3ZXRA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxrA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxrA02
5J99A 2CRKA 4XYCA 4LNNA 2D3AA 3M10A 4HPPA 4RF8A 3ZXVA 3FKYA 3L2EA 1HTOA 1QH4A 1SD0A 1M15A 4BHLA 3ZXRA 1F52A 2D3CA 1QK1A 2BVCA 2QC8A 1HTQA 4Z9MA 4BG4B 1P50A 4LNKA 4S17A 1I0EA 3B6RA 2WGSA 2WHIA 2GLSA 2UU7A 1FPYA 2LGSA 4BAXA 4GW0A 4GVYA 4LNFA 3L2EB 1CRKA 4RF6A 4RF7A 2OJWA 1U6RA 4GVZA 4LNIA 3JQ3A 5J9AA 1P52A 1VRPA 2J1QA 4ACFA 3DREA 4AM1A 1RL9A 4GW2A 1F1HA 3NG0A 2D3BA 3DRBA 3JPZA 4LNOA 3JU6A 4Q2RA 1BG0A 3L2DA 4RF9A 1G0WA 3JU5A 1LGRA 4S0RA 4BG4A
chains in the Genus database with same CATH superfamily
1N62A 4W9JA 3AEEB 4FLHA 3AEGB 1FFUA 3JSVA 3MHSD 1N63A 2VH2A 1VZ7A 2E6XA 2K39A 4C7ZA 3NY5A 4YL8A 1G6JA 4GXBA 1MPEA 4YTPB 1XXGA 3ZDMC 1RAXA 3GE3C 3C0RB 1A70A 5J17A 4IM3A 2WX1A 2R2OA 3PLVA 1TKEA 2FNJB 4PT5A 4KX6B 3H7PA 1L4DB 4WURA 2JQRB 3WAOA 3NVZA 1FFVA 1B9RA 3NUHB 2OJWA 3RT3B 3JYUA 2B76B 4W9FA 2D3BA 3CMMB 2KC1A 2ZW0A 2AQ2B 2IGHA 4XC2A 1K8RB 2DZKA 1I4XA 2O6VB 1NI3A 1WZ0A 1D4BA 2KN4A 3IBEA 1TY2A 2XK5B 1ZXHA 3NS8A 2KNBA 1P52A 2G9HD 2VRRB 3W5UB 4YT0B 4E74A 4FHKA 2LEKA 2NBVB 3VUYA 1T0RC 1KOTA 4C7YA 3TEZA 1NVID 2ACZB 2HE7A 3BVZA 3RNCC 3W2DA 4ZYNA 3L16A 1E7UA 1WM3A 4CQNA 5JHAA 2KFKA 2K8BA 3L17A 3CIRB 4PYUA 1DOXA 4RF8A 4HWIB 3X0WA 5HFYA 4HDOA 1JQ4A 4USAA 4FHJA 3B9JA 3DBSA 1MG4A 4RF6A 1WR1A 2KDMA 3L4PA 3IAS1 1EF5A 2D5GA 5EE3A 4XYCA 3VUWA 3I9V1 3W1YA 2KD0A 2L32A 2ON8A 3VTUA 4EZLA 1S3SG 4ZRKA 2LVOA 4RNAA 2CHXA 3WAPA 2OHFA 2D10A 4ITKA 5JZEB 1ISNA 4YSZB 4ICVA 1T6BX 2N7JA 3R8BA 1JALA 3SFEB 1SE9A 1Q1OA 5JXVA 2DYBA 1P7EA 1FEHA 4ZOHC 3DBRB 1KTKA 3WA0A 1ZDVA 1PQSA 4ZDVA 2PE9A 4WJNA 4EE2A 4J6IA 1FNVA 3EGRA 3UF8A 1TKYA 4GSWA 1I42A 3MJ5A 3PTFC 4PS3A 1L0XB 2KJ6A 2WXPA 4MELA 4XZ4A 4LNNA 4NQKE 3P2BA 1J8CA 1UUPA 2HD5B 3N32A 1WYWB 2B3AA 3ZKJC 2OJRA 2I38A 2NPTA 4K7UA 4WIPA 4LNKA 2DZJA 3B6RA 2BYFA 2L1AA 1WI0A 3HM3A 3PO0A 3W1SA 2H88B 4M8NA 3UINB 4BBNF 3NVWA 3CSTA 1RRBA 2BKRB 4YSYB 2IPKD 1P98A 4DK5A 1J19A 4ZHPA 1MI0A 2IGDA 4Q2JA 5GMVA 3H8HA 4A8XC 5IN7A 1L6UA 4BHLA 3NZ3A 3RFZB 3TIXA 3RNGC 4BKTA 2FCMA 3RNEC 4IUMB 1V1PB 4NJ7A 3PT2B 1HEZE 3O65B 2BT6A 1YNTE 3U30A 1KLUD 2AYOB 2CHWA 3NZUA 2LRUA 1E90A 1RYJA 3P4PB 3L54A 1EWCA 1QH4A 4NY0A 2ZNVB 2DHZA 4WWNA 1F52A 3AE5B 3Q6BA 1TY0A 2GBNA 3Q2AC 3ZYYX 1FPYA 2UU7A 2RDBC 4K7WA 4FXCA 2G1EA 2YEPB 3VH4B 1WR6E 1WRDB 3W5VB 2M0AA 2KFJA 2MW5A 2MQJA 3AU5A 3LB8C 1WY8A 1V97A 2LUMA 1F2RC 4KVGB 4JIOU 2V3SA 2WXHA 2KOXA 2KTRB 1L7YA 2Z0EB 1UBIA 2GRIA 3RI7C 4IM2A 3ML9A 2N7DA 2RGFA 2JXXA 3U7ZA 2KT7A 2JPHA 2FCQA 3MC8A 1YX6B 3D32A 4GDLB 1TS3A 1WRIA 3VR8B 1WX7A 2ZJDA 4KGRA 1WZ3A 3ZNID 1OQYA 1HZ6A 2LGXA 1SXTA 2LVQA 1TZOA 2JU6X 2XN9C 1SGHA 4DXFA 4MGKE 2V3PA 4ZYSA 2N0SB 1J7BA 2CU3A 5D2MB 5EDSA 1VR9A 5FR3A 3ZNGC 2MBBB 1XLQA 3ZJUA 2MHJA 2QMTA 4XE0A 3U7DA 1V1PA 3FC4A 2KXJA 3ZXRA 1GPXA 3AEDB 5AUKA 1P50A 1SEBD 2WXQA 4CO7A 5FKAC 2AL3A 3ZRFA 1TZ1A 3T3NA 4MGYE 4URKA 2QCZA 1HE8A 2BGFA 4L23A 2N9EB 1C78A 4FJYA 2PIAA 4BOZB 1RLFA 4KKJA 