2WHIA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate.
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
476
structure length
476
Chain Sequence
EKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 156
structure length 476
sequence length 476
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2whiA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2whiA02
3ZXRA 2UU7A 4RF6A 3L2EB 2D3BA 2CRKA 4HPPA 3B6RA 2QC8A 1QK1A 3ZXVA 4BAXA 3DREA 3JU5A 4GVZA 2WGSA 2J1QA 1HTQA 4LNKA 3M10A 3NG0A 1I0EA 1P52A 2BVCA 3L2DA 3L2EA 1BG0A 5J9AA 4AM1A 2D3AA 1QH4A 4LNOA 4GW2A 4S0RA 1CRKA 4GW0A 4BG4B 2LGSA 4GVYA 2D3CA 4RF8A 4RF7A 4Z9MA 3DRBA 1U6RA 4Q2RA 1M15A 4LNIA 3JU6A 4XYCA 1G0WA 2GLSA 1VRPA 1LGRA 4BG4A 1F52A 3JPZA 3JQ3A 4RF9A 4ACFA 4BHLA 4LNFA 2OJWA 5J99A 1HTOA 1FPYA 1SD0A 1RL9A 4S17A 4LNNA 2WHIA 3FKYA 1F1HA 1P50A
chains in the Genus database with same CATH superfamily
2GB1A 3L54A 1EU4A 1Q5WB 3M3JA 2L7RA 3BVGA 4AJWA 2FE8A 1HXYD 3CSFA 3ECIA 2ZCBA 4M00A 4LCDE 3R66C 2X38A 4TUUA 3TEZA 3W1SA 2IZVB 1YMHE 4M8MA 2KQ4X 1P9DU 3URYA 1FXIA 4E74A 1UWXA 2QCZA 3Q69A 2D2QA 1WGKA 4O1NA 3KW5B 1ZPSA 4IM2A 1BXTA 1IGCA 1R4MB 3VH4B 4I6LB 1QKZA 3SFDB 3A9KB 1GB1A 4OHJA 1K53A 3PREA 3RNCC 2L32A 4N58A 2AL3A 3ENEA 3ZUNA 2NS5A 2L76A 1TYGB 4JQWC 2IGDA 3RD2A 1NBFC 3KLSX 2WGSA 3LVWA 3AEGB 4NAWA 4W9KA 5CHVC 4MGIE 5LNK1 4MH8A 4ZRQA 1QH4A 2UWQA 1C78A 2LGDA 2J0MA 2HE7A 1WMHB 1RFKA 3VVWB 1YX5B 4II2B 4IDIA 3ZKJC 4W9FA 2KQ7A 3VDZA 4BHLA 1YQBA 4RF1A 2KWUB 3DVNU 3A9JA 2NMQA 2KX3A 5IKCM 3NZTA 2FIDA 1JRPA 2BF8B 4TQ1A 1QZEA 1F0ZA 4HCNB 2JYTA 2N9PC 1ZKHA 3MJWA 4W9GA 2M8SA 3JPZA 3LN6A 3DQVA 2NPTB 1ZE3D 1YIWA 3ZVVA 1WX7A 1XCQL 3PO0A 1KRHA 4KGRA 1XF5L 1QILA 1WE7A 1ZUD2 2FCNA 3VH3B 2MEKA 5D3IB 1WX9A 2E6XA 2W3RA 3PZDA 4DK5A 1HTQA 4DHJD 2KDIA 2PPHA 2V4IB 5G2NA 2KDEB 2M17A 3H7SA 2BGFA 2Q5WD 2INNE 5AUKA 1WMHA 2G3QB 1S1QB 3RNEC 1DOYA 4US9A 3DCGA 1EUVB 2MA9B 2OOBB 4KZCA 2BYTA 2D32A 1V81A 1WJUA 1D5XC 2MBBB 4XZ4A 4BKTA 2E3TA 4ZHOA 4KZ0A 2ZCCA 1B9RA 1WXVA 1L2NA 5CTRC 2PE6B 1XCTL 4KV2A 4MH0E 2Y3AA 3V6CB 3UGBB 1M15A 4RGTA 1C4CA 1LXDA 2DBYA 1V49A 1ZDXA 3B08A 1I35A 1QOAA 2NPTA 4WQMA 1UGMA 4FJVB 1C77A 4JL9A 2MJDA 3AU4A 3AM9A 1PYWD 3H7PA 5HHDG 2BYFA 2AYOB 1I42A 1HZ6A 1ISNA 2LI5A 4K7UA 5C2TB 4IWPA 3EECA 2MHJA 1SD0A 2PVOD 1YX6B 2D33A 3RT3B 2RMMA 3T3NA 4URKA 4ZRJA 4RH6A 4G0NB 5E6NA 2QC8A 3RCZA 2JPHA 3QJZA 1JCKB 5GMVA 1SF0A 1I0EA 2VZKB 2JRIB 2QSDA 4DHZB 1TS4A 3TEYA 1WGDA 2KMAA 4W9CA 2DLBA 4MSMB 4WURA 3L08A 4NJCA 2LXAA 4YSZB 3DVNV 5L83A 4LDTB 3GS2A 1AYFA 1T0YA 3B0AA 3AE5B 5AZHA 1GB4A 5BYRA 5IP4D 2KVRA 2WWZA 3AEBB 2MSED 1HZ5A 1V5TA 2MCNB 4FHJA 4IUMB 1U6RA 2G4DB 4C80A 5E6JA 4WWNA 4DXFA 4YL8A 4BKSD 3AH7A 2MBEA 4EOYA 2K8BA 4OZBA 2WX1A 3Q8BA 2ZJDA 3WAMA 1SSNA 2CHZA 3ZNID 2BPSA 2DYMA 4LJOB 3SFEB 4HLEA 4W9EA 3KH0A 2WXNA 3W1SC 2BYEA 1E9MA 1TS5A 5C23A 4EE2A 3GP7A 3WCQA 3UQBA 2K25A 2JQRB 4ANUA 2CRKA 1I4GA 1TS2A 1V1PB 2MX2A 4LNOA 1QOBA 3R2TA 4HKZE 4RGNA 1P7EA 3IAS1 2NCNA 2J42A 1LGRA 1TKEA 3DOWA 1OQQA 2FCQA 3AE6B 2YEPF 1FIQA 1WGYA 1CQVA 4BAXA 3EHVA 1BT0A 1KF6B 3TIXA 2FNJB 4NJ7A 4HJKA 1VCBA 1WM2A 1MG4A 2L52A 2I2YA 2IY1B 4P6VF 3PTFC 4TKNA 3LB8C 1UELA 2JZPA 1KLVA 2DX5B 2AL6A 3GE8C 3QA8A 1JW9D 2UYZB 1M94A 1C76A 4HPLB 3GE3C 1FNVA 3BVZA 1V1PA 4BKGA 2BWES 3LDZE 4OVUA 5AEKB 2IPKD 1VDVA 1V6EA 4ARCA 1RL9A 4WIPA 4RCOA 4ZYSA 4K1RB 2J7QB 1EWCA 1ZP0B 2JT4B 4WJNA 3BYTB 2FCSA 1RAXA 2JZ3B 1AWDA 1GUAB 3H1UA 4GIVA 2V1YA 3RZFA 2EMTA 4BG4B 2Y5BB 3C0RB 3RZWC 4EZJA 5FR3A 3QX1A 4HWIB 3NS1A 2DZMA 1TIFA 3H8HA 2M0XA 3X23A 4LNNA 3U2SC 3K9OB 4YWGG 2JUOA 1L6UA 1OFFA 4R3DA 5HFYA 1J7BA 2KLGA 1L4DB 1IBXB 1TT4A 2B3AA 1BG0A 2FCMA 3RN9C 3RUIB 2GBRA 3W5VB 4LNIA 4GOCA 4FA6A 2WXKA 4GDLB 2V3SA 4F7ZA 3AE9B 1WH3A 1RWSA 2PE9A 3BWUD 3NUHB 4W9HA 4A6QA 4EFOA 1L4ZB 2ON8A 2JZZA 4OVZA 3TL5A 2L8JA 2CKHB 2EKEC 3SD5A 4I6PA 1Z5SB 1M4VA 2MQJA 4AWJA 3DBLI 2K22A 2AQ2B 2VH2A 1VD2A 4L23A 2HJ1A 4S17A 3L4PA 1E7UA 4FHKA 1FCLA 4JWUC 3ETRA 