 4ARCA 1WXAA 4P1CC 3UI3A 4DHZE 1UBIA 1ZE3D 2MBHA 2MX2A 3T3NA 1F77A 2HE7A 1M4VA 4G0NB 3D32A 5JHAA 4M8MA 3N1XC 3LN7A 1KH0A 2IJ0A 1P98A 1SE3A 2SAKA 3R8BA 4PS8A 3BYYB 3VRAB 4BBNF 1SIJA 3AU4A 3AEFB 4HLEA 3A1QA 3PPAA 1CK1A 3RD2A 2DAJA 2ONQA 4NQKE 5LLIA 2WXNA 3ZIMA 1XCTL 4MM3A 3HK0A 3A9JB 4LK0M 1TYGB 2D5GA 4P16A 1K52A 4BKSA 5JZEB 4ICVA 5IP4D 2KANA 2KN5A 2LGIA 2GI9A 2KQ7A 5G55A 1IGCA 2PLPA 1I42A 3BVZA 4W9IA 4K7WA 2WXRA 1HE8A 3PSEB 4EOYA 2WU2B 4OZCA 2AQ1B 3GZNB 3PS6A 4II3B 3IXSA 4JX1C 4GDKA 2MLBA 4KKIA 1K50A 2N4FA 2WXGA 2JXTA 3ZQ4A 1R8GA 4ZYNA 2K25A 1IYFA 4IUMB 2KFKA 5LXHA 2NCNA 1T0SC 1G6JA 1SE2A 4HWIB 3K9OB 3PZ8A 5KHQA 3DQVA 3R2IA 3EGRA 1WR1A 3AE7B 2O6VB 3DPDA 4RNAA 2LASA 3PGEA 3QX1A 1ZDVA 1GOZA 3HM3A 1S3SG 3FILA 2NPTA 4M0WA 2VH1A 3PREA 2ZCBA 1LXDA 1V1OA 1ZKHA 3AU5A 4LTUA 3DREA 1F0ZA 1R4NB 4E71A 4IM3A 2JT4B 4IM0A 1FFVA 4KSLC 1PYWD 3AE9B 3RYTA 4RGNA 5HFYA 2HTME 5EE3A 3GE3C 2M0XA 1HTOA 3I57A 2RMMA 2G45B 3ZYYX 1TY0A 3N1ZC 5FK9C 4AM1A 2M0AA 3JSVB 3C8YA 2D3AA 1XEEA 4A3PA 1SBBB 2LJIA 4FA6A 2KX0A 3WANA 1VZ8A 2DNFA 2LGXA 4DQOC 1AN8A 4XZ4A 2R2OA 2WDVB 2KOXA 3AEEB 1ZW7A 2XK5A 3MJWA 1JROA 2W3RA 3O13A 1U4AA 1YJJA 4TMAB 3VUWA 1FXAA 1MPEA 2LGYA 2WDTB 2XBBC 1P3QU 3RNCC 2BWES 1XXGA 5C1ZA 2KMAA 4FULA 1FD6A 4EZKA 2KWUB 2Z0DB 1GC6A 1C76A 2L0TA 4KZ0A 4PS7A 2N9KA 4II2B 3N3KB 2V1YA 2V9HA 1WGHA 2M8SA 4BZAA 2INNE 1SJED 1J0GA 1SSNA 5TR5A 3Q8AA 2MP2B 3V61A 3EFCA 2M1MA 1K8RB 4LLGM 3ZNID 3TEXA 2VRRB 2V3SA 4GOCA 1J7BA 4GLSC 1ZDXA 2C7NB 2K3UA 1KOTA 2HJ8A 2JF5A 5J2RA 1WM2A 2JVCA 3ZKJC 1FXTB 1ACCA 3NRZA 4ITKA 3KWVA 5CHVC 1V97A 2KC1A 1QILA 3KWLA 1V6EA 3A9KB 4CQNA 2MJEA 2KMCA 4MJSB 4REZA 3LVWA 1T0YA 2DLBA 4I6LB 2Y5CA 3OLMD 2QDFA 4AJYB 3AE1B 4ZRJA 2BVCA 4KKJA 5H8YE 2KDMA 4DDID 2ZW1A 3AEBB 3N32A 4G50A 3VTWA 3I5JC 4OVUA 1FM0D 4GGQA 2BB6A 3AEDB 3W1SA 3PVLA 2OOBB 2K1FA 3NVZA 4K7SA 4NQLB 1TS4A 2FE8A 4YXDB 3QQ8B 4DXGA 3GP7A 2L3ZA 5JH5C 4C7ZA 2ZVOA 3A1QB 4MGYE 2RDGA 2JRHA 1Z5SB 2ZZPB 3DWMA 2KD0A 1WSPA 3EA6A 1PGAA 1SXTA 3DBSA 2Y5BB 2BYTA 1FNUA 1HXYD 1T6BX 5AZHA 4LDTD 2WDRB 2KC2A 4RF7A 1JALA 4FADA 1NYRA 2KACA 3KUDB 1CMXB 1WX7A 4K81A 1CJEA 3TL5A 4GDKB 2K8CA 3QC8B 4H2AA 2K5PA 3DBRB 1UF0A 3R7RA 3ZTDA 1YQBA 2K8BA 2KTRA 4HPMB 3PLUA 2BF8B 4HPLB 2W54A 1VA6A 1UD7A 2Z0EB 2NBWB 4HJKA 3VTVA 2WHIA 1OFFA 1WGYA 1A70A 3MC0B 3DRBA 3TEZA 2BYVE 3AB5A 2GLSA 3BZDB 1UGJA 3AULA 3NVYA 3GE8C 2INDC 1G0WA 1E8XA 2H89B 3SR6A 2CJOA 2FNJB 1KF6B 3EUB2 2KLGA 1C79A 3SDLC 2NPTB 4OHJA 3AH7A 2D10A 3VFKA 2JZ3B 3RZFA 3V6CB 4AWJA 4RMAA 2CKHB 3DVGX 1ROEA 3W9CB 1F2RI 2NS5A 1TGZB 4MT5A 2X8XX 2M19A 4MSMB 4W9HA 1I4HA 3DCGA 4US8A 1PGXA 1YN3A 1E10A 1BT0A 4JQWC 3A9JA 1VR9A 3QWZB 1BXTA 3L17A 2W3SA 2L32A 2VH2A 2WS3B 2XNAC 2WXPA 3BYTB 2LUEA 3U30A 3RCZA 3LXFA 1QOBA 4IW0A 2C5LC 3PHXB 4DK5A 3IG5A 1YN5A 3L54A 3NZ3A 3HM6X 4EE2A 2XK5B 3R2TA 2NR2A 5D6JB 1FCLA 1M94A 1MG4A 4KGRA 4YTNB 1JW9D 3AECB 1GPXA 2QMTA 3AXCA 2HDEA 2LVQA 1ZOYB 1L6VA 1SGHA 4GW0A 4UDUC 3UGBB 5JXVA 4LNKA 1TJEA 1N61A 1SEBD 1VZ7A 5IOIA 2O6VA 4JWUC 3MC9A 3ZVVA 2Q5WD 1PDXA 5D3DA 1C4CA 4M02A 1P50A 2K22A 2WX1A 3ML9A 4XE0A 2NBVB 3OJ3A 4PT5A 2MSED 2ACZB 2DYMA 2PE9A 4DHJD 2EMSA 5G5GA 5DPSA 1QT9A 3ZNZB 2WXJA 1I4PA 1JWMD 3RULA 4ZHOA 2KDEB 2WXIA 3RMKC 2RDHA 2NMQA 1YD8U 5E6JA 3LDZE 2W55A 1GAQB 1GB1A 1L2NA 3T3OA 3IHPC 3B2GA 4WJPA 4W9CA 1UGMA 1FPYA 5BMIA 1TTNA 3N30A 3P4QB 1EF1A 3JSVA 2ZNVC 1TS2A 3JW0X 2MW5A 5E6OA 1V1PA 1V2YA 4HKQA 4XDCA 5D2MB 4W9KA 2EKIA 4DXFA 4HDQA 3SU8X 4MELA 1PFDA 3WALA 1C9FA 2RD0A 3H7PA 2Z8LA 3UQBA 5AEKB 2REXA 1RFAA 3AV8A 1WJUA 1VLBA 4L2YA 1XCQL 4W9DA 2LXCA 4MSQB 2N7EA 4GDLA 2WLBA 3SFDB 4FLHA 4RGOS 2Y3AA 4ICUA 1I0EA 3CIRB 1YMHE 1N62A 1LO5D 4RH6A 