2NTTA 4PS7A 3ZGZA 1E6EB 3ZDTA 4BKGA 3IXSA 3DBHI 4RF1A 2Z8LA 2JX5A 4TQ1A 1KF6B 4W9HA 2BPSA 4EUTA 3OAWA 1MJDA 2G45B 2LZ6A 4OZBA 2C5LC 1HQRD 3IG8A 4N59A 1T5XD 3RN9C 2QEJC 3AE3B 3A9JA 3AU4A 3ZJVA 4PS8A 1D5MC 5D3IB 1V5OA 1PGXA 4LTUA 2AWTA 5FR6A 3AULA 4TUUA 3DVGY 3VXWA 1NENB 4DHJB 2K8CA 2K9XA 4ICUA 3AE6B 2N9KA 2MRPA 4S0RA 4DHZB 1E7PB 3RZWC 2K6DB 1Y56A 1HA5A 2FCNA 2LMCA 5BO4B 3Q3MC 1QLBB 5KHOA 1KLGD 5C2TB 5H92C 3VRAB 3URYA 3PZ7A 2XBBC 1NBFC 4JWUC 3GB1A 3PREA 4HJGE 1Q10A 1F2RI 1CRKA 1QZEA 2REXA 4M0WA 4MSQB 2KQSA 2GMIC 4ANWA 2DENB 4RF9A 1CK1A 2GBJA 3WALA 3QC8B 2D3AA 2BTEA 4MGZE 3ZRCA 3WANA 3VTWA 3TSSA 4JL9A 5IA7A 4NAMA 2AEHA 2J0JA 1D6EC 3N1YC 4N58A 1TT5B 3UQBA 2N7EA 4DXAB 5I4DA 2D32A 5J2RA 3W1SC 3A33B 3DRBA 1ACCA 4P1BC 5E6NA 5FK9C 5AZFA 4EEWA 2CJNA 1GOZA 2Y5PA 2WXJA 2BB6A 2N1VA 1E7VA 3PGEA 2JWUA 4LDTD 3VRBB 3Q8EA 2KACA 5CHFA 2HJ8A 2NVUI 4RCOA 2KKCA 1E8ZA 2W9NA 2IDYA 2KMCA 2X38A 4B6WA 3OWEB 1V6EA 5C23A 2JVCA 1SF0A 1RFKA 2R2QA 3Q3OC 2PEAA 4ANUA 2BWES 4X57B 1NI2A 3EFUA 4E3CA 1R4NI 4TSSA 1XLOA 1LO5D 1NDDA 2AQ1B 3R3MA 4JGHB 1P1AA 4MGIE 1XLPA 3AE9B 1GNUA 4MSMB 2D07B 1KJTA 2K8HA 3GZNI 3P4SB 2JYTA 1I4GA 2FBWB 3M3JA 3ZUNA 2JY6A 4AJWA 4A55A 2EKIA 3I57A 2AL6A 3VQIA 1CMXB 3IT6B 5BYQA 2J42A 4OVZA 2FUG1 2PPHA 4HCNB 2KLGA 3A1QB 2MA9B 1R4MI 2DYMA 3K9PB 3LDZE 3SEBA 1OEYA 2PVOD 1AN8A 3NZTA 2MH7A 2IJ0A 1A5RA 2PJHA 1ENFA 3N1ZC 3P4QB 3U4EG 4KDIC 4WWPA 2GWDA 4L2YA 1OFFA 3W9CB 4US8A 3U2SC 4A6QA 1UZXB 4B0EA 1F77A 1XQQA 3FILB 4GW2A 1TBEA 4II3B 4ASWC 2O2VA 3QAQA 2WLBA 3ETRA 1TIFA 1P7FA 2A4ZA 2C7HA 2N9LA 1IBXB 3L2EB 1YD8U 4RGMA 4WAAA 2W3SA 1LQBA 4Q2RA 1R7SA 1KRHA 2WXOA 3RUIB 2JRIB 4QAYA 2RSUA 4LCDE 1N5WA 2HTME 3KW5B 1PUTA 1PGAA 1IPGA 4G11A 4DHJD 2IZVB 2IY0B 3AN1A 4MT5A 4JLCA 2WDRB 2N1WA 2KJRA 1FNWA 4ZRPA 2ONQA 4JWSC 2KLCA 2BYVE 5HKHA 3I63C 4FN2A 2EELA 4HEA1 2Q5WD 4IKGA 3C19A 2MX2A 1J0GA 5G55A 2H89B 1CZPA 3PS6A 4YSXB 2VH1A 1QOAA 1FXIA 3AE4B 2D11A 2WU5B 3X23A 3V3XA 4WJOA 3T8MA 3ZXVA 5C1ZA 5EE9A 4BKSA 3KUCB 3M62B 1QK1A 2ZW1A 1V4GA 1ZOYB 4HXDA 1QOFA 2K22A 3A1QA 5G5HA 3RPFC 1BT0A 1UELA 4RGOS 3ZLZA 2N4FA 1ZW7A 2AX5A 4IOIE 2BWFA 1WWTA 3ZTCA 3VH3B 3L2DA 5H8YE 1IYFA 4RMAA 4ZRJA 5AZGA 2IO3B 3R2IA 4DDGD 1YJ1A 2KQ7A 2WYQA 4MJSB 1TGZB 1M94A 3ZW3A 1OQRA 3OLMD 2V9HA 2Z0DB 2NS5A 4OVVA 2LI5A 2MJDA 3JQ3A 3KUDB 2QIEB 3JU6A 1WE6A 4ZRQA 4GN1A 2NTSA 5IOIA 3AXCA 4GGQA 4WQOB 4IC7B 2K5PA 1RWSA 1IBXA 3L2EA 4GDKB 1VZ6A 3ABVB 1WXAA 1RFAA 3AV8A 1UNSA 1WXMA 5AZHA 4A9AA 5L95C 2DZIA 1K53A 1FM0D 1V5TA 4W9LA 5D94A 3KQ4A 5BMGA 1ET6A 3Q8FA 2O6VA 2M19A 4ARIA 2HTHA 4UDUC 1XEEA 3KYCD 4IWPA 3AE1B 2XK5A 2WXRA 4NPNA 3QHTA 3RULA 4BKSD 1V80A 1I0EA 3LVWA 3ENEA 3Q14C 1GC6A 2J7QB 4OHJA 3QARA 3TUOA 1L5PA 1FO4A 3L0WB 4W9KA 3PSEB 1TT4A 2ICIA 3AE7B 1C4AA 3BK1A 4OZCA 1AYFA 2J4XA 4TQ0A 2QC8A 2MLBA 2WS3B 4S17A 2RDGA 1YN4A 1TKGA 4DXGA 4BVUC 3QQ8B 2FAZA 2GBMA 1NYRA 2BQQA 5D6JB 5CX3A 2RR9A 3APDA 1JWBD 3JU5A 4DDID 3WIMA 1SD0A 1NEKB 2FIDA 5JHBA 4EFOA 3TEXA 1I4PA 1WJ4A 1EU4A 4GVYA 3RYTA 2KX3A 1WIAA 2I1JA 1IGDA 