3ZXRA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
b'KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxrA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxrA02
2D3BA 3NG0A 2WHIA 4XYCA 2UU7A 3ZXVA 4BAXA 1SD0A 1P50A 3L2DA 4S0RA 4ACFA 1U6RA 4LNFA 4HPPA 1BG0A 3JU5A 4RF9A 1F52A 2D3AA 5J99A 4LNIA 1RL9A 1VRPA 3DREA 4RF6A 4BG4A 2CRKA 4Z9MA 4BG4B 1HTQA 4AM1A 4RF8A 3JU6A 3B6RA 4S17A 3FKYA 3JPZA 2GLSA 1LGRA 3DRBA 1FPYA 2LGSA 2J1QA 4BHLA 1QH4A 1F1HA 3JQ3A 5J9AA 3L2EA 4GW0A 1G0WA 1P52A 3L2EB 4LNKA 1M15A 2D3CA 3M10A 4GVZA 4Q2RA 4LNOA 2QC8A 3ZXRA 4GW2A 2BVCA 1CRKA 1HTOA 4RF7A 4GVYA 1I0EA 1QK1A 2OJWA 2WGSA 4LNNA
chains in the Genus database with same CATH superfamily
1M94A 4JX1C 2JZPA 1C1YB 4B0EA 2LUEA 4MGZE 1UNSA 1YNTE 2JY6A 1I4GA 1YX5B 3DVNU 5IOIA 4I6PA 2IY0B 2K25A 4HVBA 2C7NB 4N9F4 4ANXA 1C76A 1QILA 4TUUA 3GOEA 2VZKB 3Q3JA 3WALA 1D4BA 2M56B 3IAS1 3U4EG 4BOZB 3IT4B 1TS5A 5CX3A 1WJ6A 4GDLB 1B9RA 1QKZA 1I35A 3WA0A 1XXGA 3RNEC 4WIPA 4GMVA 2PVOD 2H88B 1QOFA 3P4PB 4KZ0A 2MWSB 3P42A 2O6VA 4RGOS 3WANA 2DZJA 2V3PA 4ICVA 4EKUA 3O13A 4K7UA 2QEJC 1R7SA 4WJQA 2K9XA 2V3SA 2N9LA 1I4HA 2LZ6A 3SDLC 3AE4B 4YSZB 1EUVB 3GE8C 2D2QA 2BPSA 3KUDB 1WX7A 3TEXA 3AE7B 4OVUA 3VXWA 4E71A 1X1MA 1IP9A 2MBHA 3CMMB 2ZCBA 2Z0DB 3OAWA 3N3KB 1K51A 4XYCA 2PPHA 1NYQA 1YQ3B 2FBWB 2KXJA 1HQRD 3NJTA 5KHQA 1VD2A 2KK8A 3R7QA 4IOIE 2MW5A 3CSTA 1A5RA 2D3GA 3NS1A 3KUZA 4FJVB 2I38A 3Q6BA 2LHDA 3VHTC 2WXOA 3A33B 1SF0A 3DWMA 4R3DA 2J42A 4MGIE 3Q3MC 3RYTA 1AYFA 2KLCA 1SEBD 2MA9B 3HUIA 1XCQL 4C00A 2QJLA 1ET6A 4RGMA 2DYOA 2MBQA 2N9KA 1MJDA 4W9EA 2NS5A 3WAOA 4W9CA 1ROEA 4FLHA 2OHFA 1E6EB 5IAAC 4RF9A 2WXKA 2ZCCA 2KJHB 2BKRB 3FILA 4ZYNA 2MLBA 1G6JA 2DWQA 2G9HD 3ECIA 2Y5PA 2L0TA 3APDA 2UU7A 4HJGE 2D3AA 3Q14C 4DDGD 2RD0A 3R2TA 4WWPA 4N6EB 4GDLA 4M00A 3MFGA 2L0FA 3WIMA 1KLUD 3PGEA 1TZOA 4I6LB 4K81A 1ZE3D 2NTTA 3SFEB 4WJPA 3DOWA 4ACFA 2JU6X 4JL9A 3TJPA 3HIZA 1P1AA 3ENEA 2MH7A 1ZXIA 4ZRKA 3UGBB 1F1HA 4MACA 1JWMD 1SIFA 3ZXRA 4WAFA 3PVLA 1KM7A 1D5XC 2QDFA 1LM8B 1TS4A 1CK1A 2ZW1A 1V5TA 2JSVX 3QAQA 5CHFA 3D32A 3A4SC 1GG3A 2BS2B 3L16A 2IYDB 4DDID 4IM3A 2XBBC 4KKJA 4JWUC 4RGNA 1GB1A 2J0KA 4HPLB 1UD7A 2HE7A 1EU3A 3AEDB 3QK0A 4XWTA 5C3JB 3UINB 2K3UA 1XD3B 4NPNA 2M19A 4IUMB 4RFBA 3S2AA 2IPKD 2LVOA 1VRAB 3LB8C 3NRZA 2WP9B 3RCZA 4LK0M 3K9PB 3LVWA 3KWLA 2DHZA 2ACZB 2DAFA 3IBEA 1UBQA 1F0ZA 1CQVA 4CO7A 3KYCD 4IM0A 1E90A 2PLPA 2DBYA 3VRAB 3Q3NC 1ZGUB 2KDEB 1KFYB 4YSXB 1WGKA 3QWZB 5J9AA 4W9GA 2G4SA 1WR1A 4FULA 4C7YA 4MDKE 2WLBA 4BKSD 1C77A 3AULA 3EHVA 4RF1A 3DBRB 2JWUA 2M8SA 4L1BA 1E5WA 3N1YC 3BYTB 3DVGX 3H7SA 4IC7B 3AEEB 1P52A 2NPTA 2RSUA 2EMTA 3PZ7A 2LWPA 2BVCA 2Q5WD 2LRUA 3TUOA 5LNK1 5G55A 1MVKA 3H1UA 2JPHA 2LD9A 4NZLB 3DBHI 2KFKB 1WE6A 3NVWA 2PEAA 4CQNA 1D5MC 4HK2A 3AE3B 4H2AA 3C0RB 1RWSA 2KDBA 3P4SB 4JPSA 4WWOA 1WWTA 4RM9A 3E9SA 3Q8BA 3LDZE 2GBRA 2MEKA 4W9FA 1KOTA 2IO2B 2KDIA 2WXMA 3Q8CA 4C80A 4ARIA 2G45B 3PHXB 1GPXA 2IY1B 2BTEA 1I4XA 5DPTA 4HROA 2EMSA 2XK5A 4M0WB 3UIPB 2UYZB 3U52E 5T8IA 1MI0A 1NVID 4US9A 1VZ8A 1D5ZC 2KKCA 4YL8A 4P1BC 4ANUA 2KDMA 2INDC 2G1EA 2J53A 2WXQA 1ZPSA 1T3QA 5D94A 1L0VB 1PGBA 1A70A 1JCKB 3QJZA 3RZWC 2E3TA 3W1SA 5IKCM 2L83A 4KKIA 1IYFA 5TSSA 2Z59B 2K1FA 4KZCA 1MHHE 1YQBA 1MG4A 5JH5C 1N60A 1V2YA 1XEEA 3VTUA 1HTQA 3I57A 5IA7A 1VLBA 2KWCA 2WNMA 1FCCC 2Z8LA 4GDKA 3VDZA 1R4NI 2L3ZA 1KRHA 4M02A 1YQ4B 2BQQA 3OG5A 4RF8A 4AOFA 3VUXA 2FAZA 2BYTA 3ZKJC 3NOBA 3I9V1 2RDHA 5J17A 4EE2A 2LEKA 2WS3B 2JXTA 1SE4A 3AE2B 3I5JC 4G3XB 3QA8A 3ZNID 1FEHA 2BS3B 4RH6A 2Z0EB 2M1MA 4PS3A 3MJ5A 2IO3B 1V6EA 1K8RB 4LTUA 2QILA 2ZPNA 3DWGC 3ZLZA 1ZOYB 1WJNA 4ZDVA 1VDVA 1Y8RC 4M01A 2M0XA 1WXSA 1FCLA 2N7JA 1MFWA 3DBSA 2WYQA 1BMLC 1OGWA 2DZKA 3EFUA 4GB9A 4DXFA 1L0YB 1I42A 5C2TB 4LCDE 5H8YE 2ZPYA 3RNBC 2LGIA 1IBXA 4LDTD 2YLMA 3N1XC 1QOGA 1ZXHA 3MC9A 2OOBB 1FXTB 3PHWB 3QHTA 1Z5SB 5G2NA 4A20A 5MPOA 3ZTDA 4Q2RA 2WDVB 1WYGA 1LQBA 3C8YA 2KACA 4AS1A 5KHOA 