3KUZA 4C00A 3AE7B 1QK1A 3ML8A 3UIPB 2LHEA 4DXAB 4ZHPA 5C1ZA 4HXDA 2ZVOA 3GZNI 1IBXA 1QOFA 2I1JA 5IN7A 4BVUC 3KVFB 2KX0A 3PS6A 1E7PB 2FBWB 3QQ8B 1FRRA 2OHFA 3AEFB 4GDLA 1JALA 3APCA 4F1SA 2K5PA 1UF0A 1FMAD 1SGHA 1YJIA 2MW5A 1T0QC 2WXOA 2K1FA 3AE2B 1UH6A 1XEEA 2A5UA 1TZ1A 3ZNHB 1E8YA 1J7CA 2D07B 3HK0A 1K52A 2L05A 2KYWA 2KN5A 1YN3A 1YN5A 4FJZA 2MLBA 1UNSA 4JPSA 1D5MC 3RPFC 1CZPA 4A3OA 3K9PB 4HJGE 2L0FA 3QARA 5D6JB 2ZPNA 1E8XA 3AE4B 3ZJVA 2V0GA 3NVWA 3WIMA 1K8RB 1F52A 2G45B 3PT2B 1WYWB 1E8ZA 2HJ8A 2BB6A 1OGWA 1AN8A 1L0VB 1WZ3A 4BKSA 3LYYA 1TS3A 3WALA 1GC7A 4B6WA 3ZDTA 1D5ZC 2KMCA 1D6EC 4GLSC 5FKAC 3BK1A 4P1CC 4OW0A 4FN2A 2V3NA 3IT4B 1H4RA 1FCCC 2DZJA 1T3QA 5G55A 2KHWB 4J6IA 4QAYA 1Y8RC 4NY0A 1D3ZA 1N62A 1YQ3B 1N5WA 1RRBA 4W9LA 2JYEA 1SE9A 1ET9A 1OEYJ 2PTLA 2QHOA 2N1VA 1J7AA 3DDCB 1I7HA 2M0AA 2KJHB 3UQAA 3D32A 3ML9A 2GWDA 2XN9C 2CJOA 4XYCA 4EKUA 1L5PA 5J99A 1L0XB 3BIID 4IWOA 3Q3MC 1WZ0A 1PFDA 3NRZA 5G5GA 4BBNC 4NAWB 4XX5A 1WFYA 5D7GA 1N6ZA 3JYUA 3PGEA 1ZXHA 1FD6A 2NTSA 3RNFC 4Z9MA 2DWQA 2JF5A 1UGJA 1VR9A 3A9JB 1E6EB 3AEDB 3ZQ4A 1XLNA 2WQYB 5AZGA 1P0RA 2WP9B 2ZZPB 3SDLC 1VA6A 2I38A 5FR6A 1EO6A 1P3QU 4IWQA 2MJEA 2K8HA 1SJHD 3IG8A 4N59A 1GJZA 3VR8B 4GVYA 4FBJB 2XBBC 4ACFA 2IY0B 3DVGX 3Q3FA 4LNFA 4RMAA 2EELA 2IBIB 4XC2A 1R4NI 3M63B 2O6VD 2N7DA 3P1MA 1C1YB 5DCNA 3IFWB 2W82A 2M19A 4DWFA 1CRKA 3RNGC 3N20C 2DYBA 1YD8U 3HRDD 1VZ7A 3VRBB 1P50A 1XLPA 4AUQC 2ZEQA 3B6RA 5DPRA 2FIFA 3LVVA 4LK0M 3M10A 2BVCA 2LVOA 3LN7A 4XWTA 5E6PA 3ZW3A 4LTUA 2JXXA 3O65B 5EE3A 2RR9A 2K3UA 2BBCA 4KVGB 4NNJB 2L3ZA 3VHTC 2Z59B 4XGAB 3IBEA 4EEWA 3ZO5B 2O2VA 3V61A 3T8MA 3DWGC 1UZXB 4K3CA 4HPMB 3B2FA 3QIJA 4KGTA 3H7PB 1HA5A 3V60A 3EFUA 1WR6E 2RD0A 4GMVA 4ANWA 1LO5D 4WAFA 3RYTA 2GI9A 5CX3A 1HE8A 2KDFB 4GXBA 3T3OA 5DPWA 3ALBA 4L2YA 4RGMA 1P98A 2Z0EB 2RDGA 1WE6A 1TTNA 2K6QA 2WXGA 3NS8A 3HM6X 5KHOA 1LFDA 1EM7A 2KANA 4BFRA 5T8IA 1ROEA 3O13A 4L1BA 1EF5A 1QF6A 1TGZB 2KJRA 4ARIA 1UWMA 2N1WA 3H9DA 1WJ4A 4JGHB 5J18A 2KLCA 2KN4A 3OLMD 2GLSA 5DPSA 2LEKA 3WANA 2ZVNA 3Q14C 4YSYB 1YJ1A 4RF6A 2N0SB 1V86A 1GNUA 3NHEB 1UD7A 3SU8X 2LGIA 5L95C 2GOWA 3RULA 4ASWC 1SEBD 1TY0A 3OAWA 3PLVA 1HQRD 3U8ZA 2RGFA 2J52A 2L0TA 4FJYA 2QIEB 1VLBA 4DDID 3CSTA 1Q10A 3R7QA 4C56C 1PGAA 4MM3B 1FFUA 2CJNA 1KTKA 4CQNA 1Y56A 3FC4A 4PT5A 1JWSD 2CU1A 1YOVB 1SJED 2XNAC 5EE0A 1V97A 2GBMA 2XEWA 3Q3JA 3AV8A 4YTMB 4D2KA 5TSSA 1L0YB 1QQRA 3AI5A 5HG2A 2MJ3A 3NOBA 3P63A 4JX1C 1SE2A 3PLUA 1V5OA 3IVFA 4FULA 1F2RI 2LGXA 3ZNGC 5BYSA 1NI3A 1TJEA 3Q3NC 1STEA 2HDEA 3APDA 4ZOHC 2CU3A 5BMGA 4B0MA 3P42A 2NBWB 1L7YA 4HPPA 2JWUA 1JWBD 1VJKA 2A4ZA 3B1LX 3N1YC 2LUMA 3NZUA 4NPNA 3CWIA 2KDBA 3NVVA 2G4SA 3DPDA 2LGSA 4YT0B 3PV1A 1DGJA 4WJPA 4MM3A 3QWZB 5G5HA 2N4FA 4PS7A 4H2AA 2KC1A 5D2MB 1RLFA 2KWCA 4HROA 1E7VA 2J0JA 3GOEA 2BW2A 1C4AA 2W3SA 3JVZX 3L13A 1T0SC 2BKRB 2KWVB 3I63C 4RFBA 5H8YE 2DNFA 4W9IA 1VZ8A 4KKIA 1FXTB 3VR9B 2CHWA 3NY5A 1JWUD 2C9WB 5IO9A 1OTRB 4DHJB 3GB1A 3L0WB 2WXPA 2AQ3B 1WF9A 3Q6BA 1JWAD 1ZW7A 1SIFA 2KNBA 4NJ6A 2IYDB 3PPAA 5MPOA 4GDKB 3FILA 3AMZA 4IM3A 1IGDA 4YTNB 3PVLA 2N7JA 2DAJA 3RI7C 2FUG1 4MGKE 5C3JB 3N32A 1SE3A 2YEPB 4MEMA 4A8XC 3W5UB 5KHQA 1P1AA 1MHXA 3PHXB 4N6EB 3X0WA 3VUYA 1YN4A 1WRDB 2KT7A 1AW7A 3AXCA 3S2AA 4A3PA 1I4XA 2MWSB 3ABVB 4B0EA 3U30A 2BQQA 1IPGA 3NVYA 1LM8B 1P7FA 1TKYA 4S0RA 4MGYE 2GRIA 4TV3A 1JQ4A 4DXGA 2K39A 1E0ZA 4M8NA 1I4PA 2QJLA 4MJSB 1E5WA 4GDKA 4HKQA 3DBRB 1JMLA 4BOZB 2G1EA 3CMMB 3JU5A 5H92C 2W54A 5CHFA 1SE4A 3UINB 2PVGC 3M62B 1YNTE 1R8GA 4IW0A 2C7MB 4GW0A 3MC0B 4MACA 4B9KA 3EUB2 3DBLB 3TUOA 1WRIA 4C4VB 3QCAA 5BYQA 2KO3A 1SBBB 4USAA 2WU5B 2WXHA 1XO3A 4GSWA 1PGBA 2IJ0A 4PS3A 3AEAB 1FEHA 4P16A 3ZJTA 1MHHE 3J9CA 2HTME 4WQOB 5BMHA 2KACA 4E3CA 4RF8A 1CJEA 3GZNB 1TT5B 3ZRFA 4EUTA 2K8CA 4GB9A 3AE1B 3QAQA 3NVZA 4RGOS 2LWPA 3ZXRA 4MJSA 4P7IA 1GG3A 4BZAA 2HD5B 3VTUA 1XD3B 3OJ4B 2PKOA 4G3XB 5D94A 4NQLB 1WGGA 4C7ZA 4RF7A 2YLMA 3KQ4A 1DOXA 4AOFA 1BMLC 4G50A 2KAJA 1WSPA 