4HRSA 4W9EA 2L76A 1TJEA 4MJSA 1YN5A 2O6VD 2ZCBA 4RGNA 3RD2A 2V4IB 1KLVA 1V49A 2QHOA 3QK0A 4OZAA 5D3DA 3NS1A 4JE3B 1I4RA 4WQMA 4DWFA 3B2GA 1MFWA 5GXGB 5D7GA 2M4NA 4II2B 1UGMA 2KHWB 1PFDA 5DPWA 3SFDB 1C4CA 1EU3A 4EZJA 1KH0A 2M17A 3SU8X 4I6LB 2W55A 3LXFA 3RMKC 1JRPA 2WP9B 2BYEA 2LD9A 4MACA 3QA8A 4KKIA 4NNJB 1SJED 4AWJA 1V1OA 2FE8A 2KDIA 2UYZB 1OTRB 2YEPF 3H9DA 3P4RB 1GG3A 3EA6A 2KTFA 3A4RA 4IG7B 3ZNHB 1EWYC 4HDQA 1D3ZA 1GC7A 4RH6A 3AMZA 3TJPA 5HG2A 4GMVA 2OOBB 2WWZA 1TS5A 4KSLC 2M8SA 3ZIMA 1QQRA 3AE8B 4AOFA 1ZXIA 4G50A 2PLPA 4TV3A 4LNFA 4W9IA 4DBGA 1SIFA 4WWMA 3HVZA 1HZ5A 3KWLA 4ACFA 3ZNZB 3PV1A 1VJKA 2KN5A 4M01A 1QOBA 4J3OD 4AQ7A 1PDXA 1XO3A 3QIJA 1TYGB 3DVNV 2KX0A 1GJZA 3P1MA 4HPMB 1MHHE 2GBKA 1L0YB 3A9KB 1YN3A 1VDVA 3Q3JA 4MH8A 3QCAA 2LJ5A 4REZA 1SE2A 2LFIA 2ZVOA 4K7SA 5J18A 4WJQA 3O13A 3HHMA 4KV2A 4L1BA 4RGTA 3M10A 2JZ3B 1M15A 4P7IA 3HIZA 1ROEA 1HTQA 4BG4B 1YJJA 5LLIA 2MP2B 3V6EB 4ANXA 3BK2A 2KVZA 1XD3B 2SAKA 1BUIC 2GWCA 3LN6A 3N9YC 1UBQA 2PE6B 2VZKB 3L10B 4GLSC 4ANVA 2GI9A 3LJ3A 1Q5WB 4F7ZA 1FXAA 4ARCA 1I7HA 1VRAB 1E8WA 3PRMB 3DBHB 3MC0B 2KTRA 2I2YA 1CJEA 2WDQB 4N9F4 1TS4A 2M56B 2LXAA 1N61A 3DVGX 1R8GA 2EKEC 4LJPB 3LN7A 3ML8A 5L83A 1E5WA 1VCBA 5TSSA 1OQQA 3NZSA 2WX0A 3IFWB 3N30A 4CYEA 1XF5L 4GDLA 1VLBA 3DBLI 2GLSA 1YJIA 3EFCA 1ET9A 4EOYA 4WJPA 1ZGUB 1U6RA 1VD2A 4ZRIA 4XWWA 1UGJA 1YOVB 2J53A 5LNK1 2NCNA 2NBUA 2J0KA 3DOWA 3J9CA 1MHXA 3ZJTA 2PW9A 3E56A 2V0GA 1CQVA 3SR6A 3UIOB 3AECB 3AM9A 3DBLB 3JSVB 3NRZA 1WSPA 2K0PA 3HVDA 1JW9D 2RPQA 2SEBD 4O1NA 3KH0A 3A9KA 1VA6A 1SIJA 1UWMA 3N3KB 4AP4C 3HUIA 1AW7A 3IAM1 5AEKB 3DVNU 4Z9MA 1YX5B 1SJHD 4NAWB 4TMAB 1PGBA 1ZE3D 2MBQA 3DCGA 3LVVA 1WGKA 3MHZA 3CF6E 4P1CC 1C76A 3RNFC 1GUAB 3IVFA 5BMHA 3H1UA 4XGAB 1QF6A 1P3QU 3H7SA 4HROA 1H8CA 3N20C 4N6EB 2A5UA 2ASQA 2R61A 4OW0A 1K52A 1ZKHA 4ZHOA 3ONSA 2IO2B 3DQVA 3PRPB 4A3OA 3C8YA 3BZDB 4M02A 3NVYA 3TEYA 1C9FA 2V4LA 1JWSD 4KIKB 3IG5A 2KDEB 3DWMA 2L3ZA 4YWGG 3IHPC 1GAQB 1M4VA 1FNUA 1I4QA 2KQ4X 3DWGC 4IDIA 2FUHB 2NBWB 2WNMA 1YMHE 4YTMB 4I6NB 2JUOA 1D5ZC 3U8ZA 2BVCA 2ZEQA 3P42A 1FRRA 3DHGC 1C3TA 2QDFA 1R4NB 4IM0A 4GVZA 4BBNC 3TMPB 4DHZE 2TSSA 2CKHB 2FIFA 3TBLD 2CJOA 3AEFB 3N1XC 2LXCA 1X1MA 4KGTA 1WE7A 5J99A 4HJKA 4K81A 2KWDA 2BKFA 2AQ3B 3NOBA 5G2NA 3GE8C 3GZNB 1V81A 2KFKB 4GIVA 2MJEA 3T9LA 2KVRA 1C1YB 2G4SA 2V1YA 1V8CA 3I3TB 2MWSB 3VFKA 1E9MA 2DZMA 2YLMA 1XCTL 2QILA 4FADA 2MBOA 1BG0A 2KANA 3QX1A 2WXLA 3BINA 3VTVA 2WXGA 2KYWA 1R4MB 4HKQA 3AI5A 3NJTA 2INNE 2UWQA 4W9DA 3PZ8A 2IO0B 2LASA 3DHHC 1KM7A 3V05A 4JX1C 1VZ8A 2HJ1A 4LLGM 2GOWA 4G0NB 4YXDB 1JWUD 1L2NA 1P0RA 1G0WA 2VZKD 4NAWA 4BOSC 5IKCM 2N9XA 2I1KA 5E6JA 1JCKB 2JZZA 1WXQA 2D3CA 2DYOA 2MBEA 3PHWB 1UF0A 3BWUD 4D2KA 2BS4B 5CHVC 5J9AA 3HRDD 2J0MA 3HM6X 2ZNVC 3AEAB 5HI1A 2JZPA 1HXYD 3QJZA 5EE0A 4XDCA 3GP7A 4KIKA 4C4VB 4M00A 4HPLB 1LM8B 3PLUA 1F9JA 1E8YA 4RM8A 2ZPYA 4HK2A 2NPTB 2X8XX 1WX8A 1WXVA 3BVGA 2KDFB 4P6VF 1N6ZA 3V60A 5HHDG 3SHQA 4C56C 3UQAA 1AWDA 2JRHA 2L05A 3MP9A 4NJ6A 3R66C 3V6CB 2EMTA 