2IGHA 2FCSA 1C4PA 1U6RA 1DOIA 2MP2A 4C00A 4KIKA 2OJWA 3SFEB 3WAOA 1N63A 4B6WA 3X0WA 3KH0A 4CHKA 3FC4A 3C19A 2KTRB 3A33B 1Y56A 2MEKA 3AE4B 1WMHB 4TV3A 2R61A 2L76A 5G5HA 4NAMA 3IG8A 3A9KA 4D2KA 4TUUA 4A6QA 1TS3A 1GB4A 2MWSB 1Q1OA 1FEHA 2RPVA 1H4RA 3U7DA 1JRUA 2JWUA 2KQSA 4B95A 3R66C 3I3TB 1TZ1A 3MP9A 1FFUA 4W9GA 2LRUA 3Q8BA 1N60A 3Q3MC 2H88B 3TIXA 2J53A 3X23A 1F52A 1RM6C 4KX6B 2DYOA 4WWPA 1TIFA 2MBOA 1WGGA 1TKGA 4WAAA 3ZJUA 1DOXA 1WR6E 1E8WA 3CSFA 2HD5B 4US9A 1YJIA 4C4VB 2W82A 4EEWA 3ONSA 2D3GA 1WX8A 1ZP0B 2K9XA 5E6NA 3HVZA 3NVVA 3H7SA 2WP9B 2DWQA 2UYZB 1UELA 2MHJA 4Q2RA 2WGSA 4KV2A 1I4GA 2PKOA 1UWMA 3KYDD 4A3OA 4Q2JA 4I6PA 5C3JB 4YL8A 4ZOHC 1YQ4B 2JX5A 1ZXIA 2OEDA 3ZO5B 1JQ4A 3BINA 1K51A 3RFZB 4OZAA 4A20A 3NZUA 3VR9B 1WYWB 4DXAB 2MA9B 4NY0A 2ZPNA 2JYEA 2J4XA 1WJ6A 4BVUC 2CJNA 5BYQA 5HG2A 4EZJA 2MBBB 1X1MA 2KVZA 4FN2A 3KLSX 2BGFA 1L0VB 1FRDA 3T9LA 4W9LA 2KN4A 5BMGA 3RNFC 3Q8CA 1WJ4A 4YSYB 4JL9A 2KWVB 2QC8A 2MH7A 2KJ6A 2WYQA 4RF0A 2A4ZA 5DPRA 3L2DA 1SJHD 4MH0E 1F2RC 4KGSA 4DDGD 1SE4A 4JWSC 2CHXA 1QF6A 2AQ2B 3PV1A 3NVWA 4ASWC 2AQ3B 1NI3A 3VH4B 1L5PA 3DOWA 1FIQA 2EKEC 2OJRA 3ZTCA 3IG3A 3P1MA 5J9AA 1J7CA 2K6QA 3DBLB 4BG4A 2UWQA 2D32A 2KO3A 1V49A 2JPHA 4QAYA 1QOGA 2DHZA 5DCNA 2KTFA 3DBHI 3R3MA 2NTTA 4WH4A 2PIAA 1V1PB 4NAWA 4KDLB 4ANVA 4FJVB 1V5OA 4W9FA 3V62A 2XN9C 2KNBA 5J18A 4XC2A 4JE3B 2IO1B 3IAM1 4ANUA 1E8ZA 4L1BA 2WDQB 2GWCA 3H7PB 2DBYA 4GN1A 5LNK1 2BW2A 2JWZA 1GC7A 3ZDTA 3HRDD 3ZW3A 2KFJA 3N1YC 1UNSA 4GDLB 1HQRD 2E3TA 1WXQA 2YVCA 1YX6B 4MEMA 4MGZE 4P7IA 2DX5B 5CHFA 3ZJTA 2WQYB 2ZCCA 3RNAC 3U52E 1E6EB 3RZWC 2AL6A 3JVZX 3NJTA 3SD5A 5JHBA 1SD0A 2INCC 2FBWB 3RNBC 2PMVA 3U4EG 5GXGB 1RYJA 4C56C 2D3BA 4KIKB 1RWSA 1T3QA 4P6VF 2BQQA 1KJTA 1HZ5A 4XWTA 2IY1B 1D5XC 1OQRA 1KM7A 1NI2A 3UF8A 2JUOA 4S17A 4WQOB 2J0JA 3GZNI 1OQYA 1OEYA 2G4SA 2N9EB 4IM2A 4I6NB 3L2EA 2K6DB 2L52A 1Q5WB 2K39A 3QJZA 4J6IA 1NENB 3QHTA 1C3TA 2D3CA 3TEWA 3QIJA 3KUCB 1XT9B 4N9F4 2MJDA 1WZ3A 3VAWA 2X38A 3W5VB 1WY8A 1T0RC 3TCAA 1FNWA 1WWTA 2AL3A 3QA8A 1J7AA 2KJRA 3RUIB 1EM7A 4F8CB 2CRKA 3CWIA 3ABVB 3Q6BA 4WWMA 4FHKA 1P0RA 4KDIC 4P1BC 5HKHA 1E5WA 1R4NI 2C7MB 2JYTA 5AZFA 5CTRC 3EHVA 4W9EA 1IUEA 2CU3A 4LNOA 5HHDG 1SIFA 1XLPA 3I9V1 2LFIA 3ZNHB 1ET9A 2O2VA 2FUHB 1QOFA 5EDSA 4GW2A 2JY6A 2LMCA 1FXIA 1E90A 2EELA 2LD9A 2GBNA 2SEBD 1WX9A 1L4DB 1ZUD2 3Q3NC 2IZVB 1WMHA 1L6UA 4JGHB 1WXVA 2KZRA 1V9JA 4HROA 2MRPA 1T0QC 4YT0B 2WXLA 2BWFA 3VTUA 5J17A 4MACA 4LNNA 1KLVA 2FIFA 5BO4B 1CZPA 2MJ3A 1YN4A 2IYDB 1XO3A 3L4PA 3MTNB 4WJNA 1QOAA 5J99A 1SF0A 3DWGC 2K0PA 3MHSD 4E3CA 3QARA 4XGAB 2BT6A 2G9HD 2JQRB 1WGDA 2HJ1A 2KAJA 2TSSA 1P9DU 4W9JA 2KMMA 4FHJA 3VHTC 2DZJA 2GWDA 5EE9A 3BK2A 3DHGC 1MJDA 4OZBA 3LYYA 4GVZA 3V3XA 3UIPB 5C23A 1B9RA 2KKCA 1E7PB 2R2QA 3AE8B 4LJPB 3B6RA 1WFYA 4C4VA 5DPTA 1CRKA 4M00A 1WM3A 4BG4B 2D2QA 4K3BA 4M8NA 3NOBA 3RPFC 1HZ6A 1YNTE 4GSWA 4K7UA 1JWBD 2DZIA 1T5XD 2MQJA 3NZTA 4NAWB 1Z2MA 1ZPSA 2KWDA 1MHXA 1IPGA 2N1VA 4KGTA 2GBJA 4HCPB 3B0AA 2IPKD 2IBIB 1ENFA 2IO0B 2IO2B 1VJKA 1TBEA 3IFWB 2OHFA 4KZCA 4FBJB 1I4QA 1SB3C 1XD3B 1WRIA 4K1RB 4GB9A 1B1ZA 1WH3A 3IAS1 3N9YC 2ZJDA 2EMTA 2N7JA 3PRPB 3IT4B 1I4RA 1GUAB 3DHIC 1DGJA 3HVDA 4RF1A 3JQ3A 3FKYA 3LJ3A 3DHHC 3GB1A 2DYBA 1WXSA 1WJNA 5IKCM 2MBQA 4HDOA 1NBFC 1WE7A 3R7QA 4BFRA 1TKYA 2M56B 3N20C 3KUZA 2KK8A 4RF6A 2DENB 2GRIA 3NY5A 2G1EA 1TKEA 4IDIA 1RFKA 3RT3B 4TQ0A 2IY0B 3ETRA 2BYFA 4GXBA 2JXXA 4GMVA 2QIEB 3U7ZA 3L2EB 3NS8A 3AE3B 3EFUA 1C4AA 2KDBA 2KT7A 4ZHPA 2KQ4X 3L0WB 3ML8A 4EUTA 4CO7A 2FAZA 1AYFA 4O1NA 2N9PC 3B08A 3RNEC 3Q8EA 2J42A 4JLCA 3HUIA 4NJ6A 4MDKE 3ZXRA 1RAXA 1LGRA 1XQQA 2WXQA 4CYEA 4TQ1A 1LM8B 2WX0A 3FAHA 5DPWA 