2MHJA 3PTFC 1F77A 3ZRFA 3H9DA 2W3SA 3AN1A 4YXDB 1TKEA 3HM3A 4IWQA 2AWTA 4M0WA 4ANVA 5FK9C 1TS3A 4L23A 3ZXVA 3OJ4B 4YWGG 2IO1B 4P1CC 3P2BA 1RL9A 1FNWA 2LXCA 3AU4A 4RF6A 4F8CB 5E6OA 2PKOA 4P6VF 3FILB 2KC1A 1WR6E 3TEWA 5HFYA 3A1QA 4J3OD 2KO3A 3Q8FA 2EKIA 3UQBA 2KVRA 5AEKB 2JRIB 1JROA 2LFIA 3KLSX 3VFKA 4FHJA 1YD8U 3B0AA 2JYTA 4IM2A 1WMHB 1SXTA 1L4ZB 2AL3A 2I1KA 2CU3A 1M15A 3APFA 3U7ZA 1KLVA 5L95C 2WXJA 4A3OA 3RI7C 2N4FA 4KGTA 2JF5A 4LNFA 1V97A 2I2YA 1VRPA 3W9CB 3RT3B 4HCNB 4K7SA 3UIOB 1FO4A 3V62A 5BMIA 3PRPB 3ZYYX 1MPEA 1NI2A 1AARA 4JWSC 4OZCA 2JZ3B 3L2EA 3CSFA 1C3TA 1UZXB 4KSLC 2HJ1A 5AZHA 5JHAA 1WZ3A 1YX6B 2EKEC 1GAQB 3U2SC 4EUTA 4GGQA 1N5XA 1SE9A 1L5PA 1Z2MA 3QX1A 1V1PB 3A9KA 4A9AA 4BZAA 1JRPA 5BMGA 3P4RB 1WE7A 3DDCB 2RR9A 5AZFA 4HDOA 1SBBB 3VR9B 3W1SC 3RFZB 3L10B 3W5UB 2WQYB 1OEYJ 1J7CA 3AEFB 1WGRA 4HKZE 3C19A 1WRDB 3EA6A 1WGDA 3B1LX 2BWES 2PMVA 1GUAB 4BBNF 2BB6A 2WDQB 1AWDA 4JE3B 2LRWA 4MELA 4URKA 3ML9A 1K52A 1YN3A 3E56A 1CMXB 2QIEB 3AE6B 1HA5A 4RNAA 5EDSA 2BT6A 1J7AA 4BFRA 1YJ1A 4WWNA 2VZKD 4QAYA 4XDCA 4JQWC 4PK1A 1RAXA 5E6PA 4LJOB 2DYBA 3MHZA 1BUIC 3ZO5B 1JALA 2N9PC 1PGAA 3ZTCA 1NYRA 1QT9A 5AUIA 3GZNI 3WCQA 3W2DA 5G5HA 1YIWA 3ZIMA 3IVFA 2JRHA 4MM3A 2NPTB 1EU4A 3QQ8B 3W5VB 4BKGA 2IDYA 2BW2A 1YJJA 3RMKC 3JSVA 4FHKA 4KIKA 5JZEB 2CHXA 4K3CA 3B2GA 3LXFA 2A5UA 3BVMA 1KH0A 3LYYA 4FBJB 1WY8A 1F2RI 1WMHA 3APCA 1FM0D 4HJKA 2MQJA 4ICUA 1PFDA 2AYOB 1ZP0B 3PPAA 3VRBB 3GE3C 3KVFB 1C78A 4WJNA 3TCAA 2JQRB 1J19A 1TZ1A 1YN5A 2XN9C 2RPVA 1NENB 2MJEA 1N5WA 1P7FA 5AZGA 2LGDA 1SIJA 1UBIA 2REXA 3TEYA 5EE9A 2XK5B 2D11A 1FXIA 2BS4B 2N9EB 2NTSA 3Q3OC 1U4AA 4TQ0A 2G4DB 1S3SG 4X57B 2CJOA 1V1PA 1C79A 4G0NB 4ITKA 1E7VA 4TV3A 1FMAD 4PS7A 3DHIC 4ZHPA 1JWUD 1GC6A 5BMHA 1ZKHA 2D3CA 3UI3A 4PYZA 3HVZA 1EWCA 1XF5L 2BGFA 3V05A 4B95A 2NBVB 4WQOB 2GWCA 1UH6A 3BWUD 4GIVA 4DXGA 3I63C 4ZYSA 1FNVA 3MP9A 1LGRA 3Q69A 3W1YA 3KUCB 1FIQA 4GDKB 4MEMA 5HHDG 4B6WA 2QSDA 4W9JA 2NR2A 1C4CA 4FADA 4W9KA 1JWSD 4ZRJA 2ONQA 1L0XB 2A4ZA 2D3BA 4US8A 1DGJA 4WAAA 4J6IA 2X38A 2AL6A 2RMMA 1QZEA 1XT9B 2ZJDA 3TSSA 2JVCA 2K0PA 2HTHA 4NQKE 3BZDB 4YSYB 4DHJD 3A9JA 1WF9A 3KW5B 4AJYB 1V1OA 3L08A 3L17A 1MG8A 3ONSA 4GN1A 4D2KA 2MP2A 4MT5A 3EUB2 1Q5WB 4EZJA 3BVZA 3MC8A 3WAPA 2BBCA 4BOSC 1XO3A 3NVVA 2HJ8A 1EO6A 1ZW7A 3SR6A 4XWWA 2OEDA 3P63A 3OLMD 5DCNA 1VZ7A 5IP4D 1PUTA 3T3OA 3IXSA 1C4AA 3L13A 1HE8A 1WRIA 1E8XA 4FN2A 3VUYA 3WAMA 2KQ7A 4NQLB 2KFJA 1UF0A 5FKAC 1T0YA 2KMCA 4RM8A 5EE0A 2FUHB 2FUG1 1GOZA 1IBXB 4K1RB 5G5GA 1VZ6A 4IWPA 4EEWA 4NAMA 2MCNB 1E7PB 1G0WA 1AW7A 4IWOA 1YOVB 2LXAA 2GI9A 2D5GA 1LFDA 1UELA 1N61A 4BKTA 2N9XA 2KWDA 3ZQ4A 3RNAC 2LI5A 3T9LA 3DPDA 4XZ4A 2BYFA 2JZZA 1H4RA 2WXHA 2KX3A 2ON8A 3V6CB 1RRBA 4EZKA 5JHBA 4BKSA 5L83A 2MRPA 3KWVA 4KGSA 3NG0A 4MGYE 1JQ4A 5JXVA 2IZVB 5DPSA 2HD5B 2BWFA 5E6NA 3ALBA 4PYUA 5C1ZA 2L1AA 3EFCA 4NAWA 3QIJA 4NNJB 4KV2A 2NMQA 5EE1A 4G11A 1QQRA 2DYMA 4OVVA 2K6QA 3A1QB 2W55A 1XQQA 1PDXA 4XDDA 1PYWD 3DBHB 1GNUA 2VH2A 3NUHB 3UF8A 1YN4A 4NJCA 3H7PA 3IFWB 2W3RA 1J0GA 2DZMA 2AQ1B 2QCZA 3O65B 2SEBD 1NBFC 2L32A 3IT6B 4WWMA 5HG2A 4KX6B 4BHLA 3IHPC 2QMTA 5HI1A 3AH7A 2MBOA 3M10A 4EOYA 4YTMB 2RDGA 1R8GA 1T6BX 2CU1A 3HM6X 1E8YA 3M3JA 5J18A 3NZUA 3RUIB 1KJTA 4DHZE 5AUKA 2H89B 2W9NA 1AN8A 3L2EB 1SB3C 3TEZA 2GRIA 1LXDA 2KX0A 1ET9A 5FR6A 4F7ZA 1J8CA 2MX2A 2KHWB 2NCNA 1EWYC 3A9KB 1WFYA 1V4GA 1TYGB 4E74A 1WXMA 2GOWA 2L05A 3PLUA 2JX5A 2RPQA 3URYA 4GW0A 2KTFA 3A4RA 1L6VA 2QC8A 2XNAC 4AUQC 1XLQA 4IDIA 3VQIA 4W9IA 4NJ6A 1R4NB 2C7MB 1EM7A 1FXAA 1K50A 1TKGA 4DQOC 3AMZA 3U8ZA 2L52A 2GLSA 2WDRB 1WH3A 2Y5CA 4LNOA 4OVZA 3L54A 4RMAA 1DOYA 4RF7A 4AJWA 4GVYA 3LVVA 3AXCA 3DVNV 3IG3A 3LJ3A 3T3NA 4HCPB 4XE0A 3SU8X 1V49A 4FJZA 3ZNHB 4IG7B 4REZA 2DLBA 2M4NA 3GS2A 1JWAD 1WM3A 3ABVB 3VH4B 5IO9A 4AM1A 4K3BA 2BF8B 4MJSA 3I3TB 1M4VA 1YMHE 3P4QB 2KTRA 3PV1A 4AP4C 2R61A 2B3AA 2MSED 1VJKA 1D6EC 2ZNVC 3B9JA 5FR3A 4IW0A 4PS8A 3HHMA 2YVCA 4KVGB 