2DBYA 1ZP0B 2MJ3A 3AEBB 4MH0E 4RF7A 3BIID 3EUB2 2OEDA 3KLSX 4KZCA 2WU2B 2W3RA 2BS3B 2IO1B 4W9CA 4C00A 1K50A 1SBBB 4AUQC 3OG5A 1E0ZA 5AUIA 4MEMA 1C77A 3DHIC 2V3NA 1T0QC 4MDKE 3ZO5B 3FILA 3JW0X 4NJCA 5DPSA 3VDZA 1N5XA 4RM9A 1P9DU 1YQBA 3B2FA 2IYDB 4DQOC 3KYDD 1I35A 2JWZA 3ALBA 5DPRA 1D5XC 1JWAD 3CWIA 3DBRI 3K9OB 5E6OA 1GB1A 1ZPSA 1UH6A 2RD0A 3MJWA 5CTRC 4KDLB 4YTNB 4E71A 3V62A 3PZDA 1DOIA 2C7NB 3DDCB 4P16A 3MC9A 1EM7A 1WGGA 2C60A 3PPAA 3KWVA 2NR2A 3Q8CA 2DLBA 1GB4A 3PVLA 3JVZX 4W9GA 2BS2B 1V2YA 2W82A 2LWPA 2KAJA 2KO3A 4M8MA 2BBCA 1J7AA 4FA6A 4NZLB 1YQ4B 2D2QA 3R7QA 1QKZA 4C4VA 2C9WB 2CU1A 1ZUD2 5BYSA 2RPVA 4FBJB 5JH5C 3P63A 2PKOA 2WXNA 4K3BA 4GB9A 2L7RA 2NMQA 4NQLB 2LGSA 2L0TA 2WXKA 2CS4A 5BMIA 5MPOA 2PTLA 3LYYA 3ZQ4A 3AH7A 1SB3C 1T3QA 1WH3A 2WXMA 2JT4B 2CRKA 2LHEA 1OGWA 2QSDA 3TL5A 3OJ4B 4GU2A 3NVVA 2INDC 1UWXA 1DOYA 3Q3FA 4R3DA 2XNAC 3L13A 2IGGA 4C80A 2J1QA 2BYTA 3R7RA 3WCQA 2RDHA 2GBRA 3APFA 3A4SC 1WXSA 1ESFA 1XLNA 2JYEA 2KDBA 2INPE 1WX9A 4K3CA 4LJOB 4US9A 3EHVA 1WGHA 1K51A 1ZDXA 2MEKA 4KGSA 2Y3AA 3T3OA 3H6NA 4FJVB 2FCSA 2K25A 4GOCA 4HCPB 4AS1A 2IY1B 3GOEA 3IG3A 1RL9A 1F1HA 4LNOA 4A3PA 4GDKA 2DAJA 1TS2A 1LFDA 2KWCA 1T0YA 4G3XB 2KMAA 2K1FA 3QWZB 3A9JB 4XX5A 4LDTB 1H4RA 4K1RB 1Y8RC 2L8JA 4XWTA 2LRWA 1FIQA 3DREA 2INCC 2M1MA 3B1LX 3ZTDA 4XDDA 4BZAA 2PVGC 3IT4B 1FMAD 1L6VA 1STEA 1B1ZA 2C7MB 4B0MA 4A90A 2DX5B 2L52A 1IUEA 5DPTA 2BF8B 3B0AA 4KSKC 2BB5A 4IWQA 3ZVVA 1RM6C 2LGDA 4H2AA 3UIPB 1JMLA 2J52A 4LNIA 3L08A 1LXDA 5KHQA 1SE3A 2WDTB 2N9PC 1QOGA 3OJ3A 1YQ3B 5DCNA 3FAHA 1E8XA 3BYYB 1NYQA 1V86A 4M0WB 3EC8A 5LXHA 4LK0M 2Y5BB 3FKYA 1HTOA 1IGCA 4F1SA 2WDVB 3U52E 2L0FA 3Q3NC 3ECIA 4WWOA 4BAXA 2KC2A 3VHTC 5BYRA 1V9JA 3UGBB 4FJZA 5EE1A 1L4ZB 3AE2B 2Y5CA 1JWMD 1WGYA 3VR9B 3NHEB 2LGIA 3RZFA 3I5JC 2LVPA 4FULA 1Z2MA 3UI3A 4WH4A 2ZVNA 4BFRA 1AARA 4AM1A 2XEWA 3VVWB 1JRUA 2JXTA 3VAWA 2MBHA 1U4AA 4OVUA 3BYTB 1EF1A 3S2AA 2CR5A 4F8CB 1PYWD 4I6PA 2DNFA 2RMMA 1WFYA 2GB1A 3SDLC 3B08A 3NG0A 1SE4A 3KUZA 4EKUA 4JQWC 2ZPNA 2DWQA 3V61A 3MTNB 3TEWA 1IP9A 2W54A 2KWUB 2HDEA 2E3TA 4GW0A 5TR5A 2KK8A 1QILA 1WM2A 1I4HA 1WJNA 1WGDA 3RNAC 2IBIB 1L0VB 4RF0A 1FXTB 3JPZA 5IO9A 4HKZE 1WMHB 4B9KA 2WXFA 1E10A 4WAFA 1OEYJ 3HK0A 4MM3B 2MCNB 1C4PA 5T8IA 3KVFB 4TKNA 3GS2A 3M95A 1WJ6A 2CHZA 1QT9A 2K6QA 4KZ0A 1SSNA 2L00B 1UD7A 1VRPA 2YVCA 4HLEA 3AB5A 4B95A 5C3JB 1WYGA 4IW0A 3RCZA 1XCQL 2ZCCA 2PMVA 3BY4B 1N60A 1KFYB 2WHIA 4PK1A 1S1QB 2O2VB 4PYZA 1Q0WB 4HVBA 2JSVX 4IWOA 3H7PB 1DGJA 2BW2A 2G3QB 3Q8BA 1FCCC 2K3UA 1YIWA 2LGYA 1Z5SB 1TTNA 2LUEA 4AJYB 4A20A 1WF9A 3PHXB 2KMMA 4BG4A 3PRZA 3M63B 3SD5A 2JF5A 2MP2A 2KZRA 1BXTA 5E6PA 1WGRA 5CHWA 1MVKA 4RFBA 5G5GA 1FD6A 3Q69A 2L83A 2ZZPB 1EUVB 3BVMA 2D33A 2EMSA 3APCA 1C79A 2Z59B 4HPPA 2KWVB 2M0XA 3Q8AA 2MSED 1XT9B 3CSFA 2QJLA 2LJIA 1T0SC 1FCLA 2DAFA 1FRDA 1EO6A 2WQYB 1BMLC 2D3GA 5IAAC 3VUXA 1MG8A 1J7CA 2G4DB 4CHKA 3WAMA 3R2TA 3MFGA 2WGSA 2KJHB 3TCAA 2LHDA 5IP4D 2WXIA 4JPSA 1WMHA 1DYQA 1WJUA 4EZKA 1F0ZA 3EECA 5LXIB 3RNBC 4MM3A 1JROA 3DPDA 1LGRA 3E9SA