2W9NA 4K7SA 3U4EG 2C5LC 2DHZA 5J2RA 4C4VA 3VQIA 2KC2A 3AEEB 4JIOU 3PHWB 1EU3A 3P4SB 3SHQA 1FNUA 2K9XA 4DHZE 1MJDA 3DWMA 1FXAA 2BWFA 4YXDB 3KYCD 4KSLC 2VRRB 3JQ3A 4HRSA 3TEWA 1SIJA 2L1AA 2OJWA 1FRDA 4A90A 1KOTA 2XK5A 4AS1A 2D3BA 4FLHA 3ZTDA 4ZRKA 1ZGUB 4WH4A 4ICUA 1XLOA 2BKFA 1NEKB 2DYOA 4W9JA 5AZFA 4Q2RA 5I4DA 3DBHI 2IGGA 1WIAA 2WXJA 5BO4B 3RNBC 1UBIA 2WU2B 1FNWA 2MBHA 3C19A 4PS8A 2J4XA 1XT9B 1XXGA 2OEDA 1MFWA 4J3OD 5J17A 1TZOA 4KDIC 2BYVE 4MSQB 1OQRA 1TBEA 2LXCA 2BB5A 1A5RA 3ZIMA 2LMCA 2N9XA 3QK0A 1JRUA 1IP9A 1PGXA 2WXIA 1YJJA 1J0GA 2JU6X 2K0PA 1V1OA 4HEA1 4US8A 2JWZA 3V62A 4DQOC 4OVVA 4NZLB 4UDUC 4A55A 3LJ3A 1Q0WB 2KZRA 2D3CA 1YQ4B 2LRUA 3I9V1 3VFKA 1RFAA 3HVDA 2WLBA 5DPTA 5AUIA 2LRWA 2KK8A 4LDTD 3DREA 2MRPA 1FFVA 1NENB 2H88B 1R7SA 3EGRA 2RPQA 3VUXA 3N1XC 2O2VB 2W55A 2QDFA 1G6JA 3VTWA 4K3BA 1WXSA 3ZGZA 4GN1A 1KFYB 3W1YA 2JSVX 2AX5A 1R4NB 2LD9A 3E56A 4W9DA 1WYGA 4M02A 5J9AA 1R4MI 4AM1A 2V9HA 4ZRIA 2MH7A 1F77A 2DZIA 3E9SA 2MBQA 1FO4A 3JSVB 3CF6E 2AQ1B 1E8WA 5EE1A 3P4QB 2X8XX 1GC6A 3BZDB 1WGHA 1WR1A 5GXGB 3L2EB 2JRHA 4CHKA 5JZEB 3OWEB 2D10A 4II3B 4WWOA 1V4GA 1WJNA 3APFA 1IYFA 3R8BA 3L17A 4P1BC 4RNAA 2N9EB 4RM8A 4RF0A 4MDKE 5FK9C 4HK2A 2PEAA 1E90A 3MHSD 4KIKB 2HTHA 2PIAA 1ZOYB 1TKGA 2L00B 4B95A 4HCPB 3VUWA 2QEJC 4WWMA 3SR6A 2R61A 3BK2A 4HVBA 1IUEA 3OJ3A 5E6OA 2BS4B 2RDBC 3A4RA 3P4PB 1V80A 3AE8B 1VRPA 1WX8A 2ACZB 2PLPA 2LUEA 4NAMA 3HUIA 1XQQA 2PMVA 3EC8A 3A9KA 1JWMD 1WWTA 1N61A 1AARA 4EZLA 3JSVA 1N5XA 3A1QB 2KXJA 2INCC 2D11A 1SXTA 3L2EA 2ZW0A 5EE9A 2RSUA 2LFIA 1UBQA 3DRBA 3V3XA 2C7HA 3I5JC 1V2YA 1ZXIA 3TEXA 4E71A 1TY2A 1U4AA 3FKYA 4IG7B 1MI0A 1T0RC 3BY4B 4ICVA 3ZLZA 1ACCA 4KIKA 3M95A 4KGSA 3MP9A 4IKGA 3R2IA 3RFZB 4KX6B 3A4SC 4YSXB 4FADA 2ZNVB 2H89B 4HDQA 2IDYA 3MC8A 2CS4A 3PRZA 2C60A 2WS3B 3ZRCA 2LASA 1FPYA 2KVZA 1QOGA 3BVMA 1ET6A 3IAM1 2Y5CA 3ZJUA 4KSKC 3VTVA 5IAAC 2KTRB 3UI3A 3A1QA 1T6BX 1NYQA 2BS3B 2R2QA 1N60A 4G11A 1B1ZA 1JROA 2KKCA 3QC8B 1K51A 2NVUI 4EZKA 1WXAA 1XLQA 1Q1OA 2LHDA 3ONSA 1Z2MA 4ZRPA 3WAPA 4GU2A 4XE0A 4JWSC 5D3DA 2FUHB 4CYEA 4PYUA 2WYQA 1ENFA 3BYYB 2NBVB 3U52E 3ZTCA 3P4RB 4BBNF 3EFCA 4MELA 2WXFA 3TMPB 5LXIB 1KJTA 4PYZA 4M0WB 1WXQA 1PUTA 2GMIC 2LJ5A 3KWLA 4K7WA 3SEBA 2KTRA 3DBSA 4C7YA 2PW9A 3TBLD 3VRAB 3N1ZC 4GGQA 3IG3A 2KFKB 3MHZA 1KM7A 2LJIA 4YTPB 2MBOA 1F1HA 2KJ6A 3BINA 2D3GA 1LQBA 2QMTA 1NDDA 2O6VB 3IXSA 3B9JA 2GBJA 2M4NA 3AU5A 4HDOA 2GWCA 4K81A 1EF1A 4LNKA 2CR5A 4ANVA 1C9FA 1K50A 1DOIA 2JY6A 3VAWA 2D5GA 3PZ7A 4A9AA 3FILB 2BTEA 1H8CA 3KUDB 3DHHC 4MGZE 4KDLB 2WNMA 5JHAA 2AWTA 4OZCA 1X1MA 3UF8A 2GBKA 3MC9A 3PRMB 2R2OA 1NYRA 4M0WA 2NR2A 2IO2B 1CK1A 1OEYA 4X57B 1GPXA 2ONQA 3QHTA 2YVCA 1NI2A 2NTTA 1PQSA 2KMMA 1WM3A 2IO3B 1FM0D 3PSEB 5JHBA 3PRPB 4TSSA 2FAZA 2KFKA 2PJHA 5CHWA 1QLBB 3V05A 4BOSC 4F8CB 2O6VA 4DDGD 1C79A 3ZYYX 2WDRB 4IC7B 5TR5A 2WDVB 3AECB 3JU6A 2N9KA 4N9F4 1RM6C 4CO7A 3I57A 5IOIA 2GBNA 2IGHA 1MPEA 2DZKA 2L83A 1F9JA 1OQYA 1KLGD 3TJPA 3MFGA 3NJTA 3P2BA 2ICIA 3N9YC 3NZSA 1G0WA 1WJ6A 2WXQA 4TMAB 4LLGM 4FXCA 2KWDA 1PDXA 3Q8FA 4WAAA 3KWVA 3L16A 1ZDVA 3Q3OC 2JX5A 1J19A 1HEZE 1SB3C 3W9CB 2K6DB 1ESFA 4WWPA 1UUPA 1L6VA 5HKHA 5HI1A 1RYJA 2NBUA 3WA0A 2I1KA 2WXMA 2IO0B 4RF9A 2REXA 1CMXB 1WI0A 4MT5A 2Z0DB 3L10B 1C3TA 4GVZA 1I4QA 3HIZA 4NQKE 2DENB 2ASQA 2KDMA 1BUIC 4JLCA 3A33B 2SEBD 3T9LA 1E10A 1I4RA 2JXTA 2INDC 3DBRI 2ZW1A 3CIRB 1S3SG 2SAKA 2QILA 3AULA 1I4HA 4RM9A 2OJRA 3DHIC 1MVKA 3TSSA 1WXMA 2MP2B 2V4LA 1KLUD 2BT6A 2RPVA 4OZAA 4BG4A 3DHGC 4WJOA 1T5XD 2TSSA 3RNAC 3UIOB 1KH0A 2KTFA 2XK5B 3Q8EA 3DVGY 2WHIA 3HVZA 3V6EB 3N3KB 3U7ZA 2UU7A 3JW0X 3AE3B 3Q8AA 1QT9A 2B76B 5LLIA 2WDQB 3IHPC 1GOZA 2ZNVC 3C8YA 2LGYA 3LXFA 2EMSA 1DYQA 2LVPA 1GAQB 2J0KA 1V8CA 2M56B 3NZ3A 3B2GA 2WX0A 2G9HD 3R7RA 5JH5C 1C4PA 2J53A 5IA7A 3WAOA 1J8CA 2WXLA 2ZPYA 1P52A 4TQ0A 2INPE 3Q2AC 4DBGA 2BS2B 2JVCA 3U7DA 3VXWA 4REZA 4XDCA 4AQ7A 2M1MA 1WY8A 2LVQA 2N7EA 2KFJA 3EA6A 3FAHA 2MP2A 2KD0A 2DAFA 4ITKA 2KQSA 1VRAB 2Z8LA 3I3TB 2WDTB 3PZ8A 4JE3B 3ZDMC 3OG5A 3R3MA 4ANXA 2IO1B 2J1QA 2CHXA 3L2DA 4ZDVA 4AJYB 5EDSA 2VH1A 4IM0A 2RDHA 4XWWA 3DBHB 2N9LA 3W2DA 4LJPB 3H6NA 2LZ6A 4I6NB 4XDDA 4PK1A 3HHMA 3RMKC 3ZNZB 4WJQA 2V3PA 3NG0A 5BMIA 3MTNB 3KUCB 4ZYNA 3AN1A 1F2RC 2EKIA 3Q8CA 1VZ6A 1WGRA 1MG8A 3MJ5A 4KKJA 1N63A 3HM3A 1V9JA 3AB5A 5LXHA 3ZXVA 2Y5PA 1NVID 4IOIE 1A70A 2D3AA 4M01A 4Q2JA 4GW2A 2VZKD 1D4BA 2KOXA 3TCAA 4A20A 3KYDD 2C7NB 2AEHA 1EWYC 3N30A 1HTOA 4AP4C 5JXVA 3IT6B 3IG5A 2WXRA