1HZ6A 3LN6A 4ZRQA 2V4LA 2OJRA 1DOIA 3AECB 2IJ0A 2LHEA 1FPYA 3SFDB 4BVUC 2LMCA 2N7EA 1HXYD 1NI3A 2O6VD 4A8XC 4MM3B 4GW2A 2CKHB 2M17A 5D3DA 3BINA 3JSVB 4KIKB 2FIDA 1C9FA 5TR5A 5IN7A 1WXQA 3FAHA 3JVZX 3R2IA 4YTNB 2W82A 1V80A 2JXXA 2N0SB 2J4XA 4GVZA 5DPWA 2VRRB 2PE9A 1DYQA 2YEPF 4KDIC 1P7EA 4DHZB 2GBNA 3AEAB 2LJIA 4LNIA 1K53A 4B9KA 4N58A 3AU5A 3IG5A 3AE9B 1QF6A 3N20C 3R3MA 3ZNGC 3AEBB 3IG8A 3AE1B 2IO0B 4RGTA 1TY2A 2INCC 3PT2B 1L7YA 4A3PA 5LLIA 4C7ZA 5D2MB 3OWEB 2XEWA 3BYYB 1P50A 1FFUA 3EC8A 2PVGC 3NS8A 2LUMA 2GBKA 3HRDD 2M0AA 3U7DA 2FCMA 3AEGB 4PT5A 2MJ3A 4S17A 2K8BA 2IGDA 4I6NB 3PSEB 2ZZPB 4HDQA 2G3QB 1TBEA 1UWMA 3PREA 2BB5A 2IGGA 1VA6A 4TMAB 1WXAA 2K6DB 3B08A 1U6RA 2BYVE 1F2RC 2RGFA 1D3ZA 3DHGC 1L6UA 4DWFA 1Q1OA 4A55A 4WJOA 2NBWB 3DREA 4BG4A 5BO4B 3X23A 1TY0A 1DOXA 2GBJA 3MJWA 2LASA 3DRBA 2MJDA 2HTME 4CHKA 2KVZA 4N59A 5HKHA 1R4MI 2FCSA 2JYEA 3NZSA 4XGAB 3AI5A 2WGSA 1RFKA 3RN9C 4HLEA 5DPRA 2W54A 4GLSC 1C4PA 2LVQA 3VVWB 1N63A 2WU2B 2FNJB 3N1ZC 5I4DA 3NVYA 1E8WA 3ZUNA 2ICIA 2KANA 5LXIB 1EF5A 2KYWA 3A9JB 4LJPB 1SGHA 1T0QC 2ZNVB 4P16A 4DXAB 4II2B 1ZDXA 3ZJTA 3V60A 1SD0A 4CYEA 2MP2B 2INNE 4JGHB 1UWXA 5BYRA 3GB1A 2KT7A 2DENB 4C4VA 1JMLA 3QARA 4ASWC 1SJHD 1I4PA 1ZDVA 3FC4A 3CWIA 4MH0E 1QH4A 2NVUI 3PLVA 1XLPA 1I4QA 2IBIB 2OJWA 2TSSA 2KJRA 1R4MB 1STEA 4WH4A 1TT4A 2KDFB 2DX5B 2CR5A 4FA6A 3CIRB 1N62A 4ZRIA 1N6ZA 1WGHA 1WJ4A 1RM6C 1UUPA 3M95A 4NY0A 2VH1A 2KWVB 2NBUA 1P3QU 1ZUD2 2WWZA 1ESFA 1T0SC 1WM2A 2FCNA 5D7GA 1ACCA 2GB1A 2WX1A 4HKQA 2CJNA 2GWDA 3DVGY 4MSMB 2WXFA 3MC0B 2Y3AA 4DHJB 4KGRA 4LLGM 1KF6B 2KN5A 4IKGA 4OW0A 3VUWA 4C56C 3SD5A 4A6QA 3JYUA 3HVDA 2C7HA 2PTLA 1FFVA 1SJED 2J52A 3GZNB 3LN7A 1J7BA 3PO0A 5D6JB 2QHOA 4EFOA 1SE2A 3BVGA 5E6JA 2L7RA 1E7UA 2PIAA 2ZVNA 4K7WA 2Y5BB 1VCBA 2GBMA 2KD0A 2MBEA 1F9JA 4MSQB 4B0MA 4HXDA 3KYDD 2FCQA 2CRKA 3B2FA 4USAA 3NHEB 3B6RA 1WYWB 1OQYA 4NAWB 1FD6A 2WXGA 2K8CA 4GOCA 4MGKE 4LNKA 4P7IA 1E10A 3TL5A 2KNBA 3ZDMC 3N30A 3R7RA 2MBBB 2PJHA 2KAJA 2V0GA 3H7PB 1P98A 5BYSA 1TJEA 1VR9A 4M8NA 1GB4A 2JUOA 2D32A 2J1QA 2GMIC 1WZ0A 2EELA 2L00B 2SAKA 3DBRI 3NZTA 1YJIA 4YTPB 1IUEA 4OZBA 4BAXA 3L2DA 2KQSA 4E3CA 5D3IB 3JU5A 3NVZA 4W9DA 1WX9A 4GSWA 1UGMA 2LVPA 2CHZA 2KMAA 1WIAA 3EGRA 3ETRA 1E9MA 3VR8B 5CHVC 2CHWA 2K22A 4OHJA 4L2YA 4HRSA 2X8XX 1HZ5A 4HPMB 1BT0A 1V8CA 4AQ7A 1I7HA 3HK0A 3M62B 2V9HA 3ZGZA 1JWBD 3VTWA 3EECA 3BIID 1L2NA 2C9WB 1WGYA 2LGXA 2R2OA 3TMPB 4A90A 2ZEQA 2LJ5A 2INPE 2N1WA 2V4IB 3PS6A 3DQVA 4W9LA 4ZOHC 3V6EB 3L0WB 1T0RC 3DBLI 3GP7A 4AWJA 4ZHOA 3AE5B 3AM9A 2WXIA 1ENFA 1V9JA 2ZVOA 4TKNA 3P1MA 3TBLD 2N1VA 1BG0A 2PE6B 1QOBA 1TS2A 2KQ4X 2L8JA 3IAM1 1XCTL 1WXVA 1FRRA 3PRZA 2PW9A 3UQAA 1P9DU 2KJ6A 3JPZA 3KQ4A 5J2RA 3V3XA 1V5OA 2BKFA 4II3B 1SE3A 3CF6E 2IGHA 2C5LC 3ZVVA 1V81A 2WHIA 2C60A 5GMVA 2J7QB 2K39A 3L4PA 1OQRA 4KDLB 3RNFC 2R2QA 1P0RA 3X0WA 1WSPA 4GU2A 3RULA 5H92C 1WJUA 4MJSB 3RNCC 2KMMA 2WU5B 2RDBC 4BBNC 2KTRB 5BYQA 3M63B 4M8MA 1PQSA 3NY5A 3DBLB 2I1JA 4HPPA 3ZW3A 5CTRC 3OJ3A 1RLFA 1CZPA 2O2VB 3BK2A 3VH3B 4ARCA 1OQQA 1JRUA 3FKYA 3ZRCA 3JW0X 2WXPA 1GC7A 1KTKA 2WX0A 4F1SA 2LGYA 4ZRPA 3RD2A 3Q2AC 5EE3A 4HEA1 1LO5D 4KSKC 2V3NA 3J9CA 2DZIA 4LDTB 3QCAA 4S0RA 2AQ3B 2FE8A 4WQMA 1QOAA 4G50A 1FNUA 4OZAA 2KLGA 1OFFA 1NEKB 4YT0B 2ZW0A 4RF0A 3H8HA 1NDDA 2UWQA 3PRMB 3ZNZB 1RYJA 3RNGC 2WXRA 2CS4A 2KWUB 3MHSD 2V1YA 1OTRB 1FRDA 1XLOA 1PGXA 1L4DB 2D07B 5GXGB 4JLCA 3SHQA 4RCOA 2D33A 3ZDTA 2AQ2B 1GJZA 1TT5B 1WI0A 1IGCA 2YEPB 1Y56A 3BY4B 4XX5A 3SEBA 3VAWA 4UDUC 4NJ7A 1HTOA 1I0EA 3BK1A 3NZ3A 1CJEA 2KN4A 2O6VB 2AX5A 4FXCA 1RFAA 4MH8A 3H6NA 2HDEA 1WGGA 3Q8EA 3DCGA 3VTVA 2DAJA 2D10A 2B76B 1IGDA 2K8HA 3R66C 4LNNA 3T8MA 4WURA 2JT4B 4GXBA 1E8ZA 3Q3FA 3ML8A 1B1ZA 1F52A 1KLGD 5C23A 4Z9MA 4BG4B 1S1QB 2JWZA 3PZ8A 2L76A 3ZJUA 2J0MA 1QLBB 4W9HA 2LGSA 2WXLA 3JQ3A 4ANWA 3RPFC 2WXNA 4XC2A 3Q8AA 2ASQA 2N7DA 1TGZB 2DNFA 1ISNA 1XLNA 4EZLA 4O1NA 3V61A 3K9OB 1SSNA 3R8BA 3RZFA 3ZJVA 4TQ1A 5J99A 2KZRA 3AE8B 3N9YC 1T5XD 5LXHA 3MTNB 1E0ZA 1H8CA 2KFKA 2K5PA 4FJYA 1I4RA 3TIXA 1MHXA 2J0JA 4JIOU 4Q2JA 2AEHA 3QC8B 3KH0A 1HEZE 2BYEA 1Q10A 4DK5A 1V86A 1OEYA 4TSSA 3AB5A 1EF1A 4DBGA 1IPGA 3DHHC 2E6XA 4HWIB 3N32A 1BXTA 5CHWA 3JU6A 2O2VA 4C4VB 3U30A 3AV8A 2KOXA 2FIFA 1TIFA 1UGJA 1TTNA 1JW9D 1TKYA 1WX8A 2KC2A 2WDTB 3PZDA 1CRKA 1Q0WB 1QK1A