chains in the Genus database with same CATH topology
5J99A 2CRKA 4XYCA 4LNNA 2D3AA 3M10A 4HPPA 4RF8A 3ZXVA 3FKYA 3L2EA 1HTOA 1QH4A 1SD0A 1M15A 4BHLA 3ZXRA 1F52A 2D3CA 1QK1A 2BVCA 2QC8A 1HTQA 4Z9MA 4BG4B 1P50A 4LNKA 4S17A 1I0EA 3B6RA 2WGSA 2WHIA 2GLSA 2UU7A 1FPYA 2LGSA 4BAXA 4GW0A 4GVYA 4LNFA 3L2EB 1CRKA 4RF6A 4RF7A 2OJWA 1U6RA 4GVZA 4LNIA 3JQ3A 5J9AA 1P52A 1VRPA 2J1QA 4ACFA 3DREA 4AM1A 1RL9A 4GW2A 1F1HA 3NG0A 2D3BA 3DRBA 3JPZA 4LNOA 3JU6A 4Q2RA 1BG0A 3L2DA 4RF9A 1G0WA 3JU5A 1LGRA 4S0RA 4BG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J99 A;  2CRK A;  4XYC A;  4LNN A;  2D3A A;  3M10 A;  4HPP A;  4RF8 A;  3ZXV A;  3FKY A;  3L2E A;  1HTO A;  1QH4 A;  1SD0 A;  1M15 A;  4BHL A;  3ZXR A;  1F52 A;  2D3C A;  1QK1 A;  2BVC A;  2QC8 A;  1HTQ A;  4Z9M A;  4BG4 B;  1P50 A;  4LNK A;  4S17 A;  1I0E A;  3B6R A;  2WGS A;  2WHI A;  2GLS A;  2UU7 A;  1FPY A;  2LGS A;  4BAX A;  4GW0 A;  4GVY A;  4LNF A;  3L2E B;  1CRK A;  4RF6 A;  4RF7 A;  2OJW A;  1U6R A;  4GVZ A;  4LNI A;  3JQ3 A;  5J9A A;  1P52 A;  1VRP A;  2J1Q A;  4ACF A;  3DRE A;  4AM1 A;  1RL9 A;  4GW2 A;  1F1H A;  3NG0 A;  2D3B A;  3DRB A;  3JPZ A;  4LNO A;  3JU6 A;  4Q2R A;  1BG0 A;  3L2D A;  4RF9 A;  1G0W A;  3JU5 A;  1LGR A;  4S0R A;  4BG4 A; 
#chains in the Genus database with same CATH topology
 1N62 A;  4W9J A;  3AEE B;  4FLH A;  3AEG B;  1FFU A;  3JSV A;  3MHS D;  1N63 A;  2VH2 A;  1VZ7 A;  2E6X A;  2K39 A;  4C7Z A;  3NY5 A;  4YL8 A;  1G6J A;  4GXB A;  1MPE A;  4YTP B;  1XXG A;  3ZDM C;  1RAX A;  3GE3 C;  3C0R B;  1A70 A;  5J17 A;  4IM3 A;  2WX1 A;  2R2O A;  3PLV A;  1TKE A;  2FNJ B;  4PT5 A;  4KX6 B;  3H7P A;  1L4D B;  4WUR A;  2JQR B;  3WAO A;  3NVZ A;  1FFV A;  1B9R A;  3NUH B;  2OJW A;  3RT3 B;  3JYU A;  2B76 B;  4W9F A;  2D3B A;  3CMM B;  2KC1 A;  2ZW0 A;  2AQ2 B;  2IGH A;  4XC2 A;  1K8R B;  2DZK A;  1I4X A;  2O6V B;  1NI3 A;  1WZ0 A;  1D4B A;  2KN4 A;  3IBE A;  1TY2 A;  2XK5 B;  1ZXH A;  3NS8 A;  2KNB A;  1P52 A;  2G9H D;  2VRR B;  3W5U B;  4YT0 B;  4E74 A;  4FHK A;  2LEK A;  2NBV B;  3VUY A;  1T0R C;  1KOT A;  4C7Y A;  3TEZ A;  1NVI D;  2ACZ B;  2HE7 A;  3BVZ A;  3RNC C;  3W2D A;  4ZYN A;  3L16 A;  1E7U A;  1WM3 A;  4CQN A;  5JHA A;  2KFK A;  2K8B A;  3L17 A;  3CIR B;  4PYU A;  1DOX A;  4RF8 A;  4HWI B;  3X0W A;  5HFY A;  4HDO A;  1JQ4 A;  4USA A;  4FHJ A;  3B9J A;  3DBS A;  1MG4 A;  4RF6 A;  1WR1 A;  2KDM A;  3L4P A;  3IAS 1;  1EF5 A;  2D5G A;  5EE3 A;  4XYC A;  3VUW A;  3I9V 1;  3W1Y A;  2KD0 A;  2L32 A;  2ON8 A;  3VTU A;  4EZL A;  1S3S G;  4ZRK A;  2LVO A;  4RNA A;  2CHX A;  3WAP A;  2OHF A;  2D10 A;  4ITK A;  5JZE B;  1ISN A;  4YSZ B;  4ICV A;  1T6B X;  2N7J A;  3R8B A;  1JAL A;  3SFE B;  1SE9 A;  1Q1O A;  5JXV A;  2DYB A;  1P7E A;  1FEH A;  4ZOH C;  3DBR B;  1KTK A;  3WA0 A;  1ZDV A;  1PQS A;  4ZDV A;  2PE9 A;  4WJN A;  4EE2 A;  4J6I A;  1FNV A;  3EGR A;  3UF8 A;  1TKY A;  4GSW A;  1I42 A;  3MJ5 A;  3PTF C;  4PS3 A;  1L0X B;  2KJ6 