3HHMA 3LN6A 3VDZA 2GOWA 2WWZA 1QZEA 1P7EA 2J1QA 4XDDA 2WXMA 3E9SA 2CHWA 2WU5B 5BYSA 2M4NA 3Q3JA 4BKGA 3AE5B 2ZW0A 3BVMA 3PZ7A 2DZKA 4X57B 3IBEA 5FR3A 2J0KA 2O2VB 1BG0A 4DWFA 2BKFA 4HCNB 4A9AA 2LI5A 2WXKA 4NJ7A 1L0XB 4AOFA 1C78A 2J52A 3CSTA 3Q69A 2KYWA 4YSZB 5CHWA 4BKSD 1XLQA 2IGDA 3EECA 4B0EA 4MGKE 4AP4C 3TEYA 3EC8A 2KVRA 2ZNVB 1F9JA 4TKNA 4AS1A 4AUQC 2FIDA 3ZUNA 2L0FA 1LFDA 4RGMA 4XX5A 3U2SC 1QKZA 1BUIC 3MHZA 4JPSA 5BYRA 3RN9C 3TUOA 4NNJB 3CMMB 1QK1A 4WAFA 2LWPA 3QCAA 1RLFA 2GBRA 4KSKC 3PRMB 3AI5A 1DYQA 1WF9A 4G3XB 2JRIB 3URYA 4WIPA 4BBNC 4L23A 2ZEQA 2IDYA 2ICIA 2ASQA 3L10B 1JCKB 4OVVA 4ANWA 1WGRA 5AZGA 5MPOA 3NZSA 2KDIA 2ZPYA 1R7SA 1UWXA 2YEPF 4BHLA 4LDTB 1R4MI 1D6EC 2KDFB 4HKZE 2JZPA 3NHEB 1AARA 1IP9A 1EU3A 2BS4B 2A5UA 4BOZB 2I38A 2PE6B 4LCDE 3APDA 3M10A 1HTQA 3DVGY 4JIOU 5HI1A 3ZRFA 3Q8FA 4HPPA 2PVGC 2YLMA 3AM9A 4RF9A 1YJ1A 2I1JA 4ZRKA 1N6ZA 3KYCD 4FJYA 3J9CA 1XLNA 4NZLB 2BTEA 2I1KA 1FRRA 2KHWB 1V4GA 1VCBA 1V5TA 3PRZA 1Y8RC 3LVVA 1YX5B 1ESFA 2VZKD 3A4SC 4URKA 2MBEA 3AE6B 3ALBA 1FCCC 3AN1A 2INPE 4ACFA 3H8HA 4IG7B 2AWTA 1LQBA 3PHWB 1V81A 2YEPB 1C1YB 3V05A 1MG8A 1D5MC 2QHOA 3WCQA 1OGWA 2V0GA 3TMPB 1WIAA 3APCA 2JZZA 4F1SA 3WA0A 3B2FA 2LJ5A 3KW5B 2CS4A 3VXWA 2G4DB 1L0YB 5C2TB 4G11A 3VRBB 3UINB 4WWNA 1P7FA 1E7VA 2C9WB 4GU2A 2LEKA 3AE2B 4ZRQA 3SEBA 4OVZA 1I4XA 2BPSA 4F7ZA 2GBKA 2RR9A 3L08A 2V3NA 4AQ7A 3P4PB 3W1YA 2M17A 3UQAA 5L95C 2KXJA 1QQRA 1BMLC 3NS1A 3APFA 3PT2B 1RRBA 1FO4A 2N1WA 3BY4B 3BK1A 1L7YA 1ET6A 1L4ZB 2LZ6A 1TT5B 4B9KA 2V3PA 1KRHA 5T8IA 1OTRB 4Z9MA 4IOIE 3PLVA 4RFBA 3DVNV 2QSDA 4ANXA 5L83A 5D7GA 4C80A 4C7YA 3PO0A 3WAMA 2C60A 4DHJB 1WYGA 3P2BA 3WIMA 3ZGZA 4FXCA 1JWSD 5AUKA 1PQSA 1GG3A 3P4SB 2BS3B 1UH6A 2L1AA 4S0RA 3CF6E 3AMZA 4RM8A 5CX3A 3RNGC 3M62B 1PUTA 1ZXHA 3JU6A 4J3OD 3ZRCA 4FJZA 1IGDA 2AEHA 1WRDB 1K53A 4WJOA 2PEAA 5FR6A 3HIZA 2B76B 3VUYA 4B0MA 5AUIA 1Q0WB 2KJHB 2LHDA 2PVOD 3OAWA 1KLUD 3Q3OC 1VZ6A 4MH8A 1V80A 1IBXA 3W5UB 3GOEA 3WAPA 3QAQA 2I2YA 2LGDA 2BBCA 1EU4A 3NUHB 3ENEA 4WJQA 1JMLA 1EWCA 2D11A 1WE6A 5H92C 3IVFA 4IC7B 1WI0A 3VVWB 3H6NA 2IGGA 2LHEA 2K8HA 2UU7A 3O65B 1I35A 1UBQA 1EF5A 1UUPA 2CR5A 2GMIC 2KLCA 2FCQA 2LUMA 3Q3FA 3T8MA 3ECIA 1D4BA 2GB1A 2CHZA 2ZVNA 1VRPA 2LGSA 1TS5A 4N6EB 1P1AA 1M15A 3OJ4B 1MVKA 1XF5L 3BIID 3JYUA 4XWWA 1UZXB 4GVYA 3BVGA 1VD2A 4BAXA 2LXAA 4A55A 1J19A 2NVUI 1D5ZC 4MM3B 3P63A 2D33A 5EE1A 5D3IB 3MJ5A 3RI7C 2NBUA 2CU1A 4YTMB 3DBLI 1TZOA 3S2AA 4USAA 2RPQA 3AEAB 2KWCA 4MGIE 5IO9A 4TSSA 2WXOA 2N0SB 1EUVB 1YOVB 4WURA 4M01A 1S1QB 4HRSA 2DZMA 4OW0A 2IO3B 5IAAC 3U8ZA 1TY2A 1A5RA 1GJZA 2L83A 1XLOA 3L13A 3PZDA 1KFYB 2KX3A 3TSSA
chains in the Genus database with same CATH topology
4S17A 4RF8A 4GW0A 3JQ3A 4GVZA 1M15A 3L2EB 4LNKA 4RF9A 4BHLA 1SD0A 2BVCA 3FKYA 3L2EA 2CRKA 3NG0A 4LNOA 1F52A 4ACFA 1QK1A 1U6RA 4Z9MA 2WHIA 2UU7A 3ZXRA 1LGRA 4S0RA 4RF7A 2D3BA 1BG0A 3B6RA 4GVYA 1HTOA 3DRBA 4BAXA 1F1HA 1P52A 3JU6A 2OJWA 1CRKA 3JU5A 2D3CA 3DREA 4LNFA 4XYCA 2QC8A 4LNNA 5J9AA 4BG4B 1P50A 3M10A 4RF6A 4GW2A 1HTQA 2GLSA 3ZXVA 1FPYA 1QH4A 4BG4A 3L2DA 4AM1A 4HPPA 1G0WA 2J1QA 4Q2RA 1VRPA 5J99A 2LGSA 1I0EA 2D3AA 3JPZA 4LNIA 1RL9A 2WGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S17 A;  4RF8 A;  4GW0 A;  3JQ3 A;  4GVZ A;  1M15 A;  3L2E B;  4LNK A;  4RF9 A;  4BHL A;  1SD0 A;  2BVC A;  3FKY A;  3L2E A;  2CRK A;  3NG0 A;  4LNO A;  1F52 A;  4ACF A;  1QK1 A;  1U6R A;  4Z9M A;  2WHI A;  2UU7 A;  3ZXR A;  1LGR A;  4S0R A;  4RF7 A;  2D3B A;  1BG0 A;  3B6R A;  4GVY A;  1HTO A;  3DRB A;  4BAX A;  1F1H A;  1P52 A;  3JU6 A;  2OJW A;  1CRK A;  3JU5 A;  2D3C A;  3DRE A;  4LNF A;  4XYC A;  2QC8 A;  4LNN A;  5J9A A;  4BG4 B;  1P50 A;  3M10 A;  4RF6 A;  4GW2 A;  1HTQ A;  2GLS A;  3ZXV A;  1FPY A;  1QH4 A;  4BG4 A;  3L2D A;  4AM1 A;  4HPP A;  1G0W A;  2J1Q A;  4Q2R A;  1VRP A;  5J99 A;  2LGS A;  1I0E A;  2D3A A;  3JPZ A;  4LNI A;  1RL9 A;  2WGS A; 