chains in the Genus database with same CATH topology
2D3BA 3NG0A 2WHIA 4XYCA 2UU7A 3ZXVA 4BAXA 1SD0A 1P50A 3L2DA 4S0RA 4ACFA 1U6RA 4LNFA 4HPPA 1BG0A 3JU5A 4RF9A 1F52A 2D3AA 5J99A 4LNIA 1RL9A 1VRPA 3DREA 4RF6A 4BG4A 2CRKA 4Z9MA 4BG4B 1HTQA 4AM1A 4RF8A 3JU6A 3B6RA 4S17A 3FKYA 3JPZA 2GLSA 1LGRA 3DRBA 1FPYA 2LGSA 2J1QA 4BHLA 1QH4A 1F1HA 3JQ3A 5J9AA 3L2EA 4GW0A 1G0WA 1P52A 3L2EB 4LNKA 1M15A 2D3CA 3M10A 4GVZA 4Q2RA 4LNOA 2QC8A 3ZXRA 4GW2A 2BVCA 1CRKA 1HTOA 4RF7A 4GVYA 1I0EA 1QK1A 2OJWA 2WGSA 4LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3B A;  3NG0 A;  2WHI A;  4XYC A;  2UU7 A;  3ZXV A;  4BAX A;  1SD0 A;  1P50 A;  3L2D A;  4S0R A;  4ACF A;  1U6R A;  4LNF A;  4HPP A;  1BG0 A;  3JU5 A;  4RF9 A;  1F52 A;  2D3A A;  5J99 A;  4LNI A;  1RL9 A;  1VRP A;  3DRE A;  4RF6 A;  4BG4 A;  2CRK A;  4Z9M A;  4BG4 B;  1HTQ A;  4AM1 A;  4RF8 A;  3JU6 A;  3B6R A;  4S17 A;  3FKY A;  3JPZ A;  2GLS A;  1LGR A;  3DRB A;  1FPY A;  2LGS A;  2J1Q A;  4BHL A;  1QH4 A;  1F1H A;  3JQ3 A;  5J9A A;  3L2E A;  4GW0 A;  1G0W A;  1P52 A;  3L2E B;  4LNK A;  1M15 A;  2D3C A;  3M10 A;  4GVZ A;  4Q2R A;  4LNO A;  2QC8 A;  3ZXR A;  4GW2 A;  2BVC A;  1CRK A;  1HTO A;  4RF7 A;  4GVY A;  1I0E A;  1QK1 A;  2OJW A;  2WGS A;  4LNN A; 
#chains in the Genus database with same CATH topology
 1M94 A;  4JX1 C;  2JZP A;  1C1Y B;  4B0E A;  2LUE A;  4MGZ E;  1UNS A;  1YNT E;  2JY6 A;  1I4G A;  1YX5 B;  3DVN U;  5IOI A;  4I6P A;  2IY0 B;  2K25 A;  4HVB A;  2C7N B;  4N9F 4;  4ANX A;  1C76 A;  1QIL A;  4TUU A;  3GOE A;  2VZK B;  3Q3J A;  3WAL A;  1D4B A;  2M56 B;  3IAS 1;  3U4E G;  4BOZ B;  3IT4 B;  1TS5 A;  5CX3 A;  1WJ6 A;  4GDL B;  1B9R A;  1QKZ A;  1I35 A;  3WA0 A;  1XXG A;  3RNE C;  4WIP A;  4GMV A;  2PVO D;  2H88 B;  1QOF A;  3P4P B;  4KZ0 A;  2MWS B;  3P42 A;  2O6V A;  4RGO S;  3WAN A;  2DZJ A;  2V3P A;  4ICV A;  4EKU A;  3O13 A;  4K7U A;  2QEJ C;  1R7S A;  4WJQ A;  2K9X A;  2V3S A;  2N9L A;  1I4H A;  2LZ6 A;  3SDL C;  3AE4 B;  4YSZ B;  1EUV B;  3GE8 C;  2D2Q A;  2BPS A;  3KUD B;  1WX7 A;  3TEX A;  3AE7 B;  4OVU A;  3VXW A;  4E71 A;  1X1M A;  1IP9 A;  2MBH A;  3CMM B;  2ZCB A;  2Z0D B;  3OAW A;  3N3K B;  1K51 A;  4XYC A;  2PPH A;  1NYQ A;  1YQ3 B;  2FBW B;  2KXJ A;  1HQR D;  3NJT A;  5KHQ A;  1VD2 A;  2KK8 A;  3R7Q A;  4IOI E;  2MW5 A;  3CST A;  1A5R A;  2D3G A;  3NS1 A;  3KUZ A;  4FJV B;  2I38 A;  3Q6B A;  2LHD A;  3VHT C;  2WXO A;  3A33 B;  1SF0 A;  3DWM A;  4R3D A;  2J42 A;  4MGI E;  3Q3M C;  3RYT A;  1AYF A;  2KLC A;  1SEB D;  2MA9 B;  3HUI A;  1XCQ L;  4C00 A;  2QJL A;  1ET6 A;  4RGM A;  2DYO A;  2MBQ A;  2N9K A;  1MJD A;  4W9E A;  2NS5 A;  3WAO A;  4W9C A;  1ROE A;  4FLH A;  2OHF A;  1E6E B;  5IAA C;  4RF9 A;  2WXK A;  2ZCC A;  2KJH B;  2BKR B;  3FIL A;  4ZYN A;  2MLB A;  1G6J A;  2DWQ A;  2G9H D;  3ECI A;  2Y5P A;  2L0T A;  3APD A;  2UU7 A;  4HJG E;  2D3A A;  3Q14 C;  4DDG D;  2RD0 A;  3R2T A;  4WWP A;  4N6E B;  4GDL A;  4M00 A;  3MFG A;  2L0F A;  3WIM A;  1KLU D;  3PGE A;  1TZO A;  4I6L B;  4K81 A;  1ZE3 D;  2NTT A;  3SFE B;  4WJP A;  3DOW A;  4ACF A;  2JU6 X;  4JL9 A;  3TJP A;  3HIZ A;  1P1A A;  3ENE A;  2MH7 A;  1ZXI A;  4ZRK A;  3UGB B;  1F1H A;  4MAC A;  1JWM D;  1SIF A;  3ZXR A;  4WAF A;  3PVL A;  1KM7 A;  1D5X C;  2QDF A;  1LM8 B;  1TS4 A;  1CK1 A;  2ZW1 A;  1V5T A;  2JSV X;  3QAQ A;  5CHF A;  3D32 A;  3A4S C;  1GG3 A;  2BS2 B;  3L16 A;  2IYD B;  4DDI D;  4IM3 A;  2XBB C;  4KKJ A;  4JWU C;  4RGN A;  1GB1 A;  2J0K A;  4HPL B;  1UD7 A;  2HE7 A;  1EU3 A;  3AED B;  3QK0 