chains in the Genus database with same CATH topology
3ZXRA 2UU7A 4RF6A 3L2EB 2D3BA 2CRKA 4HPPA 3B6RA 2QC8A 1QK1A 3ZXVA 4BAXA 3DREA 3JU5A 4GVZA 2WGSA 2J1QA 1HTQA 4LNKA 3M10A 3NG0A 1I0EA 1P52A 2BVCA 3L2DA 3L2EA 1BG0A 5J9AA 4AM1A 2D3AA 1QH4A 4LNOA 4GW2A 4S0RA 1CRKA 4GW0A 4BG4B 2LGSA 4GVYA 2D3CA 4RF8A 4RF7A 4Z9MA 3DRBA 1U6RA 4Q2RA 1M15A 4LNIA 3JU6A 4XYCA 1G0WA 2GLSA 1VRPA 1LGRA 4BG4A 1F52A 3JPZA 3JQ3A 4RF9A 4ACFA 4BHLA 4LNFA 2OJWA 5J99A 1HTOA 1FPYA 1SD0A 1RL9A 4S17A 4LNNA 2WHIA 3FKYA 1F1HA 1P50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXR A;  2UU7 A;  4RF6 A;  3L2E B;  2D3B A;  2CRK A;  4HPP A;  3B6R A;  2QC8 A;  1QK1 A;  3ZXV A;  4BAX A;  3DRE A;  3JU5 A;  4GVZ A;  2WGS A;  2J1Q A;  1HTQ A;  4LNK A;  3M10 A;  3NG0 A;  1I0E A;  1P52 A;  2BVC A;  3L2D A;  3L2E A;  1BG0 A;  5J9A A;  4AM1 A;  2D3A A;  1QH4 A;  4LNO A;  4GW2 A;  4S0R A;  1CRK A;  4GW0 A;  4BG4 B;  2LGS A;  4GVY A;  2D3C A;  4RF8 A;  4RF7 A;  4Z9M A;  3DRB A;  1U6R A;  4Q2R A;  1M15 A;  4LNI A;  3JU6 A;  4XYC A;  1G0W A;  2GLS A;  1VRP A;  1LGR A;  4BG4 A;  1F52 A;  3JPZ A;  3JQ3 A;  4RF9 A;  4ACF A;  4BHL A;  4LNF A;  2OJW A;  5J99 A;  1HTO A;  1FPY A;  1SD0 A;  1RL9 A;  4S17 A;  4LNN A;  2WHI A;  3FKY A;  1F1H A;  1P50 A; 
#chains in the Genus database with same CATH topology
 2GB1 A;  3L54 A;  1EU4 A;  1Q5W B;  3M3J A;  2L7R A;  3BVG A;  4AJW A;  2FE8 A;  1HXY D;  3CSF A;  3ECI A;  2ZCB A;  4M00 A;  4LCD E;  3R66 C;  2X38 A;  4TUU A;  3TEZ A;  3W1S A;  2IZV B;  1YMH E;  4M8M A;  2KQ4 X;  1P9D U;  3URY A;  1FXI A;  4E74 A;  1UWX A;  2QCZ A;  3Q69 A;  2D2Q A;  1WGK A;  4O1N A;  3KW5 B;  1ZPS A;  4IM2 A;  1BXT A;  1IGC A;  1R4M B;  3VH4 B;  4I6L B;  1QKZ A;  3SFD B;  3A9K B;  1GB1 A;  4OHJ A;  1K53 A;  3PRE A;  3RNC C;  2L32 A;  4N58 A;  2AL3 A;  3ENE A;  3ZUN A;  2NS5 A;  2L76 A;  1TYG B;  4JQW C;  2IGD A;  3RD2 A;  1NBF C;  3KLS X;  2WGS A;  3LVW A;  3AEG B;  4NAW A;  4W9K A;  5CHV C;  4MGI E;  5LNK 1;  4MH8 A;  4ZRQ A;  1QH4 A;  2UWQ A;  1C78 A;  2LGD A;  2J0M A;  2HE7 A;  1WMH B;  1RFK A;  3VVW B;  1YX5 B;  4II2 B;  4IDI A;  3ZKJ C;  4W9F A;  2KQ7 A;  3VDZ A;  4BHL A;  1YQB A;  4RF1 A;  2KWU B;  3DVN U;  3A9J A;  2NMQ A;  2KX3 A;  5IKC M;  3NZT A;  2FID A;  1JRP A;  2BF8 B;  4TQ1 A;  1QZE A;  1F0Z A;  4HCN B;  2JYT A;  2N9P C;  1ZKH A;  3MJW A;  4W9G A;  2M8S A;  3JPZ A;  3LN6 A;  3DQV A;  2NPT B;  1ZE3 D;  1YIW A;  3ZVV A;  1WX7 A;  1XCQ L;  3PO0 A;  1KRH A;  4KGR A;  1XF5 L;  1QIL A;  1WE7 A;  1ZUD 2;  2FCN A;  3VH3 B;  2MEK A;  5D3I B;  1WX9 A;  2E6X A;  2W3R A;  3PZD A;  4DK5 A;  1HTQ A;  4DHJ D;  2KDI A;  2PPH A;  2V4I B;  5G2N A;  2KDE B;  2M17 A;  3H7S A;  2BGF A;  2Q5W D;  2INN E;  5AUK A;  1WMH A;  2G3Q B;  1S1Q B;  3RNE C;  1DOY A;  4US9 A;  3DCG A;  1EUV B;  2MA9 B;  2OOB B;  4KZC A;  2BYT A;  2D32 A;  1V81 A;  1WJU A;  1D5X C;  2MBB B;  4XZ4 A;  4BKT A;  2E3T A;  4ZHO A;  4KZ0 A;  2ZCC A;  1B9R A;  1WXV A;  1L2N A;  5CTR C;  2PE6 B;  1XCT L;  4KV2 A;  4MH0 E;  2Y3A A;  3V6C B;  3UGB B;  1M15 A;  4RGT A;  1C4C A;  1LXD A;  2DBY A;  1V49 A;  1ZDX A;  3B08 A;  1I35 A;  1QOA A;  2NPT A;  4WQM A;  1UGM A;  4FJV B;  1C77 A;  4JL9 A;  2MJD A;  3AU4 A;  3AM9 A;  1PYW D;  3H7P A;  5HHD G;  2BYF A;  2AYO B;  1I42 A;  1HZ6 A;  1ISN A;  2LI5 A;  4K7U A;  5C2T B;  4IWP A;  3EEC A;  2MHJ A;  1SD0 A;  2PVO D;  1YX6 B;  2D33 A;  3RT3 B;  2RMM A;  3T3N A;  4URK A;  4ZRJ A;  4RH6 A;  4G0N B;  5E6N A;  2QC8 A;  3RCZ A;  2JPH A;  3QJZ A;  1JCK B;  5GMV A;  1SF0 A;  1I0E A;  2VZK B;  2JRI B;  2QSD A;  4DHZ B;  1TS4 A;  3TEY A;  1WGD A;  2KMA A;  4W9C A;  2DLB A;  4MSM B;  4WUR A;  3L08 A;  4NJC A;  2LXA A;  4YSZ B;  3DVN V;  5L83 A;  4LDT B;  3GS2 A;  1AYF A;  1T0Y A;  3B0A A;  3AE5 B;  5AZH A;  1GB4 A;  5BYR A;  5IP4 D;  2KVR A;  2WWZ A;  3AEB B;  2MSE D;  1HZ5 A;  1V5T A;  2MCN B;  4FHJ A;  4IUM B;  1U6R A;  2G4D B;  4C80 A;  5E6J A;  4WWN A;  4DXF A;  4YL8 A;  4BKS D;  3AH7 A;  2MBE A;  4EOY A;  2K8B A;  4OZB A;  2WX1 A;  3Q8B A;  2ZJD A;  3WAM A;  1SSN A;  2CHZ A;  3ZNI D;  2BPS A;  2DYM A;  4LJO B;  3SFE B;  4HLE A;  4W9E A;  3KH0 A;  2WXN A;  3W1S C;  2BYE A;  1E9M A;  1TS5 A;  5C23 A;  4EE2 A;  3GP7 A;  3WCQ A;  3UQB A;  2K25 A;  2JQR B;  4ANU A;  2CRK A;  1I4G A;  1TS2 A;  1V1P B;  2MX2 A;  4LNO A;  1QOB A;  3R2T A;  4HKZ E;  4RGN A;  1P7E A;  3IAS 1;  2NCN A;  2J42 A;  1LGR A;  1TKE A;  3DOW A;  1OQQ A;  2FCQ A;  3AE6 B;  2YEP F;  1FIQ A;  1WGY A;  1CQV A;  4BAX A;  3EHV A;  1BT0 A;  1KF6 B;  3TIX A;  2FNJ B;  4NJ7 A;  4HJK A;  1VCB A;  1WM2 A;  1MG4 A;  2L52 A;  2I2Y A;  2IY1 B;  4P6V F;  3PTF C;  4TKN A;  3LB8 C;  1UEL A;  2JZP A;  1KLV A;  2DX5 B;  2AL6 A;  3GE8 C;  3QA8 A;  1JW9 D;  2UYZ B;  1M94 A;  1C76 A;  4HPL B;  3GE3 C;  1FNV A;  3BVZ A;  1V1P A;  4BKG A;  2BWE S;  3LDZ E;  4OVU A;  5AEK B;  2IPK D;  1VDV A;  1V6E A;  4ARC A;  1RL9 A;  4WIP A;  4RCO A;  4ZYS A;  4K1R B;  2J7Q B;  1EWC A;  1ZP0 B;  2JT4 B;  4WJN A;  3BYT B;  2FCS A;  1RAX A;  2JZ3 B;  1AWD A;  1GUA B;  3H1U A;  4GIV A;  2V1Y A;  3RZF A;  2EMT A;  4BG4 B;  2Y5B B;  3C0R B;  3RZW C;  4EZJ A;  5FR3 A;  3QX1 A;  4HWI B;  3NS1 A;  2DZM A;  1TIF A;  3H8H A;  2M0X A;  3X23 A;  4LNN A;  3U2S C;  3K9O B;  4YWG G;  2JUO A;  1L6U A;  1OFF A;  4R3D A;  5HFY A;  1J7B A;  2KLG A;  1L4D B;  1IBX B;  1TT4 A;  2B3A A;  1BG0 A;  2FCM A;  3RN9 C;  3RUI B;  2GBR A;  3W5V B;  4LNI A;  4GOC A;  4FA6 A;  2WXK A;  4GDL B;  2V3S A;  4F7Z A;  3AE9 B;  1WH3 A;  1RWS A;  2PE9 A;  3BWU D;  3NUH B;  4W9H A;  4A6Q A;  4EFO A;  1L4Z B;  2ON8 A;  2JZZ A;  4OVZ A;  3TL5 A;  2L8J A;  2CKH B;  2EKE C;  3SD5 A;  4I6P A;  1Z5S B;  1M4V A;  2MQJ A;  4AWJ A;  3DBL I;  2K22 A;  2AQ2 B;  2VH2 A;  1VD2 A;  4L23 A;  2HJ1 A;  4S17 A;  3L4P A;  1E7U A;  4FHK A;  1FCL A;  4JWU C;  3ETR A;  3KUZ A;  4C00 A;  3AE7 B;  1QK1 A;  3ML8 A;  3UIP B;  2LHE A;  4DXA B;  4ZHP A;  5C1Z A;  4HXD A;  2ZVO A;  3GZN I;  1IBX A;  1QOF A;  2I1J A;  5IN7 A;  4BVU C;  3KVF B;  2KX0 A;  3PS6 A;  1E7P B;  2FBW B;  3QQ8 B;  1FRR A;  2OHF A;  3AEF B;  4GDL A;  1JAL A;  3APC A;  4F1S A;  2K5P A;  1UF0 A;  1FMA D;  1SGH A;  1YJI A;  2MW5 A;  1T0Q C;  2WXO A;  2K1F A;  3AE2 B;  1UH6 A;  1XEE A;  2A5U A;  1TZ1 A;  3ZNH B;  1E8Y A;  1J7C A;  2D07 B;  3HK0 A;  1K52 A;  2L05 A;  2KYW A;  2KN5 A;  1YN3 A;  1YN5 A;  4FJZ A;  2MLB A;  1UNS A;  4JPS A;  1D5M C;  3RPF C;  1CZP A;  4A3O A;  3K9P B;  4HJG E;  2L0F A;  3QAR A;  5D6J B;  2ZPN A;  1E8X A;  3AE4 B;  3ZJV A;  2V0G A;  3NVW A;  3WIM A;  1K8R B;  1F52 A;  2G45 B;  3PT2 B;  1WYW B;  1E8Z A;  2HJ8 A;  2BB6 A;  1OGW A;  1AN8 A;  1L0V B;  1WZ3 A;  4BKS A;  3LYY A;  1TS3 A;  3WAL A;  1GC7 A;  4B6W A;  3ZDT A;  1D5Z C;  2KMC A;  1D6E C;  4GLS C;  5FKA C;  3BK1 A;  4P1C C;  4OW0 A;  4FN2 A;  2V3N A;  3IT4 B;  1H4R A;  1FCC C;  2DZJ A;  1T3Q A;  5G55 A;  2KHW B;  4J6I A;  4QAY A;  1Y8R C;  4NY0 A;  1D3Z A;  1N62 A;  1YQ3 B;  1N5W A;  1RRB A;  4W9L A;  2JYE A;  1SE9 A;  1ET9 A;  1OEY J;  2PTL A;  2QHO A;  2N1V A;  1J7A A;  3DDC B;  1I7H A;  2M0A A;  2KJH B;  3UQA A;  3D32 A;  3ML9 A;  2GWD A;  2XN9 C;  2CJO A;  4XYC A;  4EKU A;  1L5P A;  5J99 A;  1L0X B;  3BII D;  4IWO A;  3Q3M C;  1WZ0 A;  1PFD A;  3NRZ A;  5G5G A;  4BBN C;  4NAW B;  4XX5 A;  1WFY A;  5D7G A;  1N6Z A;  3JYU A;  3PGE A;  1ZXH A;  1FD6 A;  2NTS