#chains in the Genus database with same CATH topology
 3Q2A C;  4ZYS A;  1WGK A;  1PGB A;  1CQV A;  1JRP A;  2KFK B;  3LB8 C;  1STE A;  2JSV X;  1NDD A;  3H9D A;  3OG5 A;  4K3C A;  2J0M A;  3TBL D;  1OQQ A;  3JU5 A;  1E0Z A;  3KQ4 A;  1ZGU B;  2AX5 A;  2Y5P A;  4PYZ A;  3VQI A;  2PJH A;  5IA7 A;  3TJP A;  1FMA D;  3M63 B;  2LRW A;  3FIL B;  2O6V D;  4M0W B;  1MHH E;  4A8X C;  4HXD A;  3ZNG C;  2WXH A;  4GIV A;  5EE0 A;  2QJL A;  4ZRP A;  1F1H A;  1V8C A;  4LNF A;  1ISN A;  2BB5 A;  4RCO A;  2WNM A;  5FKA C;  3ZXV A;  2AYO B;  3B9J A;  3M95 A;  3KVF B;  1MFW A;  3GS2 A;  1J8C A;  1RL9 A;  2DAF A;  4ARI A;  1YQ3 B;  2NTS A;  2RGF A;  4IWQ A;  3ZJV A;  2RSU A;  1NEK B;  2PW9 A;  2V4L A;  3UIO B;  2XEW A;  5IN7 A;  2GBM A;  3C0R B;  4N58 A;  1P52 A;  2N9X A;  5G2N A;  3I63 C;  5KHO A;  2L00 B;  1D3Z A;  2VZK B;  3ZDM C;  3QK0 A;  1GNU A;  3BWU D;  2BS2 B;  4BKT A;  2L05 A;  2FUG 1;  4IWP A;  2JU6 X;  1QLB B;  3B1L X;  1WXM A;  3W1S C;  2L7R A;  3DVN U;  1AWD A;  2LVP A;  1YIW A;  2PTL A;  1V86 A;  1QH4 A;  4EKU A;  4LNI A;  4NPN A;  2V4I B;  5BMH A;  4E74 A;  1JWA D;  1KLG D;  4LJO B;  1N5X A;  2N9L A;  3NG0 A;  3L16 A;  4IKG A;  2QCZ A;  4R3D A;  5TSS A;  4PK1 A;  5D94 A;  1SE9 A;  1HA5 A;  2FCM A;  4XYC A;  1KTK A;  3VH3 B;  1OEY J;  2L8J A;  1R4M B;  1TT4 A;  3P42 A;  3E56 A;  4ZRI A;  3P4R B;  3JPZ A;  4RF8 A;  3ZLZ A;  2J7Q B;  5I4D A;  5E6P A;  3DBR I;  2LVO A;  2BKR B;  2BYE A;  1IBX B;  3V60 A;  4PYU A;  1MI0 A;  1NYQ A;  2WXF A;  1JWU D;  4HEA 1;  2FCN A;  3SHQ A;  2QEJ C;  3H1U A;  1NVI D;  4HJG E;  4IWO A;  4NJC A;  4DBG A;  4YWG G;  3M3J A;  4RGT A;  4DHZ B;  2ON8 A;  2N7D A;  3K9P B;  3OWE B;  3VUX A;  4AJW A;  3A4R A;  2E6X A;  2G3Q B;  1N5W A;  1FNV A;  3MC8 A;  3MFG A;  4EZL A;  1DOY A;  2Z59 B;  1Q10 A;  3V6E B;  1HEZ E;  2C7H A;  4ZDV A;  1VRA B;  1WZ0 A;  2RDB C;  1EO6 A;  4WWO A;  2B3A A;  2HTH A;  2D07 B;  2MCN B;  2W9N A;  4WQM A;  3W2D A;  1AW7 A;  1H8C A;  1I7H A;  1EWY C;  4N59 A;  4HVB A;  3AEG B;  3VR8 B;  1E8Y A;  4YSX B;  4BOS C;  3DBH B;  1C77 A;  1E7U A;  4KVG B;  3IT6 B;  2PPH A;  5GMV A;  3PTF C;  4A90 A;  4RM9 A;  4YTP B;  5LXI B;  4MJS A;  1E9M A;  4EFO A;  3Q14 C;  4PS3 A;  2QIL A;  3DDC B;  1VDV A;  4HK2 A;  4ARC A;  1WXA A;  4P1C C;  3UI3 A;  4DHZ E;  1UBI A;  1ZE3 D;  2MBH A;  2MX2 A;  3T3N A;  1F77 A;  2HE7 A;  1M4V A;  4G0N B;  3D32 A;  5JHA A;  4M8M A;  3N1X C;  3LN7 A;  1KH0 A;  2IJ0 A;  1P98 A;  1SE3 A;  2SAK A;  3R8B A;  4PS8 A;  3BYY B;  3VRA B;  4BBN F;  1SIJ A;  3AU4 A;  3AEF B;  4HLE A;  3A1Q A;  3PPA A;  1CK1 A;  3RD2 A;  2DAJ A;  2ONQ A;  4NQK E;  5LLI A;  2WXN A;  3ZIM A;  1XCT L;  4MM3 A;  3HK0 A;  3A9J B;  4LK0 M;  1TYG B;  2D5G A;  4P16 A;  1K52 A;  4BKS A;  5JZE B;  4ICV A;  5IP4 D;  2KAN A;  2KN5 A;  2LGI A;  2GI9 A;  2KQ7 A;  5G55 A;  1IGC A;  2PLP A;  1I42 A;  3BVZ A;  4W9I A;  4K7W A;  2WXR A;  1HE8 A;  3PSE B;  4EOY A;  2WU2 B;  4OZC A;  2AQ1 B;  3GZN B;  3PS6 A;  4II3 B;  3IXS A;  4JX1 C;  4GDK A;  2MLB A;  4KKI A;  1K50 A;  2N4F A;  2WXG A;  2JXT A;  3ZQ4 A;  1R8G A;  4ZYN A;  2K25 A;  1IYF A;  4IUM B;  2KFK A;  5LXH A;  2NCN A;  1T0S C;  1G6J A;  1SE2 A;  4HWI B;  3K9O B;  3PZ8 A;  5KHQ A;  3DQV A;  3R2I A;  3EGR A;  1WR1 A;  3AE7 B;  2O6V B;  3DPD A;  4RNA A;  2LAS A;  3PGE A;  3QX1 A;  1ZDV A;  1GOZ A;  3HM3 A;  