A;  4XWT A;  5C3J B;  3UIN B;  2K3U A;  1XD3 B;  4NPN A;  2M19 A;  4IUM B;  4RFB A;  3S2A A;  2IPK D;  2LVO A;  1VRA B;  3LB8 C;  3NRZ A;  2WP9 B;  3RCZ A;  4LK0 M;  3K9P B;  3LVW A;  3KWL A;  2DHZ A;  2ACZ B;  2DAF A;  3IBE A;  1UBQ A;  1F0Z A;  1CQV A;  4CO7 A;  3KYC D;  4IM0 A;  1E90 A;  2PLP A;  2DBY A;  3VRA B;  3Q3N C;  1ZGU B;  2KDE B;  1KFY B;  4YSX B;  1WGK A;  3QWZ B;  5J9A A;  4W9G A;  2G4S A;  1WR1 A;  4FUL A;  4C7Y A;  4MDK E;  2WLB A;  4BKS D;  1C77 A;  3AUL A;  3EHV A;  4RF1 A;  3DBR B;  2JWU A;  2M8S A;  4L1B A;  1E5W A;  3N1Y C;  3BYT B;  3DVG X;  3H7S A;  4IC7 B;  3AEE B;  1P52 A;  2NPT A;  2RSU A;  2EMT A;  3PZ7 A;  2LWP A;  2BVC A;  2Q5W D;  2LRU A;  3TUO A;  5LNK 1;  5G55 A;  1MVK A;  3H1U A;  2JPH A;  2LD9 A;  4NZL B;  3DBH I;  2KFK B;  1WE6 A;  3NVW A;  2PEA A;  4CQN A;  1D5M C;  4HK2 A;  3AE3 B;  4H2A A;  3C0R B;  1RWS A;  2KDB A;  3P4S B;  4JPS A;  4WWO A;  1WWT A;  4RM9 A;  3E9S A;  3Q8B A;  3LDZ E;  2GBR A;  2MEK A;  4W9F A;  1KOT A;  2IO2 B;  2KDI A;  2WXM A;  3Q8C A;  4C80 A;  4ARI A;  2G45 B;  3PHX B;  1GPX A;  2IY1 B;  2BTE A;  1I4X A;  5DPT A;  4HRO A;  2EMS A;  2XK5 A;  4M0W B;  3UIP B;  2UYZ B;  3U52 E;  5T8I A;  1MI0 A;  1NVI D;  4US9 A;  1VZ8 A;  1D5Z C;  2KKC A;  4YL8 A;  4P1B C;  4ANU A;  2KDM A;  2IND C;  2G1E A;  2J53 A;  2WXQ A;  1ZPS A;  1T3Q A;  5D94 A;  1L0V B;  1PGB A;  1A70 A;  1JCK B;  3QJZ A;  3RZW C;  2E3T A;  3W1S A;  5IKC M;  2L83 A;  4KKI A;  1IYF A;  5TSS A;  2Z59 B;  2K1F A;  4KZC A;  1MHH E;  1YQB A;  1MG4 A;  5JH5 C;  1N60 A;  1V2Y A;  1XEE A;  3VTU A;  1HTQ A;  3I57 A;  5IA7 A;  1VLB A;  2KWC A;  2WNM A;  1FCC C;  2Z8L A;  4GDK A;  3VDZ A;  1R4N I;  2L3Z A;  1KRH A;  4M02 A;  1YQ4 B;  2BQQ A;  3OG5 A;  4RF8 A;  4AOF A;  3VUX A;  2FAZ A;  2BYT A;  3ZKJ C;  3NOB A;  3I9V 1;  2RDH A;  5J17 A;  4EE2 A;  2LEK A;  2WS3 B;  2JXT A;  1SE4 A;  3AE2 B;  3I5J C;  4G3X B;  3QA8 A;  3ZNI D;  1FEH A;  2BS3 B;  4RH6 A;  2Z0E B;  2M1M A;  4PS3 A;  3MJ5 A;  2IO3 B;  1V6E A;  1K8R B;  4LTU A;  2QIL A;  2ZPN A;  3DWG C;  3ZLZ A;  1ZOY B;  1WJN A;  4ZDV A;  1VDV A;  1Y8R C;  4M01 A;  2M0X A;  1WXS A;  1FCL A;  2N7J A;  1MFW A;  3DBS A;  2WYQ A;  1BML C;  1OGW A;  2DZK A;  3EFU A;  4GB9 A;  4DXF A;  1L0Y B;  1I42 A;  5C2T B;  4LCD E;  5H8Y E;  2ZPY A;  3RNB C;  2LGI A;  1IBX A;  4LDT D;  2YLM A;  3N1X C;  1QOG A;  1ZXH A;  3MC9 A;  2OOB B;  1FXT B;  3PHW B;  3QHT A;  1Z5S B;  5G2N A;  4A20 A;  5MPO A;  3ZTD A;  4Q2R A;  2WDV B;  1WYG A;  1LQB A;  3C8Y A;  2KAC A;  4AS1 A;  5KHO A;  2MHJ A;  3PTF C;  1F77 A;  3ZRF A;  3H9D A;  2W3S A;  3AN1 A;  4YXD B;  1TKE A;  3HM3 A;  4IWQ A;  2AWT A;  4M0W A;  4ANV A;  5FK9 C;  1TS3 A;  4L23 A;  3ZXV A;  3OJ4 B;  4YWG G;  2IO1 B;  4P1C C;  3P2B A;  1RL9 A;  1FNW A;  2LXC A;  3AU4 A;  4RF6 A;  4F8C B;  5E6O A;  2PKO A;  4P6V F;  3FIL B;  2KC1 A;  1WR6 E;  3TEW A;  5HFY A;  3A1Q A;  4J3O D;  2KO3 A;  3Q8F A;  2EKI A;  3UQB A;  2KVR A;  5AEK B;  2JRI B;  1JRO A;  2LFI A;  3KLS X;  3VFK A;  4FHJ A;  1YD8 U;  3B0A A;  2JYT A;  4IM2 A;  1WMH B;  1SXT A;  1L4Z B;  2AL3 A;  2I1K A;  2CU3 A;  1M15 A;  3APF A;  3U7Z A;  1KLV A;  5L95 C;  2WXJ A;  4A3O A;  3RI7 C;  2N4F A;  4KGT A;  2JF5 A;  4LNF A;  1V97 A;  2I2Y A;  1VRP A;  3W9C B;  3RT3 B;  4HCN B;  4K7S A;  3UIO B;  1FO4 A;  3V62 A;  5BMI A;  3PRP B;  3ZYY X;  1MPE A;  1NI2 A;  1AAR A;  4JWS C;  4OZC A;  2JZ3 B;  3L2E A;  3CSF A;  1C3T A;  1UZX B;  4KSL C;  2HJ1 A;  5AZH A;  5JHA A;  1WZ3 A;  1YX6 B;  2EKE C;  1GAQ B;  3U2S C;  4EUT A;  4GGQ A;  1N5X A;  1SE9 A;  1L5P A;  1Z2M A;  3QX1 A;  1V1P B;  3A9K A;  4A9A A;  4BZA A;  1JRP A;  5BMG A;  3P4R B;  1WE7 A;  3DDC B;  2RR9 A;  5AZF A;  4HDO A;  1SBB B;  3VR9 B;  3W1S C;  3RFZ B;  3L10 B;  3W5U B;  2WQY B;  1OEY J;  1J7C A;  3AEF B;  1WGR A;  4HKZ E;  3C19 A;  1WRD B;  3EA6 A;  1WGD A;  3B1L X;  2BWE