A;  3RNF C;  4Z9M A;  2DWQ A;  2JF5 A;  1UGJ A;  1VR9 A;  3A9J B;  1E6E B;  3AED B;  3ZQ4 A;  1XLN A;  2WQY B;  5AZG A;  1P0R A;  2WP9 B;  2ZZP B;  3SDL C;  1VA6 A;  2I38 A;  5FR6 A;  1EO6 A;  1P3Q U;  4IWQ A;  2MJE A;  2K8H A;  1SJH D;  3IG8 A;  4N59 A;  1GJZ A;  3VR8 B;  4GVY A;  4FBJ B;  2XBB C;  4ACF A;  2IY0 B;  3DVG X;  3Q3F A;  4LNF A;  4RMA A;  2EEL A;  2IBI B;  4XC2 A;  1R4N I;  3M63 B;  2O6V D;  2N7D A;  3P1M A;  1C1Y B;  5DCN A;  3IFW B;  2W82 A;  2M19 A;  4DWF A;  1CRK A;  3RNG C;  3N20 C;  2DYB A;  1YD8 U;  3HRD D;  1VZ7 A;  3VRB B;  1P50 A;  1XLP A;  4AUQ C;  2ZEQ A;  3B6R A;  5DPR A;  2FIF A;  3LVV A;  4LK0 M;  3M10 A;  2BVC A;  2LVO A;  3LN7 A;  4XWT A;  5E6P A;  3ZW3 A;  4LTU A;  2JXX A;  3O65 B;  5EE3 A;  2RR9 A;  2K3U A;  2BBC A;  4KVG B;  4NNJ B;  2L3Z A;  3VHT C;  2Z59 B;  4XGA B;  3IBE A;  4EEW A;  3ZO5 B;  2O2V A;  3V61 A;  3T8M A;  3DWG C;  1UZX B;  4K3C A;  4HPM B;  3B2F A;  3QIJ A;  4KGT A;  3H7P B;  1HA5 A;  3V60 A;  3EFU A;  1WR6 E;  2RD0 A;  4GMV A;  4ANW A;  1LO5 D;  4WAF A;  3RYT A;  2GI9 A;  5CX3 A;  1HE8 A;  2KDF B;  4GXB A;  3T3O A;  5DPW A;  3ALB A;  4L2Y A;  4RGM A;  1P98 A;  2Z0E B;  2RDG A;  1WE6 A;  1TTN A;  2K6Q A;  2WXG A;  3NS8 A;  3HM6 X;  5KHO A;  1LFD A;  1EM7 A;  2KAN A;  4BFR A;  5T8I A;  1ROE A;  3O13 A;  4L1B A;  1EF5 A;  1QF6 A;  1TGZ B;  2KJR A;  4ARI A;  1UWM A;  2N1W A;  3H9D A;  1WJ4 A;  4JGH B;  5J18 A;  2KLC A;  2KN4 A;  3OLM D;  2GLS A;  5DPS A;  2LEK A;  3WAN A;  2ZVN A;  3Q14 C;  4YSY B;  1YJ1 A;  4RF6 A;  2N0S B;  1V86 A;  1GNU A;  3NHE B;  1UD7 A;  3SU8 X;  2LGI A;  5L95 C;  2GOW A;  3RUL A;  4ASW C;  1SEB D;  1TY0 A;  3OAW A;  3PLV A;  1HQR D;  3U8Z A;  2RGF A;  2J52 A;  2L0T A;  4FJY A;  2QIE B;  1VLB A;  4DDI D;  3CST A;  1Q10 A;  3R7Q A;  4C56 C;  1PGA A;  4MM3 B;  1FFU A;  2CJN A;  1KTK A;  4CQN A;  1Y56 A;  3FC4 A;  4PT5 A;  1JWS D;  2CU1 A;  1YOV B;  1SJE D;  2XNA C;  5EE0 A;  1V97 A;  2GBM A;  2XEW A;  3Q3J A;  3AV8 A;  4YTM B;  4D2K A;  5TSS A;  1L0Y B;  1QQR A;  3AI5 A;  5HG2 A;  2MJ3 A;  3NOB A;  3P63 A;  4JX1 C;  1SE2 A;  3PLU A;  1V5O A;  3IVF A;  4FUL A;  1F2R I;  2LGX A;  3ZNG C;  5BYS A;  1NI3 A;  1TJE A;  3Q3N C;  1STE A;  2HDE A;  3APD A;  4ZOH C;  2CU3 A;  5BMG A;  4B0M A;  3P42 A;  2NBW B;  1L7Y A;  4HPP A;  2JWU A;  1JWB D;  1VJK A;  2A4Z A;  3B1L X;  3N1Y C;  2LUM A;  3NZU A;  4NPN A;  3CWI A;  2KDB A;  3NVV A;  2G4S A;  3DPD A;  2LGS A;  4YT0 B;  3PV1 A;  1DGJ A;  4WJP A;  4MM3 A;  3QWZ B;  5G5H A;  2N4F A;  4PS7 A;  4H2A A;  2KC1 A;  5D2M B;  1RLF A;  2KWC A;  4HRO A;  1E7V A;  2J0J A;  3GOE A;  2BW2 A;  1C4A A;  2W3S A;  3JVZ X;  3L13 A;  1T0S C;  2BKR B;  2KWV B;  3I63 C;  4RFB A;  5H8Y E;  2DNF A;  4W9I A;  1VZ8 A;  4KKI A;  1FXT B;  3VR9 B;  2CHW A;  3NY5 A;  1JWU D;  2C9W B;  5IO9 A;  1OTR B;  4DHJ B;  3GB1 A;  3L0W B;  2WXP A;  2AQ3 B;  1WF9 A;  3Q6B A;  1JWA D;  1ZW7 A;  1SIF A;  2KNB A;  4NJ6 A;  2IYD B;  3PPA A;  5MPO A;  4GDK B;  3FIL A;  3AMZ A;  4IM3 A;  1IGD A;  4YTN B;  3PVL A;  2N7J A;  2DAJ A;  3RI7 C;  2FUG 1;  4MGK E;  5C3J B;  3N32 A;  1SE3 A;  2YEP B;  4MEM A;  4A8X C;  3W5U B;  5KHQ A;  1P1A A;  1MHX A;  3PHX B;  4N6E B;  3X0W A;  3VUY A;  1YN4 A;  1WRD B;  2KT7 A;  1AW7 A;  3AXC A;  3S2A A;  4A3P A;  1I4X A;  2MWS B;  3ABV B;  4B0E A;  3U30 A;  2BQQ A;  1IPG A;  3NVY A;  1LM8 B;  1P7F A;  1TKY A;  4S0R A;  4MGY E;  2GRI A;  4TV3 A;  1JQ4 A;  4DXG A;  2K39 A;  1E0Z A;  4M8N A;  1I4P A;  2QJL A;  4MJS B;  1E5W A;  4GDK A;  4HKQ A;  3DBR B;  1JML A;  4BOZ B;  2G1E A;  3CMM B;  3JU5 A;  5H92 C;  2W54 A;  5CHF A;  1SE4 A;  3UIN B;  2PVG C;  3M62 B;  1YNT E;  1R8G A;  4IW0 A;  2C7M B;  4GW0 A;  3MC0 B;  4MAC A;  4B9K A;  3EUB 2;  3DBL B;  3TUO A;  1WRI A;  4C4V B;  3QCA A;  5BYQ A;  2KO3 A;  1SBB B;  4USA A;  2WU5 B;  2WXH A;  1XO3 A;  4GSW A;  1PGB A;  2IJ0 A;  4PS3 A;  3AEA B;  1FEH A;  