1S3S G;  3FIL A;  2NPT A;  4M0W A;  2VH1 A;  3PRE A;  2ZCB A;  1LXD A;  1V1O A;  1ZKH A;  3AU5 A;  4LTU A;  3DRE A;  1F0Z A;  1R4N B;  4E71 A;  4IM3 A;  2JT4 B;  4IM0 A;  1FFV A;  4KSL C;  1PYW D;  3AE9 B;  3RYT A;  4RGN A;  5HFY A;  2HTM E;  5EE3 A;  3GE3 C;  2M0X A;  1HTO A;  3I57 A;  2RMM A;  2G45 B;  3ZYY X;  1TY0 A;  3N1Z C;  5FK9 C;  4AM1 A;  2M0A A;  3JSV B;  3C8Y A;  2D3A A;  1XEE A;  4A3P A;  1SBB B;  2LJI A;  4FA6 A;  2KX0 A;  3WAN A;  1VZ8 A;  2DNF A;  2LGX A;  4DQO C;  1AN8 A;  4XZ4 A;  2R2O A;  2WDV B;  2KOX A;  3AEE B;  1ZW7 A;  2XK5 A;  3MJW A;  1JRO A;  2W3R A;  3O13 A;  1U4A A;  1YJJ A;  4TMA B;  3VUW A;  1FXA A;  1MPE A;  2LGY A;  2WDT B;  2XBB C;  1P3Q U;  3RNC C;  2BWE S;  1XXG A;  5C1Z A;  2KMA A;  4FUL A;  1FD6 A;  4EZK A;  2KWU B;  2Z0D B;  1GC6 A;  1C76 A;  2L0T A;  4KZ0 A;  4PS7 A;  2N9K A;  4II2 B;  3N3K B;  2V1Y A;  2V9H A;  1WGH A;  2M8S A;  4BZA A;  2INN E;  1SJE D;  1J0G A;  1SSN A;  5TR5 A;  3Q8A A;  2MP2 B;  3V61 A;  3EFC A;  2M1M A;  1K8R B;  4LLG M;  3ZNI D;  3TEX A;  2VRR B;  2V3S A;  4GOC A;  1J7B A;  4GLS C;  1ZDX A;  2C7N B;  2K3U A;  1KOT A;  2HJ8 A;  2JF5 A;  5J2R A;  1WM2 A;  2JVC A;  3ZKJ C;  1FXT B;  1ACC A;  3NRZ A;  4ITK A;  3KWV A;  5CHV C;  1V97 A;  2KC1 A;  1QIL A;  3KWL A;  1V6E A;  3A9K B;  4CQN A;  2MJE A;  2KMC A;  4MJS B;  4REZ A;  3LVW A;  1T0Y A;  2DLB A;  4I6L B;  2Y5C A;  3OLM D;  2QDF A;  4AJY B;  3AE1 B;  4ZRJ A;  2BVC A;  4KKJ A;  5H8Y E;  2KDM A;  4DDI D;  2ZW1 A;  3AEB B;  3N32 A;  4G50 A;  3VTW A;  3I5J C;  4OVU A;  1FM0 D;  4GGQ A;  2BB6 A;  3AED B;  3W1S A;  3PVL A;  2OOB B;  2K1F A;  3NVZ A;  4K7S A;  4NQL B;  1TS4 A;  2FE8 A;  4YXD B;  3QQ8 B;  4DXG A;  3GP7 A;  2L3Z A;  5JH5 C;  4C7Z A;  2ZVO A;  3A1Q B;  4MGY E;  2RDG A;  2JRH A;  1Z5S B;  2ZZP B;  3DWM A;  2KD0 A;  1WSP A;  3EA6 A;  1PGA A;  1SXT A;  3DBS A;  2Y5B B;  2BYT A;  1FNU A;  1HXY D;  1T6B X;  5AZH A;  4LDT D;  2WDR B;  2KC2 A;  4RF7 A;  1JAL A;  4FAD A;  1NYR A;  2KAC A;  3KUD B;  1CMX B;  1WX7 A;  4K81 A;  1CJE A;  3TL5 A;  4GDK B;  2K8C A;  3QC8 B;  4H2A A;  2K5P A;  3DBR B;  1UF0 A;  3R7R A;  3ZTD A;  1YQB A;  2K8B A;  2KTR A;  4HPM B;  3PLU A;  2BF8 B;  4HPL B;  2W54 A;  1VA6 A;  1UD7 A;  2Z0E B;  2NBW B;  4HJK A;  3VTV A;  2WHI A;  1OFF A;  1WGY A;  1A70 A;  3MC0 B;  3DRB A;  3TEZ A;  2BYV E;  3AB5 A;  2GLS A;  3BZD B;  1UGJ A;  3AUL A;  3NVY A;  3GE8 C;  2IND C;  1G0W A;  1E8X A;  2H89 B;  3SR6 A;  2CJO A;  2FNJ B;  1KF6 B;  3EUB 2;  2KLG A;  1C79 A;  3SDL C;  2NPT B;  4OHJ A;  3AH7 A;  2D10 A;  3VFK A;  2JZ3 B;  3RZF A;  3V6C B;  4AWJ A;  4RMA A;  2CKH B;  3DVG X;  1ROE A;  3W9C B;  1F2R I;  2NS5 A;  1TGZ B;  4MT5 A;  2X8X X;  2M19 A;  4MSM B;  4W9H A;  1I4H A;  3DCG A;  4US8 A;  1PGX A;  1YN3 A;  1E10 A;  1BT0 A;  4JQW C;  3A9J A;  1VR9 A;  3QWZ B;  1BXT A;  3L17 A;  2W3S A;  2L32 A;  2VH2 A;  2WS3 B;  2XNA C;  2WXP A;  3BYT B;  2LUE A;  3U30 A;  3RCZ A;  3LXF A;  1QOB A;  4IW0 A;  2C5L C;  3PHX B;  4DK5 A;  3IG5 A;  1YN5 A;  3L54 A;  3NZ3 A;  3HM6 X;  4EE2 A;  2XK5 B;  3R2T A;  2NR2 A;  5D6J B;  1FCL A;  1M94 A;  1MG4 A;  4KGR A;  4YTN B;  1JW9 D;  3AEC B;  1GPX A;  2QMT A;  3AXC A;  2HDE A;  2LVQ A;  1ZOY B;  1L6V A;  1SGH A;  4GW0 A;  4UDU C;  3UGB B;  5JXV A;  4LNK A;  1TJE A;  1N61 A;  1SEB D;  1VZ7 A;  5IOI A;  2O6V A;  4JWU C;  3MC9 A;  3ZVV A;  2Q5W D;  1PDX A;  5D3D A;  1C4C A;  4M02 A;  1P50 A;  2K22 A;  2WX1 A;  3ML9 A;  4XE0 A;  2NBV B;  3OJ3 A;  4PT5 A;  2MSE D;  2ACZ B;  2DYM A;  2PE9 A;  4DHJ D;  2EMS A;  5G5G A;  5DPS A;  1QT9 A;  3ZNZ B;  2WXJ A;  1I4P A;  1JWM D;  3RUL A;  4ZHO A;  2KDE B;  2WXI A;  3RMK C;  2RDH A;  2NMQ A;  1YD8 U;  5E6J A;  3LDZ E;  2W55 A;  1GAQ B;  1GB1 A;  1L2N A;  3T3O A;  3IHP C;  3B2G A;  4WJP A;  4W9C A;  1UGM A;  1FPY A;  5BMI A;  1TTN A;  3N30 A;  3P4Q B;  1EF1 A;  3JSV A;  2ZNV C;  1TS2 A;  3JW0 X;  2MW5 A;  5E6O A;  1V1P A;  1V2Y A;  4HKQ A;  4XDC A;  5D2M B;  4W9K A;  2EKI A;  4DXF A;  4HDQ A;  3SU8 X;  4MEL A;  1PFD A;  3WAL A;  1C9F A;  2RD0 A;  3H7P A;  2Z8L A;  3UQB A;  5AEK B;  2REX A;  1RFA A;  3AV8 A;  1WJU A;  1VLB A;  4L2Y A;  1XCQ L;  4W9D A;  2LXC A;  4MSQ B;  2N7E A;  4GDL A;  2WLB A;  3SFD B;  4FLH A;  4RGO S;  2Y3A A;  4ICU A;  1I0E A;  3CIR B;  1YMH E;  1N62 A;  1LO5 D;  4RH6 A;  2IGH A;  2FCS A;  1C4P A;  1U6R A;  1DOI A;  2MP2 A;  4C00 A;  4KIK A;  2OJW A;  3SFE B;  3WAO A;  1N63 A;  4B6W A;  3X0W A;  3KH0 A;  4CHK A;  3FC4 A;  3C19 A;  2KTR B;  3A33 B;  1Y56 A;  2MEK A;  3AE4 B;  1WMH B;  4TV3 A;  2R61 A;  2L76 A;  5G5H A;  4NAM A;  3IG8 A;  3A9K A;  4D2K A;  4TUU A;  4A6Q A;  1TS3 A;  1GB4 A;  2MWS B;  1Q1O A;  1FEH A;  2RPV A;  1H4R A;  3U7D A;  1JRU A;  2JWU A;  2KQS A;  4B95 A;  3R66 C;  3I3T B;  1TZ1 A;  3MP9 A;  1FFU A;  4W9G A;  2LRU A;  3Q8B A;  1N60 A;  3Q3M C;  2H88 B;  3TIX A;  2J53 A;  3X23 A;  1F52 A;  1RM6 C;  4KX6 B;  2DYO A;  4WWP A;  1TIF A;  2MBO A;  1WGG A;  1TKG A;  4WAA A;  3ZJU A;  1DOX A;  1WR6 E;  1E8W A;  3CSF A;  2HD5 B;  4US9 A;  1YJI A;  4C4V B;  2W82 A;  4EEW A;  3ONS A;  2D3G A;  1WX8 A;  1ZP0 B;  2K9X A;  5E6N A;  3HVZ A;  3NVV A;  3H7S A;  2WP9 B;  2DWQ A;  2UYZ B;  1UEL A;  2MHJ A;  4Q2R A;  2WGS A;  4KV2 A;  1I4G A;  2PKO A;  1UWM A;  3KYD D;  4A3O A;  4Q2J A;  4I6P A;  5C3J B;  4YL8 A;  4ZOH C;  1YQ4 B;  2JX5 A;  1ZXI A;  2OED A;  3ZO5 B;  1JQ4 A;  3BIN A;  1K51 A;  3RFZ B;  4OZA A;  4A20 A;  3NZU A;  3VR9 B;  1WYW B;  4DXA B;  2MA9 B;  4NY0 A;  2ZPN A;  2JYE A;  2J4X A;  1WJ6 A;  4BVU C;  2CJN A;  5BYQ A;  5HG2 A;  4EZJ A;  2MBB B;  1X1M A;  2KVZ A;  4FN2 A;  3KLS X;  2BGF A;  1L0V B;  1FRD A;  3T9L A;  4W9L A;  2KN4 A;  5BMG A;  3RNF C;  3Q8C A;  1WJ4 A;  4YSY B;  4JL9 A;  2KWV B;  2QC8 A;  2MH7 A;  2KJ6 A;  2WYQ A;  4RF0 A;  2A4Z A;  5DPR A;  3L2D A;  1SJH D;  4MH0 E;  1F2R C;  4KGS A;  4DDG D;  1SE4 A;  4JWS C;  2CHX A;  1QF6 A;  2AQ2 B;  3PV1 A;  3NVW A;  4ASW C;  2AQ3 B;  1NI3 A;  3VH4 B;  1L5P A;  3DOW A;  1FIQ A;  2EKE C;  2OJR A;  3ZTC A;  3IG3 A;  3P1M A;  5J9A A;  1J7C A;  2K6Q A;  3DBL B;  4BG4 A;  2UWQ A;  2D32 A;  2KO3 A;  1V49 A;  2JPH A;  4QAY A;  1QOG A;  2DHZ A;  5DCN A;  2KTF A;  3DBH I;  3R3M A;  2NTT A;  4WH4 A;  2PIA A;  1V1P B;  4NAW A;  4KDL B;  4ANV A;  4FJV B;  1V5O A;  4W9F A;  3V62 A;  2XN9 C;  2KNB A;  5J18 A;  4XC2 A;  4JE3 B;  2IO1 B;  3IAM 1;  4ANU A;  1E8Z A;  4L1B A;  2WDQ B;  2GWC A;  3H7P B;  2DBY A;  4GN1 A;  5LNK 1;  2BW2 A;  2JWZ A;  1GC7 A;  3ZDT A;  3HRD D;  3ZW3 A;  2KFJ A;  3N1Y C;  1UNS A;  4GDL B;  1HQR D;  2E3T A;  1WXQ A;  2YVC A;  1YX6 B;  4MEM A;  4MGZ E;  4P7I A;  2DX5 B;  5CHF A;  3ZJT A;  2WQY B;  2ZCC A;  3RNA C;  3U52 E;  1E6E B;  3RZW C;  2AL6 A;  3JVZ X;  3NJT A;  3SD5 A;  5JHB A;  1SD0 A;  2INC C;  2FBW B;  3RNB C;  2PMV A;  3U4E G;  5GXG B;  1RYJ A;  4C56 C;  2D3B A;  4KIK B;  1RWS A;  1T3Q A;  4P6V F;  2BQQ A;  1KJT A;  1HZ5 A;  4XWT A;  2IY1 B;  1D5X C;  1OQR A;  1KM7 A;  1NI2 A;  3UF8 A;  2JUO A;  4S17 A;  4WQO B;  2J0J A;  3GZN I;  1OQY A;  1OEY A;  2G4S A;  2N9E B;  4IM2 A;  4I6N B;  3L2E A;  2K6D B;  2L52 A;  1Q5W B;  2K39 A;  3QJZ A;  4J6I A;  1NEN B;  3QHT A;  1C3T A;  2D3C A;  3TEW A;  3QIJ A;  3KUC B;  1XT9 