A;  2WXP A;  4MEL A;  4XZ4 A;  4LNN A;  4NQK E;  3P2B A;  1J8C A;  1UUP A;  2HD5 B;  3N32 A;  1WYW B;  2B3A A;  3ZKJ C;  2OJR A;  2I38 A;  2NPT A;  4K7U A;  4WIP A;  4LNK A;  2DZJ A;  3B6R A;  2BYF A;  2L1A A;  1WI0 A;  3HM3 A;  3PO0 A;  3W1S A;  2H88 B;  4M8N A;  3UIN B;  4BBN F;  3NVW A;  3CST A;  1RRB A;  2BKR B;  4YSY B;  2IPK D;  1P98 A;  4DK5 A;  1J19 A;  4ZHP A;  1MI0 A;  2IGD A;  4Q2J A;  5GMV A;  3H8H A;  4A8X C;  5IN7 A;  1L6U A;  4BHL A;  3NZ3 A;  3RFZ B;  3TIX A;  3RNG C;  4BKT A;  2FCM A;  3RNE C;  4IUM B;  1V1P B;  4NJ7 A;  3PT2 B;  1HEZ E;  3O65 B;  2BT6 A;  1YNT E;  3U30 A;  1KLU D;  2AYO B;  2CHW A;  3NZU A;  2LRU A;  1E90 A;  1RYJ A;  3P4P B;  3L54 A;  1EWC A;  1QH4 A;  4NY0 A;  2ZNV B;  2DHZ A;  4WWN A;  1F52 A;  3AE5 B;  3Q6B A;  1TY0 A;  2GBN A;  3Q2A C;  3ZYY X;  1FPY A;  2UU7 A;  2RDB C;  4K7W A;  4FXC A;  2G1E A;  2YEP B;  3VH4 B;  1WR6 E;  1WRD B;  3W5V B;  2M0A A;  2KFJ A;  2MW5 A;  2MQJ A;  3AU5 A;  3LB8 C;  1WY8 A;  1V97 A;  2LUM A;  1F2R C;  4KVG B;  4JIO U;  2V3S A;  2WXH A;  2KOX A;  2KTR B;  1L7Y A;  2Z0E B;  1UBI A;  2GRI A;  3RI7 C;  4IM2 A;  3ML9 A;  2N7D A;  2RGF A;  2JXX A;  3U7Z A;  2KT7 A;  2JPH A;  2FCQ A;  3MC8 A;  1YX6 B;  3D32 A;  4GDL B;  1TS3 A;  1WRI A;  3VR8 B;  1WX7 A;  2ZJD A;  4KGR A;  1WZ3 A;  3ZNI D;  1OQY A;  1HZ6 A;  2LGX A;  1SXT A;  2LVQ A;  1TZO A;  2JU6 X;  2XN9 C;  1SGH A;  4DXF A;  4MGK E;  2V3P A;  4ZYS A;  2N0S B;  1J7B A;  2CU3 A;  5D2M B;  5EDS A;  1VR9 A;  5FR3 A;  3ZNG C;  2MBB B;  1XLQ A;  3ZJU A;  2MHJ A;  2QMT A;  4XE0 A;  3U7D A;  1V1P A;  3FC4 A;  2KXJ A;  3ZXR A;  1GPX A;  3AED B;  5AUK A;  1P50 A;  1SEB D;  2WXQ A;  4CO7 A;  5FKA C;  2AL3 A;  3ZRF A;  1TZ1 A;  3T3N A;  4MGY E;  4URK A;  2QCZ A;  1HE8 A;  2BGF A;  4L23 A;  2N9E B;  1C78 A;  4FJY A;  2PIA A;  4BOZ B;  1RLF A;  4KKJ A;  2NTT A;  4PS7 A;  3ZGZ A;  1E6E B;  3ZDT A;  4BKG A;  3IXS A;  3DBH I;  4RF1 A;  2Z8L A;  2JX5 A;  4TQ1 A;  1KF6 B;  4W9H A;  2BPS A;  4EUT A;  3OAW A;  1MJD A;  2G45 B;  2LZ6 A;  4OZB A;  2C5L C;  1HQR D;  3IG8 A;  4N59 A;  1T5X D;  3RN9 C;  2QEJ C;  3AE3 B;  3A9J A;  3AU4 A;  3ZJV A;  4PS8 A;  1D5M C;  5D3I B;  1V5O A;  1PGX A;  4LTU A;  2AWT A;  5FR6 A;  3AUL A;  4TUU A;  3DVG Y;  3VXW A;  1NEN B;  4DHJ B;  2K8C A;  2K9X A;  4ICU A;  3AE6 B;  2N9K A;  2MRP A;  4S0R A;  4DHZ B;  1E7P B;  3RZW C;  2K6D B;  1Y56 A;  1HA5 A;  2FCN A;  2LMC A;  5BO4 B;  3Q3M C;  1QLB B;  5KHO A;  1KLG D;  5C2T B;  5H92 C;  3VRA B;  3URY A;  3PZ7 A;  2XBB C;  1NBF C;  4JWU C;  3GB1 A;  3PRE A;  4HJG E;  1Q10 A;  1F2R I;  1CRK A;  1QZE A;  2REX A;  4M0W A;  4MSQ B;  2KQS A;  2GMI C;  4ANW A;  2DEN B;  4RF9 A;  1CK1 A;  2GBJ A;  3WAL A;  3QC8 B;  2D3A A;  2BTE A;  4MGZ E;  3ZRC A;  3WAN A;  3VTW A;  3TSS A;  4JL9 A;  5IA7 A;  4NAM A;  2AEH A;  2J0J A;  1D6E C;  3N1Y C;  4N58 A;  1TT5 B;  3UQB A;  2N7E A;  4DXA B;  5I4D A;  2D32 A;  5J2R A;  3W1S C;  3A33 B;  3DRB A;  1ACC A;  4P1B C;  