S;  2PMV A;  1GUA B;  4BBN F;  2BB6 A;  2WDQ B;  1AWD A;  4JE3 B;  2LRW A;  4MEL A;  4URK A;  3ML9 A;  1K52 A;  1YN3 A;  3E56 A;  1CMX B;  2QIE B;  3AE6 B;  1HA5 A;  4RNA A;  5EDS A;  2BT6 A;  1J7A A;  4BFR A;  1YJ1 A;  4WWN A;  2VZK D;  4QAY A;  4XDC A;  4JQW C;  4PK1 A;  1RAX A;  5E6P A;  4LJO B;  2DYB A;  3MHZ A;  1BUI C;  3ZO5 B;  1JAL A;  2N9P C;  1PGA A;  3ZTC A;  1NYR A;  1QT9 A;  5AUI A;  3GZN I;  3WCQ A;  3W2D A;  5G5H A;  1YIW A;  3ZIM A;  3IVF A;  2JRH A;  4MM3 A;  2NPT B;  1EU4 A;  3QQ8 B;  3W5V B;  4BKG A;  2IDY A;  2BW2 A;  1YJJ A;  3RMK C;  3JSV A;  4FHK A;  4KIK A;  5JZE B;  2CHX A;  4K3C A;  3B2G A;  3LXF A;  2A5U A;  3BVM A;  1KH0 A;  3LYY A;  4FBJ B;  1WY8 A;  1F2R I;  1WMH A;  3APC A;  1FM0 D;  4HJK A;  2MQJ A;  4ICU A;  1PFD A;  2AYO B;  1ZP0 B;  3PPA A;  3VRB B;  3GE3 C;  3KVF B;  1C78 A;  4WJN A;  3TCA A;  2JQR B;  1J19 A;  1TZ1 A;  1YN5 A;  2XN9 C;  2RPV A;  1NEN B;  2MJE A;  1N5W A;  1P7F A;  5AZG A;  2LGD A;  1SIJ A;  1UBI A;  2REX A;  3TEY A;  5EE9 A;  2XK5 B;  2D11 A;  1FXI A;  2BS4 B;  2N9E B;  2NTS A;  3Q3O C;  1U4A A;  4TQ0 A;  2G4D B;  1S3S G;  4X57 B;  2CJO A;  1V1P A;  1C79 A;  4G0N B;  4ITK A;  1E7V A;  4TV3 A;  1FMA D;  4PS7 A;  3DHI C;  4ZHP A;  1JWU D;  1GC6 A;  5BMH A;  1ZKH A;  2D3C A;  3UI3 A;  4PYZ A;  3HVZ A;  1EWC A;  1XF5 L;  2BGF A;  3V05 A;  4B95 A;  2NBV B;  4WQO B;  2GWC A;  1UH6 A;  3BWU D;  4GIV A;  4DXG A;  3I63 C;  4ZYS A;  1FNV A;  3MP9 A;  1LGR A;  3Q69 A;  3W1Y A;  3KUC B;  1FIQ A;  4GDK B;  4MEM A;  5HHD G;  4B6W A;  2QSD A;  4W9J A;  2NR2 A;  1C4C A;  4FAD A;  4W9K A;  1JWS D;  4ZRJ A;  2ONQ A;  1L0X B;  2A4Z A;  2D3B A;  4US8 A;  1DGJ A;  4WAA A;  4J6I A;  2X38 A;  2AL6 A;  2RMM A;  1QZE A;  1XT9 B;  2ZJD A;  3TSS A;  2JVC A;  2K0P A;  2HTH A;  4NQK E;  3BZD B;  4YSY B;  4DHJ D;  3A9J A;  1WF9 A;  3KW5 B;  4AJY B;  1V1O A;  3L08 A;  3L17 A;  1MG8 A;  3ONS A;  4GN1 A;  4D2K A;  2MP2 A;  4MT5 A;  3EUB 2;  1Q5W B;  4EZJ A;  3BVZ A;  3MC8 A;  3WAP A;  2BBC A;  4BOS C;  1XO3 A;  3NVV A;  2HJ8 A;  1EO6 A;  1ZW7 A;  3SR6 A;  4XWW A;  2OED A;  3P63 A;  3OLM D;  5DCN A;  1VZ7 A;  5IP4 D;  1PUT A;  3T3O A;  3IXS A;  1C4A A;  3L13 A;  1HE8 A;  1WRI A;  1E8X A;  4FN2 A;  3VUY A;  3WAM A;  2KQ7 A;  4NQL B;  2KFJ A;  1UF0 A;  5FKA C;  1T0Y A;  2KMC A;  4RM8 A;  5EE0 A;  2FUH B;  2FUG 1;  1GOZ A;  1IBX B;  4K1R B;  5G5G A;  1VZ6 A;  4IWP A;  4EEW A;  4NAM A;  2MCN B;  1E7P B;  1G0W A;  1AW7 A;  4IWO A;  1YOV B;  2LXA A;  2GI9 A;  2D5G A;  1LFD A;  1UEL A;  1N61 A;  4BKT A;  2N9X A;  2KWD A;  3ZQ4 A;  3RNA C;  2LI5 A;  3T9L A;  3DPD A;  4XZ4 A;  2BYF A;  2JZZ A;  1H4R A;  2WXH A;  2KX3 A;  2ON8 A;  3V6C B;  1RRB A;  4EZK A;  5JHB A;  4BKS A;  5L83 A;  2MRP A;  3KWV A;  4KGS A;  3NG0 A;  4MGY E;  1JQ4 A;  5JXV A;  2IZV B;  5DPS A;  2HD5 B;  2BWF A;  5E6N A;  3ALB A;  4PYU A;  5C1Z A;  2L1A A;  3EFC A;  4NAW A;  3QIJ A;  4NNJ B;  4KV2 A;  2NMQ A;  5EE1 A;  4G11 A;  1QQR A;  2DYM A;  4OVV A;  2K6Q A;  3A1Q B;  2W55 A;  1XQQ A;  1PDX A;  4XDD A;  1PYW D;  3DBH B;  1GNU A;  2VH2 A;  3NUH B;  3UF8 A;  1YN4 A;  4NJC A;  3H7P A;  3IFW B;  2W3R A;  1J0G A;  2DZM A;  2AQ1 B;  2QCZ A;  3O65 B;  2SEB D;  1NBF C;  2L32 A;  3IT6 B;  4WWM A;  5HG2 A;  4KX6 B;  4BHL A;  3IHP C;  2QMT A;  5HI1 A;  3AH7 A;  2MBO A;  3M10 A;  4EOY A;  4YTM B;  2RDG A;  1R8G A;  1T6B X;  2CU1 A;  3HM6 X;  1E8Y A;  3M3J A;  5J18 A;  3NZU A;  3RUI B;  1KJT A;  4DHZ E;  5AUK A;  2H89 B;  2W9N A;  1AN8 A;  3L2E B;  1SB3 C;  3TEZ A;  2GRI A;  1LXD A;  2KX0 A;  1ET9 A;  5FR6 A;  4F7Z A;  1J8C A;  2MX2 A;  2KHW B;  2NCN A;  1EWY C;  3A9K B;  1WFY A;  1V4G A;  1TYG B;  4E74 A;  1WXM A;  2GOW A;  2L05 A;  3PLU A;  2JX5 A;  2RPQ A;  3URY A;  4GW0 A;  2KTF A;  3A4R A;  1L6V A;  2QC8 A;  2XNA C;  4AUQ C;  1XLQ A;  4IDI A;  3VQI A;  4W9I A;  4NJ6 A;  1R4N B;  2C7M B;  1EM7 