B;  4N9F 4;  2MJD A;  1WZ3 A;  3VAW A;  2X38 A;  3W5V B;  1WY8 A;  1T0R C;  3TCA A;  1FNW A;  1WWT A;  2AL3 A;  3QA8 A;  1J7A A;  2KJR A;  3RUI B;  1EM7 A;  4F8C B;  2CRK A;  3CWI A;  3ABV B;  3Q6B A;  4WWM A;  4FHK A;  1P0R A;  4KDI C;  4P1B C;  5HKH A;  1E5W A;  1R4N I;  2C7M B;  2JYT A;  5AZF A;  5CTR C;  3EHV A;  4W9E A;  1IUE A;  2CU3 A;  4LNO A;  5HHD G;  1SIF A;  1XLP A;  3I9V 1;  2LFI A;  3ZNH B;  1ET9 A;  2O2V A;  2FUH B;  1QOF A;  5EDS A;  4GW2 A;  2JY6 A;  2LMC A;  1FXI A;  1E90 A;  2EEL A;  2LD9 A;  2GBN A;  2SEB D;  1WX9 A;  1L4D B;  1ZUD 2;  3Q3N C;  2IZV B;  1WMH A;  1L6U A;  4JGH B;  1WXV A;  2KZR A;  1V9J A;  4HRO A;  2MRP A;  1T0Q C;  4YT0 B;  2WXL A;  2BWF A;  3VTU A;  5J17 A;  4MAC A;  4LNN A;  1KLV A;  2FIF A;  5BO4 B;  1CZP A;  2MJ3 A;  1YN4 A;  2IYD B;  1XO3 A;  3L4P A;  3MTN B;  4WJN A;  1QOA A;  5J99 A;  1SF0 A;  3DWG C;  2K0P A;  3MHS D;  4E3C A;  3QAR A;  4XGA B;  2BT6 A;  2G9H D;  2JQR B;  1WGD A;  2HJ1 A;  2KAJ A;  2TSS A;  1P9D U;  4W9J A;  2KMM A;  4FHJ A;  3VHT C;  2DZJ A;  2GWD A;  5EE9 A;  3BK2 A;  3DHG C;  1MJD A;  4OZB A;  3LYY A;  4GVZ A;  3V3X A;  3UIP B;  5C23 A;  1B9R A;  2KKC A;  1E7P B;  2R2Q A;  3AE8 B;  4LJP B;  3B6R A;  1WFY A;  4C4V A;  5DPT A;  1CRK A;  4M00 A;  1WM3 A;  4BG4 B;  2D2Q A;  4K3B A;  4M8N A;  3NOB A;  3RPF C;  1HZ6 A;  1YNT E;  4GSW A;  4K7U A;  1JWB D;  2DZI A;  1T5X D;  2MQJ A;  3NZT A;  4NAW B;  1Z2M A;  1ZPS A;  2KWD A;  1MHX A;  1IPG A;  2N1V A;  4KGT A;  2GBJ A;  4HCP B;  3B0A A;  2IPK D;  2IBI B;  1ENF A;  2IO0 B;  2IO2 B;  1VJK A;  1TBE A;  3IFW B;  2OHF A;  4KZC A;  4FBJ B;  1I4Q A;  1SB3 C;  1XD3 B;  1WRI A;  4K1R B;  4GB9 A;  1B1Z A;  1WH3 A;  3IAS 1;  3N9Y C;  2ZJD A;  2EMT A;  2N7J A;  3PRP B;  3IT4 B;  1I4R A;  1GUA B;  3DHI C;  1DGJ A;  3HVD A;  4RF1 A;  3JQ3 A;  3FKY A;  3LJ3 A;  3DHH C;  3GB1 A;  2DYB A;  1WXS A;  1WJN A;  5IKC M;  2MBQ A;  4HDO A;  1NBF C;  1WE7 A;  3R7Q A;  4BFR A;  1TKY A;  2M56 B;  3N20 C;  3KUZ A;  2KK8 A;  4RF6 A;  2DEN B;  2GRI A;  3NY5 A;  2G1E A;  1TKE A;  4IDI A;  1RFK A;  3RT3 B;  4TQ0 A;  2IY0 B;  3ETR A;  2BYF A;  4GXB A;  2JXX A;  4GMV A;  2QIE B;  3U7Z A;  3L2E B;  3NS8 A;  3AE3 B;  3EFU A;  1C4A A;  2KDB A;  2KT7 A;  4ZHP A;  2KQ4 X;  3L0W B;  3ML8 A;  4EUT A;  4CO7 A;  2FAZ A;  1AYF A;  4O1N A;  2N9P C;  3B08 A;  3RNE C;  3Q8E A;  2J42 A;  4JLC A;  3HUI A;  4NJ6 A;  4MDK E;  3ZXR A;  1RAX A;  1LGR A;  1XQQ A;  2WXQ A;  4CYE A;  4TQ1 A;  1LM8 B;  2WX0 A;  3FAH A;  5DPW A;  3HHM A;  3LN6 A;  3VDZ A;  2GOW A;  2WWZ A;  1QZE A;  1P7E A;  2J1Q A;  4XDD A;  2WXM A;  3E9S A;  2CHW A;  2WU5 B;  5BYS A;  2M4N A;  3Q3J A;  4BKG A;  3AE5 B;  2ZW0 A;  3BVM A;  3PZ7 A;  2DZK A;  4X57 B;  3IBE A;  5FR3 A;  2J0K A;  2O2V B;  1BG0 A;  4DWF A;  2BKF A;  4HCN B;  4A9A A;  2LI5 A;  2WXK A;  4NJ7 A;  1L0X B;  4AOF A;  1C78 A;  2J52 A;  3CST A;  3Q69 A;  2KYW A;  4YSZ B;  5CHW A;  4BKS D;  1XLQ A;  2IGD A;  3EEC A;  4B0E A;  4MGK E;  4AP4 C;  3TEY A;  3EC8 A;  2KVR A;  2ZNV B;  1F9J A;  4TKN A;  4AS1 A;  4AUQ C;  2FID A;  3ZUN A;  2L0F A;  1LFD A;  4RGM A;  4XX5 A;  3U2S C;  1QKZ A;  1BUI C;  3MHZ A;  4JPS A;  5BYR A;  3RN9 C;  3TUO A;  4NNJ B;  3CMM B;  1QK1 A;  4WAF A;  2LWP A;  3QCA A;  1RLF A;  2GBR A;  4KSK C;  3PRM B;  3AI5 A;  1DYQ A;  1WF9 A;  4G3X B;  2JRI B;  3URY A;  4WIP A;  4BBN C;  4L23 A;  2ZEQ A;  2IDY A;  2ICI A;  2ASQ A;  3L10 B;  1JCK B;  4OVV A;  4ANW A;  1WGR A;  5AZG A;  5MPO A;  3NZS A;  2KDI A;  2ZPY A;  1R7S A;  1UWX A;  2YEP F;  4BHL A;  4LDT B;  1R4M I;  1D6E C;  2KDF B;  4HKZ E;  2JZP A;  3NHE