5E6N A;  5FK9 C;  5AZF A;  4EEW A;  2CJN A;  1GOZ A;  2Y5P A;  2WXJ A;  2BB6 A;  2N1V A;  1E7V A;  3PGE A;  2JWU A;  4LDT D;  3VRB B;  3Q8E A;  2KAC A;  5CHF A;  2HJ8 A;  2NVU I;  4RCO A;  2KKC A;  1E8Z A;  2W9N A;  2IDY A;  2KMC A;  2X38 A;  4B6W A;  3OWE B;  1V6E A;  5C23 A;  2JVC A;  1SF0 A;  1RFK A;  2R2Q A;  3Q3O C;  2PEA A;  4ANU A;  2BWE S;  4X57 B;  1NI2 A;  3EFU A;  4E3C A;  1R4N I;  4TSS A;  1XLO A;  1LO5 D;  1NDD A;  2AQ1 B;  3R3M A;  4JGH B;  1P1A A;  4MGI E;  1XLP A;  3AE9 B;  1GNU A;  4MSM B;  2D07 B;  1KJT A;  2K8H A;  3GZN I;  3P4S B;  2JYT A;  1I4G A;  2FBW B;  3M3J A;  3ZUN A;  2JY6 A;  4AJW A;  4A55 A;  2EKI A;  3I57 A;  2AL6 A;  3VQI A;  1CMX B;  3IT6 B;  5BYQ A;  2J42 A;  4OVZ A;  2FUG 1;  2PPH A;  4HCN B;  2KLG A;  3A1Q B;  2MA9 B;  1R4M I;  2DYM A;  3K9P B;  3LDZ E;  3SEB A;  1OEY A;  2PVO D;  1AN8 A;  3NZT A;  2MH7 A;  2IJ0 A;  1A5R A;  2PJH A;  1ENF A;  3N1Z C;  3P4Q B;  3U4E G;  4KDI C;  4WWP A;  2GWD A;  4L2Y A;  1OFF A;  3W9C B;  4US8 A;  3U2S C;  4A6Q A;  1UZX B;  4B0E A;  1F77 A;  1XQQ A;  3FIL B;  4GW2 A;  1TBE A;  4II3 B;  4ASW C;  2O2V A;  3QAQ A;  2WLB A;  3ETR A;  1TIF A;  1P7F A;  2A4Z A;  2C7H A;  2N9L A;  1IBX B;  3L2E B;  1YD8 U;  4RGM A;  4WAA A;  2W3S A;  1LQB A;  4Q2R A;  1R7S A;  1KRH A;  2WXO A;  3RUI B;  2JRI B;  4QAY A;  2RSU A;  4LCD E;  1N5W A;  2HTM E;  3KW5 B;  1PUT A;  1PGA A;  1IPG A;  4G11 A;  4DHJ D;  2IZV B;  2IY0 B;  3AN1 A;  4MT5 A;  4JLC A;  2WDR B;  2N1W A;  2KJR A;  1FNW A;  4ZRP A;  2ONQ A;  4JWS C;  2KLC A;  2BYV E;  5HKH A;  3I63 C;  4FN2 A;  2EEL A;  4HEA 1;  2Q5W D;  4IKG A;  3C19 A;  2MX2 A;  1J0G A;  5G55 A;  2H89 B;  1CZP A;  3PS6 A;  4YSX B;  2VH1 A;  1QOA A;  1FXI A;  3AE4 B;  2D11 A;  2WU5 B;  3X23 A;  3V3X A;  4WJO A;  3T8M A;  3ZXV A;  5C1Z A;  5EE9 A;  4BKS A;  3KUC B;  3M62 B;  1QK1 A;  2ZW1 A;  1V4G A;  1ZOY B;  4HXD A;  1QOF A;  2K22 A;  3A1Q A;  5G5H A;  3RPF C;  1BT0 A;  1UEL A;  4RGO S;  3ZLZ A;  2N4F A;  1ZW7 A;  2AX5 A;  4IOI E;  2BWF A;  1WWT A;  3ZTC A;  3VH3 B;  3L2D A;  5H8Y E;  1IYF A;  4RMA A;  4ZRJ A;  5AZG A;  2IO3 B;  3R2I A;  4DDG D;  1YJ1 A;  2KQ7 A;  2WYQ A;  4MJS B;  1TGZ B;  1M94 A;  3ZW3 A;  1OQR A;  3OLM D;  2V9H A;  2Z0D B;  2NS5 A;  4OVV A;  2LI5 A;  2MJD A;  3JQ3 A;  3KUD B;  2QIE B;  3JU6 A;  1WE6 A;  4ZRQ A;  4GN1 A;  2NTS A;  5IOI A;  3AXC A;  4GGQ A;  4WQO B;  4IC7 B;  2K5P A;  1RWS A;  1IBX A;  3L2E A;  4GDK B;  1VZ6 A;  3ABV B;  1WXA A;  1RFA A;  3AV8 A;  1UNS A;  1WXM A;  5AZH A;  4A9A A;  5L95 C;  2DZI A;  1K53 A;  1FM0 D;  1V5T A;  4W9L A;  5D94 A;  3KQ4 A;  5BMG A;  1ET6 A;  3Q8F A;  2O6V A;  2M19 A;  4ARI A;  2HTH A;  4UDU C;  1XEE A;  3KYC D;  4IWP A;  3AE1 B;  2XK5 A;  2WXR A;  4NPN A;  3QHT A;  3RUL A;  4BKS D;  1V80 A;  1I0E A;  3LVW A;  3ENE A;  3Q14 C;  1GC6 A;  2J7Q B;  4OHJ A;  3QAR A;  3TUO A;  1L5P A;  1FO4 A;  3L0W B;  4W9K A;  3PSE B;  1TT4 A;  2ICI A;  3AE7 B;  1C4A A;  3BK1 A;  4OZC A;  1AYF A;  