A;  1FXA A;  1K50 A;  1TKG A;  4DQO C;  3AMZ A;  3U8Z A;  2L52 A;  2GLS A;  2WDR B;  1WH3 A;  2Y5C A;  4LNO A;  4OVZ A;  3L54 A;  4RMA A;  1DOY A;  4RF7 A;  4AJW A;  4GVY A;  3LVV A;  3AXC A;  3DVN V;  3IG3 A;  3LJ3 A;  3T3N A;  4HCP B;  4XE0 A;  3SU8 X;  1V49 A;  4FJZ A;  3ZNH B;  4IG7 B;  4REZ A;  2DLB A;  2M4N A;  3GS2 A;  1JWA D;  1WM3 A;  3ABV B;  3VH4 B;  5IO9 A;  4AM1 A;  4K3B A;  2BF8 B;  4MJS A;  3I3T B;  1M4V A;  1YMH E;  3P4Q B;  2KTR A;  3PV1 A;  4AP4 C;  2R61 A;  2B3A A;  2MSE D;  1VJK A;  1D6E C;  2ZNV C;  3B9J A;  5FR3 A;  4IW0 A;  4PS8 A;  3HHM A;  2YVC A;  4KVG B;  1HZ6 A;  3LN6 A;  4ZRQ A;  2V4L A;  2OJR A;  1DOI A;  3AEC B;  2IJ0 A;  2LHE A;  1FPY A;  3SFD B;  4BVU C;  2LMC A;  2N7E A;  1HXY D;  1NI3 A;  2O6V D;  4A8X C;  4MM3 B;  4GW2 A;  2CKH B;  2M17 A;  5D3D A;  3BIN A;  3JSV B;  4KIK B;  2FID A;  1C9F A;  5TR5 A;  5IN7 A;  1WXQ A;  3FAH A;  3JVZ X;  3R2I A;  4YTN B;  2W82 A;  1V80 A;  2JXX A;  2N0S B;  2J4X A;  4GVZ A;  5DPW A;  2VRR B;  2PE9 A;  1DYQ A;  2YEP F;  4KDI C;  1P7E A;  4DHZ B;  2GBN A;  3AEA B;  2LJI A;  4LNI A;  1K53 A;  4B9K A;  4N58 A;  3AU5 A;  3IG5 A;  3AE9 B;  1QF6 A;  3N20 C;  3R3M A;  3ZNG C;  3AEB B;  3IG8 A;  3AE1 B;  2IO0 B;  4RGT A;  1TY2 A;  2INC C;  3PT2 B;  1L7Y A;  4A3P A;  5LLI A;  4C7Z A;  5D2M B;  3OWE B;  2XEW A;  3BYY B;  1P50 A;  1FFU A;  3EC8 A;  2PVG C;  3NS8 A;  2LUM A;  2GBK A;  3HRD D;  2M0A A;  3U7D A;  2FCM A;  3AEG B;  4PT5 A;  2MJ3 A;  4S17 A;  2K8B A;  2IGD A;  4I6N B;  3PSE B;  2ZZP B;  4HDQ A;  2G3Q B;  1TBE A;  1UWM A;  3PRE A;  2BB5 A;  2IGG A;  1VA6 A;  4TMA B;  1WXA A;  2K6D B;  3B08 A;  1U6R A;  2BYV E;  1F2R C;  2RGF A;  1D3Z A;  3DHG C;  1L6U A;  4DWF A;  1Q1O A;  4A55 A;  4WJO A;  2NBW B;  3DRE A;  4BG4 A;  5BO4 B;  3X23 A;  1TY0 A;  1DOX A;  2GBJ A;  3MJW A;  2LAS A;  3DRB A;  2MJD A;  2HTM E;  4CHK A;  2KVZ A;  4N59 A;  5HKH A;  1R4M I;  2FCS A;  2JYE A;  3NZS A;  4XGA B;  3AI5 A;  2WGS A;  1RFK A;  3RN9 C;  4HLE A;  5DPR A;  2W54 A;  4GLS C;  1C4P A;  2LVQ A;  3VVW B;  1N63 A;  2WU2 B;  2FNJ B;  3N1Z C;  5I4D A;  3NVY A;  1E8W A;  3ZUN A;  2ICI A;  2KAN A;  5LXI B;  1EF5 A;  2KYW A;  3A9J B;  4LJP B;  1SGH A;  1T0Q C;  2ZNV B;  4P16 A;  4DXA B;  4II2 B;  1ZDX A;  3ZJT A;  3V60 A;  1SD0 A;  4CYE A;  2MP2 B;  2INN E;  4JGH B;  1UWX A;  5BYR A;  3GB1 A;  2KT7 A;  2DEN B;  4C4V A;  1JML A;  3QAR A;  4ASW C;  1SJH D;  1I4P A;  1ZDV A;  3FC4 A;  3CWI A;  4MH0 E;  1QH4 A;  2NVU I;  3PLV A;  1XLP A;  1I4Q A;  2IBI B;  2OJW A;  2TSS A;  2KJR A;  1R4M B;  1STE A;  4WH4 A;  1TT4 A;  2KDF B;  2DX5 B;  2CR5 A;  4FA6 A;  3CIR B;  1N62 A;  4ZRI A;  1N6Z A;  1WGH A;  1WJ4 A;  1RM6 C;  1UUP A;  3M95 A;  4NY0 A;  2VH1 A;  2KWV B;  2NBU A;  1P3Q U;  1ZUD 2;  2WWZ A;  1ESF A;  1T0S C;  1WM2 A;  2FCN A;  5D7G A;  1ACC A;  2GB1 A;  2WX1 A;  4HKQ A;  2CJN A;  2GWD A;  3DVG Y;  4MSM B;  2WXF A;  3MC0 B;  2Y3A A;  4DHJ B;  4KGR A;  4LLG M;  1KF6 B;  2KN5 A;  4IKG A;  4OW0 A;  3VUW A;  4C56 C;  3SD5 A;  4A6Q A;  3JYU A;  3HVD A;  2C7H A;  2PTL A;  1FFV A;  1SJE D;  2J52 A;  3GZN B;  3LN7 A;  1J7B A;  3PO0 A;  5D6J B;  2QHO A;  4EFO A;  1SE2 A;  3BVG A;  5E6J A;  2L7R A;  1E7U A;  2PIA A;  2ZVN A;  4K7W A;  2Y5B B;  1VCB A;  2GBM A;  2KD0 A;  2MBE A;  1F9J A;  4MSQ B;  4B0M A;  4HXD A;  3KYD D;  2FCQ A;  2CRK A;  3B2F A;  4USA A;  3NHE B;  3B6R A;  1WYW B;  1OQY A;  4NAW B;  1FD6 A;  2WXG A;  2K8C A;  4GOC A;  4MGK E;  4LNK A;  4P7I A;  1E10 A;  3TL5 A;  2KNB A;  3ZDM C;  3N30 A;  3R7R A;  2MBB B;  2PJH A;  2KAJ A;  2V0G A;  3H7P B;  1P98 A;  5BYS A;  1TJE A;  1VR9 A;  4M8N A;  1GB4 A;  2JUO A;  2D32 A;  2J1Q A;  2GMI C;  1WZ0 A;  2EEL A;  2L00 B;  2SAK A;  3DBR I;  3NZT A;  1YJI A;  4YTP B;  1IUE A;  4OZB A;  4BAX A;  3L2D A;  2KQS A;  4E3C A;  5D3I B;  3JU5 A;  3NVZ A;  4W9D A;  1WX9 A;  4GSW A;  1UGM A;  2LVP