4P16 A;  3ZJT A;  1MHH E;  3J9C A;  2HTM E;  4WQO B;  5BMH A;  2KAC A;  4E3C A;  4RF8 A;  1CJE A;  3GZN B;  1TT5 B;  3ZRF A;  4EUT A;  2K8C A;  4GB9 A;  3AE1 B;  3QAQ A;  3NVZ A;  4RGO S;  2LWP A;  3ZXR A;  4MJS A;  4P7I A;  1GG3 A;  4BZA A;  2HD5 B;  3VTU A;  1XD3 B;  3OJ4 B;  2PKO A;  4G3X B;  5D94 A;  4NQL B;  1WGG A;  4C7Z A;  4RF7 A;  2YLM A;  3KQ4 A;  1DOX A;  4AOF A;  1BML C;  4G50 A;  2KAJ A;  1WSP A;  2W9N A;  4K7S A;  3U4E G;  2C5L C;  2DHZ A;  5J2R A;  4C4V A;  3VQI A;  2KC2 A;  3AEE B;  4JIO U;  3PHW B;  1EU3 A;  3P4S B;  3SHQ A;  1FNU A;  2K9X A;  4DHZ E;  1MJD A;  3DWM A;  1FXA A;  2BWF A;  4YXD B;  3KYC D;  4KSL C;  2VRR B;  3JQ3 A;  4HRS A;  3TEW A;  1SIJ A;  2L1A A;  2OJW A;  1FRD A;  4A90 A;  1KOT A;  2XK5 A;  4AS1 A;  2D3B A;  4FLH A;  3ZTD A;  4ZRK A;  1ZGU B;  4WH4 A;  4ICU A;  1XLO A;  2BKF A;  1NEK B;  2DYO A;  4W9J A;  5AZF A;  4Q2R A;  5I4D A;  3DBH I;  2IGG A;  1WIA A;  2WXJ A;  5BO4 B;  3RNB C;  1UBI A;  2WU2 B;  1FNW A;  2MBH A;  3C19 A;  4PS8 A;  2J4X A;  1XT9 B;  1XXG A;  2OED A;  1MFW A;  4J3O D;  5J17 A;  1TZO A;  4KDI C;  2BYV E;  4MSQ B;  1OQR A;  1TBE A;  2LXC A;  2BB5 A;  1A5R A;  3ZIM A;  2LMC A;  2N9X A;  3QK0 A;  1JRU A;  1IP9 A;  1PGX A;  2WXI A;  1YJJ A;  1J0G A;  2JU6 X;  2K0P A;  1V1O A;  4HEA 1;  4US8 A;  2JWZ A;  3V62 A;  4DQO C;  4OVV A;  4NZL B;  4UDU C;  4A55 A;  3LJ3 A;  1Q0W B;  2KZR A;  2D3C A;  1YQ4 B;  2LRU A;  3I9V 1;  3VFK A;  1RFA A;  3HVD A;  2WLB A;  5DPT A;  5AUI A;  2LRW A;  2KK8 A;  4LDT D;  3DRE A;  2MRP A;  1FFV A;  1NEN B;  2H88 B;  1R7S A;  3EGR A;  2RPQ A;  3VUX A;  3N1X C;  2O2V B;  2W55 A;  2QDF A;  1G6J A;  3VTW A;  4K3B A;  1WXS A;  3ZGZ A;  4GN1 A;  1KFY B;  3W1Y A;  2JSV X;  2AX5 A;  1R4N B;  2LD9 A;  3E56 A;  4W9D A;  1WYG A;  4M02 A;  5J9A A;  1R4M I;  4AM1 A;  2V9H A;  4ZRI A;  2MH7 A;  1F77 A;  2DZI A;  3E9S A;  2MBQ A;  1FO4 A;  3JSV B;  3CF6 E;  2AQ1 B;  1E8W A;  5EE1 A;  3P4Q B;  2X8X X;  1GC6 A;  3BZD B;  1WGH A;  1WR1 A;  5GXG B;  3L2E B;  2JRH A;  4CHK A;  5JZE B;  3OWE B;  2D10 A;  4II3 B;  4WWO A;  1V4G A;  1WJN A;  3APF A;  1IYF A;  3R8B A;  3L17 A;  4P1B C;  4RNA A;  2N9E B;  4RM8 A;  4RF0 A;  4MDK E;  5FK9 C;  4HK2 A;  2PEA A;  1E90 A;  3MHS D;  4KIK B;  2HTH A;  2PIA A;  1ZOY B;  1TKG A;  2L00 B;  4B95 A;  4HCP B;  3VUW A;  2QEJ C;  4WWM A;  3SR6 A;  2R61 A;  3BK2 A;  4HVB A;  1IUE A;  3OJ3 A;  5E6O A;  2BS4 B;  2RDB C;  3A4R A;  3P4P B;  1V80 A;  3AE8 B;  1VRP A;  1WX8 A;  2ACZ B;  2PLP A;  2LUE A;  4NAM A;  3HUI A;  1XQQ A;  2PMV A;  3EC8 A;  3A9K A;  1JWM D;  1WWT A;  1N61 A;  1AAR A;  4EZL A;  3JSV A;  1N5X A;  3A1Q B;  2KXJ A;  2INC C;  2D11 A;  1SXT A;  3L2E A;  2ZW0 A;  5EE9 A;  2RSU A;  2LFI A;  1UBQ A;  3DRB A;  3V3X A;  2C7H A;  3I5J C;  1V2Y A;  1ZXI A;  3TEX A;  4E71 A;  1TY2 A;  1U4A A;  3FKY A;  4IG7 B;  1MI0 A;  1T0R C;  3BY4 B;  4ICV A;  3ZLZ A;  1ACC A;  4KIK A;  3M95 A;  4KGS A;  3MP9 A;  4IKG A;  3R2I A;  3RFZ B;  4KX6 B;  3A4S C;  4YSX B;  4FAD A;  2ZNV B;  2H89 B;  4HDQ A;  2IDY A;  3MC8 A;  2CS4 A;  3PRZ A;  2C60 A;  2WS3 B;  3ZRC A;  2LAS A;  1FPY A;  2KVZ A;  1QOG A;  3BVM A;  1ET6 A;  3IAM 1;  2Y5C A;  3ZJU A;  4KSK C;  3VTV A;  5IAA C;  2KTR B;  3UI3 A;  3A1Q A;  1T6B X;  1NYQ A;  2BS3 B;  2R2Q A;  1N60 A;  4G11 A;  1B1Z A;  1JRO A;  2KKC A;  3QC8 B;  1K51 A;  2NVU I;  4EZK A;  1WXA A;  1XLQ A;  1Q1O A;  2LHD A;  3ONS A;  1Z2M A;  4ZRP A;  3WAP A;  4GU2 A;  4XE0 A;  4JWS C;  5D3D A;  2FUH B;  4CYE A;  4PYU A;  2WYQ A;  1ENF A;  3BYY B;  2NBV B;  3U52 E;  3ZTC A;  3P4R B;  4BBN F;  3EFC A;  4MEL A;  2WXF A;  3TMP B;  5LXI B;  1KJT A;  4PYZ A;  4M0W B;  1WXQ A;  1PUT A;  2GMI C;  2LJ5 A;  3KWL A;  4K7W A;  3SEB A;  2KTR A;  3DBS A;  4C7Y A;  2PW9 A;  3TBL D;  3VRA B;  3N1Z C;  4GGQ A;  3IG3 A;  2KFK B;  3MHZ A;  1KM7 A;  2LJI A;  4YTP B;  2MBO A;  1F1H A;  2KJ6 A;  3BIN A;  2D3G A;  