B;  1AAR A;  1IP9 A;  1EU3 A;  2BS4 B;  2A5U A;  4BOZ B;  2I38 A;  2PE6 B;  4LCD E;  3APD A;  3M10 A;  1HTQ A;  3DVG Y;  4JIO U;  5HI1 A;  3ZRF A;  3Q8F A;  4HPP A;  2PVG C;  2YLM A;  3AM9 A;  4RF9 A;  1YJ1 A;  2I1J A;  4ZRK A;  1N6Z A;  3KYC D;  4FJY A;  3J9C A;  1XLN A;  4NZL B;  2BTE A;  2I1K A;  1FRR A;  2KHW B;  1V4G A;  1VCB A;  1V5T A;  3PRZ A;  1Y8R C;  3LVV A;  1YX5 B;  1ESF A;  2VZK D;  3A4S C;  4URK A;  2MBE A;  3AE6 B;  3ALB A;  1FCC C;  3AN1 A;  2INP E;  4ACF A;  3H8H A;  4IG7 B;  2AWT A;  1LQB A;  3PHW B;  1V81 A;  2YEP B;  1C1Y B;  3V05 A;  1MG8 A;  1D5M C;  2QHO A;  3WCQ A;  1OGW A;  2V0G A;  3TMP B;  1WIA A;  3APC A;  2JZZ A;  4F1S A;  3WA0 A;  3B2F A;  2LJ5 A;  3KW5 B;  2CS4 A;  3VXW A;  2G4D B;  1L0Y B;  5C2T B;  4G11 A;  3VRB B;  3UIN B;  4WWN A;  1P7F A;  1E7V A;  2C9W B;  4GU2 A;  2LEK A;  3AE2 B;  4ZRQ A;  3SEB A;  4OVZ A;  1I4X A;  2BPS A;  4F7Z A;  2GBK A;  2RR9 A;  3L08 A;  2V3N A;  4AQ7 A;  3P4P B;  3W1Y A;  2M17 A;  3UQA A;  5L95 C;  2KXJ A;  1QQR A;  1BML C;  3NS1 A;  3APF A;  3PT2 B;  1RRB A;  1FO4 A;  2N1W A;  3BY4 B;  3BK1 A;  1L7Y A;  1ET6 A;  1L4Z B;  2LZ6 A;  1TT5 B;  4B9K A;  2V3P A;  1KRH A;  5T8I A;  1OTR B;  4Z9M A;  4IOI E;  3PLV A;  4RFB A;  3DVN V;  2QSD A;  4ANX A;  5L83 A;  5D7G A;  4C80 A;  4C7Y A;  3PO0 A;  3WAM A;  2C60 A;  4DHJ B;  1WYG A;  3P2B A;  3WIM A;  3ZGZ A;  4FXC A;  1JWS D;  5AUK A;  1PQS A;  1GG3 A;  3P4S B;  2BS3 B;  1UH6 A;  2L1A A;  4S0R A;  3CF6 E;  3AMZ A;  4RM8 A;  5CX3 A;  3RNG C;  3M62 B;  1PUT A;  1ZXH A;  3JU6 A;  4J3O D;  3ZRC A;  4FJZ A;  1IGD A;  2AEH A;  1WRD B;  1K53 A;  4WJO A;  2PEA A;  5FR6 A;  3HIZ A;  2B76 B;  3VUY A;  4B0M A;  5AUI A;  1Q0W B;  2KJH B;  2LHD A;  2PVO D;  3OAW A;  1KLU D;  3Q3O C;  1VZ6 A;  4MH8 A;  1V80 A;  1IBX A;  3W5U B;  3GOE A;  3WAP A;  3QAQ A;  2I2Y A;  2LGD A;  2BBC A;  1EU4 A;  3NUH B;  3ENE A;  4WJQ A;  1JML A;  1EWC A;  2D11 A;  1WE6 A;  5H92 C;  3IVF A;  4IC7 B;  1WI0 A;  3VVW B;  3H6N A;  2IGG A;  2LHE A;  2K8H A;  2UU7 A;  3O65 B;  1I35 A;  1UBQ A;  1EF5 A;  1UUP A;  2CR5 A;  2GMI C;  2KLC A;  2FCQ A;  2LUM A;  3Q3F A;  3T8M A;  3ECI A;  1D4B A;  2GB1 A;  2CHZ A;  2ZVN A;  1VRP A;  2LGS A;  1TS5 A;  4N6E B;  1P1A A;  1M15 A;  3OJ4 B;  1MVK A;  1XF5 L;  3BII D;  3JYU A;  4XWW A;  1UZX B;  4GVY A;  3BVG A;  1VD2 A;  4BAX A;  2LXA A;  4A55 A;  1J19 A;  2NVU I;  1D5Z C;  4MM3 B;  3P63 A;  2D33 A;  5EE1 A;  5D3I B;  3MJ5 A;  3RI7 C;  2NBU A;  2CU1 A;  4YTM B;  3DBL I;  1TZO A;  3S2A A;  4USA A;  2RPQ A;  3AEA B;  2KWC A;  4MGI E;  5IO9 A;  4TSS A;  2WXO A;  2N0S B;  1EUV B;  1YOV B;  4WUR A;  4M01 A;  1S1Q B;  4HRS A;  2DZM A;  4OW0 A;  2IO3 B;  5IAA C;  3U8Z A;  1TY2 A;  1A5R A;  1GJZ A;  2L83 A;  1XLO A;  3L13 A;  3PZD A;  1KFY B;  2KX3 A;  3TSS A; 
#chains in the Genus database with same CATH homology
 4S17 A;  4RF8 A;  4GW0 A;  3JQ3 A;  4GVZ A;  1M15 A;  3L2E B;  4LNK A;  4RF9 A;  4BHL A;  1SD0 A;  2BVC A;  3FKY A;  3L2E A;  2CRK A;  3NG0 A;  4LNO A;  1F52 A;  4ACF A;  1QK1 A;  1U6R A;  4Z9M A;  2WHI A;  2UU7 A;  3ZXR A;  1LGR A;  4S0R A;  4RF7 A;  2D3B A;  1BG0 A;  3B6R A;  4GVY A;  1HTO A;  3DRB A;  4BAX A;  1F1H A;  1P52 A;  3JU6 A;  2OJW A;  1CRK A;  3JU5 A;  2D3C A;  3DRE A;  4LNF A;  4XYC A;  2QC8 A;  4LNN A;  5J9A A;  4BG4 B;  1P50 A;  3M10 A;  4RF6 A;  4GW2 A;  1HTQ A;  2GLS A;  3ZXV A;  1FPY A;  1QH4 A;  4BG4 A;  3L2D A;  4AM1 A;  4HPP A;  1G0W A;  2J1Q A;  4Q2R A;  1VRP A;  5J99 A;  2LGS A;  1I0E A;  2D3A A;  3JPZ A;  4LNI A;  1RL9 A;  2WGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...