A;  2CHZ A;  2KMA A;  1WIA A;  3EGR A;  3ETR A;  1E9M A;  3VR8 B;  5CHV C;  2CHW A;  2K22 A;  4OHJ A;  4L2Y A;  4HRS A;  2X8X X;  1HZ5 A;  4HPM B;  1BT0 A;  1V8C A;  4AQ7 A;  1I7H A;  3HK0 A;  3M62 B;  2V9H A;  3ZGZ A;  1JWB D;  3VTW A;  3EEC A;  3BII D;  1L2N A;  2C9W B;  1WGY A;  2LGX A;  2R2O A;  3TMP B;  4A90 A;  2ZEQ A;  2LJ5 A;  2INP E;  2N1W A;  2V4I B;  3PS6 A;  3DQV A;  4W9L A;  4ZOH C;  3V6E B;  3L0W B;  1T0R C;  3DBL I;  3GP7 A;  4AWJ A;  4ZHO A;  3AE5 B;  3AM9 A;  2WXI A;  1ENF A;  1V9J A;  2ZVO A;  4TKN A;  3P1M A;  3TBL D;  2N1V A;  1BG0 A;  2PE6 B;  1QOB A;  1TS2 A;  2KQ4 X;  2L8J A;  3IAM 1;  1XCT L;  1WXV A;  1FRR A;  3PRZ A;  2PW9 A;  3UQA A;  1P9D U;  2KJ6 A;  3JPZ A;  3KQ4 A;  5J2R A;  3V3X A;  1V5O A;  2BKF A;  4II3 B;  1SE3 A;  3CF6 E;  2IGH A;  2C5L C;  3ZVV A;  1V81 A;  2WHI A;  2C60 A;  5GMV A;  2J7Q B;  2K39 A;  3L4P A;  1OQR A;  4KDL B;  3RNF C;  2R2Q A;  1P0R A;  3X0W A;  1WSP A;  4GU2 A;  3RUL A;  5H92 C;  1WJU A;  4MJS B;  3RNC C;  2KMM A;  2WU5 B;  2RDB C;  4BBN C;  2KTR B;  5BYQ A;  3M63 B;  4M8M A;  1PQS A;  3NY5 A;  3DBL B;  2I1J A;  4HPP A;  3ZW3 A;  5CTR C;  3OJ3 A;  1RLF A;  1CZP A;  2O2V B;  3BK2 A;  3VH3 B;  4ARC A;  1OQQ A;  1JRU A;  3FKY A;  3ZRC A;  3JW0 X;  2WXP A;  1GC7 A;  1KTK A;  2WX0 A;  4F1S A;  2LGY A;  4ZRP A;  3RD2 A;  3Q2A C;  5EE3 A;  4HEA 1;  1LO5 D;  4KSK C;  2V3N A;  3J9C A;  2DZI A;  4LDT B;  3QCA A;  4S0R A;  2AQ3 B;  2FE8 A;  4WQM A;  1QOA A;  4G50 A;  1FNU A;  4OZA A;  2KLG A;  1OFF A;  1NEK B;  4YT0 B;  2ZW0 A;  4RF0 A;  3H8H A;  1NDD A;  2UWQ A;  3PRM B;  3ZNZ B;  1RYJ A;  3RNG C;  2WXR A;  2CS4 A;  2KWU B;  3MHS D;  2V1Y A;  1OTR B;  1FRD A;  1XLO A;  1PGX A;  1L4D B;  2D07 B;  5GXG B;  4JLC A;  3SHQ A;  4RCO A;  2D33 A;  3ZDT A;  2AQ2 B;  1GJZ A;  1TT5 B;  1WI0 A;  1IGC A;  2YEP B;  1Y56 A;  3BY4 B;  4XX5 A;  3SEB A;  3VAW A;  4UDU C;  4NJ7 A;  1HTO A;  1I0E A;  3BK1 A;  3NZ3 A;  1CJE A;  2KN4 A;  2O6V B;  2AX5 A;  4FXC A;  1RFA A;  4MH8 A;  3H6N A;  2HDE A;  1WGG A;  3Q8E A;  3DCG A;  3VTV A;  2DAJ A;  2D10 A;  2B76 B;  1IGD A;  2K8H A;  3R66 C;  4LNN A;  3T8M A;  4WUR A;  2JT4 B;  4GXB A;  1E8Z A;  3Q3F A;  3ML8 A;  1B1Z A;  1F52 A;  1KLG D;  5C23 A;  4Z9M A;  4BG4 B;  1S1Q B;  2JWZ A;  3PZ8 A;  2L76 A;  3ZJU A;  2J0M A;  1QLB B;  4W9H A;  2LGS A;  2WXL A;  3JQ3 A;  4ANW A;  3RPF C;  2WXN A;  4XC2 A;  3Q8A A;  2ASQ A;  2N7D A;  1TGZ B;  2DNF A;  1ISN A;  1XLN A;  4EZL A;  4O1N A;  3V61 A;  3K9O B;  1SSN A;  3R8B A;  3RZF A;  3ZJV A;  4TQ1 A;  5J99 A;  2KZR A;  3AE8 B;  3N9Y C;  1T5X D;  5LXH A;  3MTN B;  1E0Z A;  1H8C A;  2KFK A;  2K5P A;  4FJY A;  1I4R A;  3TIX A;  1MHX A;  2J0J A;  4JIO U;  4Q2J A;  2AEH A;  3QC8 B;  3KH0 A;  1HEZ E;  2BYE A;  1Q10 A;  4DK5 A;  1V86 A;  1OEY A;  4TSS A;  3AB5 A;  1EF1 A;  4DBG A;  1IPG A;  3DHH C;  2E6X A;  4HWI B;  3N32 A;  1BXT A;  5CHW A;  3JU6 A;  2O2V A;  4C4V B;  3U30 A;  3AV8 A;  2KOX A;  2FIF A;  1TIF A;  1UGJ A;  1TTN A;  1JW9 D;  1TKY A;  1WX8 A;  2KC2 A;  2WDT B;  3PZD A;  1CRK A;  1Q0W B;  1QK1 A; 
#chains in the Genus database with same CATH homology
 2D3B A;  3NG0 A;  2WHI A;  4XYC A;  2UU7 A;  3ZXV A;  4BAX A;  1SD0 A;  1P50 A;  3L2D A;  4S0R A;  4ACF A;  1U6R A;  4LNF A;  4HPP A;  1BG0 A;  3JU5 A;  4RF9 A;  1F52 A;  2D3A A;  5J99 A;  4LNI A;  1RL9 A;  1VRP A;  3DRE A;  4RF6 A;  4BG4 A;  2CRK A;  4Z9M A;  4BG4 B;  1HTQ A;  4AM1 A;  4RF8 A;  3JU6 A;  3B6R A;  4S17 A;  3FKY A;  3JPZ A;  2GLS A;  1LGR A;  3DRB A;  1FPY A;  2LGS A;  2J1Q A;  4BHL A;  1QH4 A;  1F1H A;  3JQ3 A;  5J9A A;  3L2E A;  4GW0 A;  1G0W A;  1P52 A;  3L2E B;  4LNK A;  1M15 A;  2D3C A;  3M10 A;  4GVZ A;  4Q2R A;  4LNO A;  2QC8 A;  3ZXR A;  4GW2 A;  2BVC A;  1CRK A;  1HTO A;  4RF7 A;  4GVY A;  1I0E A;  1QK1 A;  2OJW A;  2WGS A;  4LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...