1LQB A;  2QMT A;  1NDD A;  2O6V B;  3IXS A;  3B9J A;  2GBJ A;  2M4N A;  3AU5 A;  4HDO A;  2GWC A;  4K81 A;  1EF1 A;  4LNK A;  2CR5 A;  4ANV A;  1C9F A;  1K50 A;  1DOI A;  2JY6 A;  3VAW A;  2D5G A;  3PZ7 A;  4A9A A;  3FIL B;  2BTE A;  1H8C A;  3KUD B;  3DHH C;  4MGZ E;  4KDL B;  2WNM A;  5JHA A;  2AWT A;  4OZC A;  1X1M A;  3UF8 A;  2GBK A;  3MC9 A;  3PRM B;  2R2O A;  1NYR A;  4M0W A;  2NR2 A;  2IO2 B;  1CK1 A;  1OEY A;  4X57 B;  1GPX A;  2ONQ A;  3QHT A;  2YVC A;  1NI2 A;  2NTT A;  1PQS A;  2KMM A;  1WM3 A;  2IO3 B;  1FM0 D;  3PSE B;  5JHB A;  3PRP B;  4TSS A;  2FAZ A;  2KFK A;  2PJH A;  5CHW A;  1QLB B;  3V05 A;  4BOS C;  4F8C B;  2O6V A;  4DDG D;  1C79 A;  3ZYY X;  2WDR B;  4IC7 B;  5TR5 A;  2WDV B;  3AEC B;  3JU6 A;  2N9K A;  4N9F 4;  1RM6 C;  4CO7 A;  3I57 A;  5IOI A;  2GBN A;  2IGH A;  1MPE A;  2DZK A;  2L83 A;  1F9J A;  1OQY A;  1KLG D;  3TJP A;  3MFG A;  3NJT A;  3P2B A;  2ICI A;  3N9Y C;  3NZS A;  1G0W A;  1WJ6 A;  2WXQ A;  4TMA B;  4LLG M;  4FXC A;  2KWD A;  1PDX A;  3Q8F A;  4WAA A;  3KWV A;  3L16 A;  1ZDV A;  3Q3O C;  2JX5 A;  1J19 A;  1HEZ E;  1SB3 C;  3W9C B;  2K6D B;  1ESF A;  4WWP A;  1UUP A;  1L6V A;  5HKH A;  5HI1 A;  1RYJ A;  2NBU A;  3WA0 A;  2I1K A;  2WXM A;  2IO0 B;  4RF9 A;  2REX A;  1CMX B;  1WI0 A;  4MT5 A;  2Z0D B;  3L10 B;  1C3T A;  4GVZ A;  1I4Q A;  3HIZ A;  4NQK E;  2DEN B;  2ASQ A;  2KDM A;  1BUI C;  4JLC A;  3A33 B;  2SEB D;  3T9L A;  1E10 A;  1I4R A;  2JXT A;  2IND C;  3DBR I;  2ZW1 A;  3CIR B;  1S3S G;  2SAK A;  2QIL A;  3AUL A;  1I4H A;  4RM9 A;  2OJR A;  3DHI C;  1MVK A;  3TSS A;  1WXM A;  2MP2 B;  2V4L A;  1KLU D;  2BT6 A;  2RPV A;  4OZA A;  4BG4 A;  3DHG C;  4WJO A;  1T5X D;  2TSS A;  3RNA C;  3UIO B;  1KH0 A;  2KTF A;  2XK5 B;  3Q8E A;  3DVG Y;  2WHI A;  3HVZ A;  3V6E B;  3N3K B;  3U7Z A;  2UU7 A;  3JW0 X;  3AE3 B;  3Q8A A;  1QT9 A;  2B76 B;  5LLI A;  2WDQ B;  3IHP C;  1GOZ A;  2ZNV C;  3C8Y A;  2LGY A;  3LXF A;  2EMS A;  1DYQ A;  2LVP A;  1GAQ B;  2J0K A;  1V8C A;  2M56 B;  3NZ3 A;  3B2G A;  2WX0 A;  2G9H D;  3R7R A;  5JH5 C;  1C4P A;  2J53 A;  5IA7 A;  3WAO A;  1J8C A;  2WXL A;  2ZPY A;  1P52 A;  4TQ0 A;  2INP E;  3Q2A C;  4DBG A;  2BS2 B;  2JVC A;  3U7D A;  3VXW A;  4REZ A;  4XDC A;  4AQ7 A;  2M1M A;  1WY8 A;  2LVQ A;  2N7E A;  2KFJ A;  3EA6 A;  3FAH A;  2MP2 A;  2KD0 A;  2DAF A;  4ITK A;  2KQS A;  1VRA B;  2Z8L A;  3I3T B;  2WDT B;  3PZ8 A;  4JE3 B;  3ZDM C;  3OG5 A;  3R3M A;  4ANX A;  2IO1 B;  2J1Q A;  2CHX A;  3L2D A;  4ZDV A;  4AJY B;  5EDS A;  2VH1 A;  4IM0 A;  2RDH A;  4XWW A;  3DBH B;  2N9L A;  3W2D A;  4LJP B;  3H6N A;  2LZ6 A;  4I6N B;  4XDD A;  4PK1 A;  3HHM A;  3RMK C;  3ZNZ B;  4WJQ A;  2V3P A;  3NG0 A;  5BMI A;  3MTN B;  3KUC B;  4ZYN A;  3AN1 A;  1F2R C;  2EKI A;  3Q8C A;  1VZ6 A;  1WGR A;  1MG8 A;  3MJ5 A;  4KKJ A;  1N63 A;  3HM3 A;  1V9J A;  3AB5 A;  5LXH A;  3ZXV A;  2Y5P A;  1NVI D;  4IOI E;  1A70 A;  2D3A A;  4M01 A;  4Q2J A;  4GW2 A;  2VZK D;  1D4B A;  2KOX A;  3TCA A;  4A20 A;  3KYD D;  2C7N B;  2AEH A;  1EWY C;  3N30 A;  1HTO A;  4AP4 C;  5JXV A;  3IT6 B;  3IG5 A;  2WXR A; 
#chains in the Genus database with same CATH homology
 3ZXR A;  2UU7 A;  4RF6 A;  3L2E B;  2D3B A;  2CRK A;  4HPP A;  3B6R A;  2QC8 A;  1QK1 A;  3ZXV A;  4BAX A;  3DRE A;  3JU5 A;  4GVZ A;  2WGS A;  2J1Q A;  1HTQ A;  4LNK A;  3M10 A;  3NG0 A;  1I0E A;  1P52 A;  2BVC A;  3L2D A;  3L2E A;  1BG0 A;  5J9A A;  4AM1 A;  2D3A A;  1QH4 A;  4LNO A;  4GW2 A;  4S0R A;  1CRK A;  4GW0 A;  4BG4 B;  2LGS A;  4GVY A;  2D3C A;  4RF8 A;  4RF7 A;  4Z9M A;  3DRB A;  1U6R A;  4Q2R A;  1M15 A;  4LNI A;  3JU6 A;  4XYC A;  1G0W A;  2GLS A;  1VRP A;  1LGR A;  4BG4 A;  1F52 A;  3JPZ A;  3JQ3 A;  4RF9 A;  4ACF A;  4BHL A;  4LNF A;  2OJW A;  5J99 A;  1HTO A;  1FPY A;  1SD0 A;  1RL9 A;  4S17 A;  4LNN A;  2WHI A;  3FKY A;  1F1H A;  1P50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...