2J4X A;  4TQ0 A;  2QC8 A;  2MLB A;  2WS3 B;  4S17 A;  2RDG A;  1YN4 A;  1TKG A;  4DXG A;  4BVU C;  3QQ8 B;  2FAZ A;  2GBM A;  1NYR A;  2BQQ A;  5D6J B;  5CX3 A;  2RR9 A;  3APD A;  1JWB D;  3JU5 A;  4DDI D;  3WIM A;  1SD0 A;  1NEK B;  2FID A;  5JHB A;  4EFO A;  3TEX A;  1I4P A;  1WJ4 A;  1EU4 A;  4GVY A;  3RYT A;  2KX3 A;  1WIA A;  2I1J A;  1IGD A;  4HRS A;  4W9E A;  2L76 A;  1TJE A;  4MJS A;  1YN5 A;  2O6V D;  2ZCB A;  4RGN A;  3RD2 A;  2V4I B;  1KLV A;  1V49 A;  2QHO A;  3QK0 A;  4OZA A;  5D3D A;  3NS1 A;  4JE3 B;  1I4R A;  4WQM A;  4DWF A;  3B2G A;  1MFW A;  5GXG B;  5D7G A;  2M4N A;  4II2 B;  1UGM A;  2KHW B;  1PFD A;  5DPW A;  3SFD B;  1C4C A;  1EU3 A;  4EZJ A;  1KH0 A;  2M17 A;  3SU8 X;  4I6L B;  2W55 A;  3LXF A;  3RMK C;  1JRP A;  2WP9 B;  2BYE A;  2LD9 A;  4MAC A;  3QA8 A;  4KKI A;  4NNJ B;  1SJE D;  4AWJ A;  1V1O A;  2FE8 A;  2KDI A;  2UYZ B;  1OTR B;  2YEP F;  3H9D A;  3P4R B;  1GG3 A;  3EA6 A;  2KTF A;  3A4R A;  4IG7 B;  3ZNH B;  1EWY C;  4HDQ A;  1D3Z A;  1GC7 A;  4RH6 A;  3AMZ A;  3TJP A;  5HG2 A;  4GMV A;  2OOB B;  2WWZ A;  1TS5 A;  4KSL C;  2M8S A;  3ZIM A;  1QQR A;  3AE8 B;  4AOF A;  1ZXI A;  4G50 A;  2PLP A;  4TV3 A;  4LNF A;  4W9I A;  4DBG A;  1SIF A;  4WWM A;  3HVZ A;  1HZ5 A;  3KWL A;  4ACF A;  3ZNZ B;  3PV1 A;  1VJK A;  2KN5 A;  4M01 A;  1QOB A;  4J3O D;  4AQ7 A;  1PDX A;  1XO3 A;  3QIJ A;  1TYG B;  3DVN V;  2KX0 A;  1GJZ A;  3P1M A;  4HPM B;  1MHH E;  2GBK A;  1L0Y B;  3A9K B;  1YN3 A;  1VDV A;  3Q3J A;  4MH8 A;  3QCA A;  2LJ5 A;  4REZ A;  1SE2 A;  2LFI A;  2ZVO A;  4K7S A;  5J18 A;  4WJQ A;  3O13 A;  3HHM A;  4KV2 A;  4L1B A;  4RGT A;  3M10 A;  2JZ3 B;  1M15 A;  4P7I A;  3HIZ A;  1ROE A;  1HTQ A;  4BG4 B;  1YJJ A;  5LLI A;  2MP2 B;  3V6E B;  4ANX A;  3BK2 A;  2KVZ A;  1XD3 B;  2SAK A;  1BUI C;  2GWC A;  3LN6 A;  3N9Y C;  1UBQ A;  2PE6 B;  2VZK B;  3L10 B;  4GLS C;  4ANV A;  2GI9 A;  3LJ3 A;  1Q5W B;  4F7Z A;  1FXA A;  4ARC A;  1I7H A;  1VRA B;  1E8W A;  3PRM B;  3DBH B;  3MC0 B;  2KTR A;  2I2Y A;  1CJE A;  2WDQ B;  4N9F 4;  1TS4 A;  2M56 B;  2LXA A;  1N61 A;  3DVG X;  1R8G A;  2EKE C;  4LJP B;  3LN7 A;  3ML8 A;  5L83 A;  1E5W A;  1VCB A;  5TSS A;  1OQQ A;  3NZS A;  2WX0 A;  3IFW B;  3N30 A;  4CYE A;  1XF5 L;  4GDL A;  1VLB A;  3DBL I;  2GLS A;  1YJI A;  3EFC A;  1ET9 A;  4EOY A;  4WJP A;  1ZGU B;  1U6R A;  1VD2 A;  4ZRI A;  4XWW A;  1UGJ A;  1YOV B;  2J53 A;  5LNK 1;  2NCN A;  2NBU A;  2J0K A;  3DOW A;  3J9C A;  1MHX A;  3ZJT A;  2PW9 A;  3E56 A;  2V0G A;  1CQV A;  3SR6 A;  3UIO B;  3AEC B;  3AM9 A;  3DBL B;  3JSV B;  3NRZ A;  1WSP A;  2K0P A;  3HVD A;  1JW9 D;  2RPQ A;  2SEB D;  4O1N A;  3KH0 A;  3A9K A;  1VA6 A;  1SIJ A;  1UWM A;  3N3K B;  4AP4 C;  3HUI A;  1AW7 A;  3IAM 1;  5AEK B;  3DVN U;  4Z9M A;  1YX5 B;  1SJH D;  4NAW B;  4TMA B;  1PGB A;  1ZE3 D;  2MBQ A;  3DCG A;  3LVV A;  1WGK A;  3MHZ A;  3CF6 E;  4P1C C;  1C76 A;  3RNF C;  1GUA B;  3IVF A;  5BMH A;  3H1U A;  4XGA B;  1QF6 A;  1P3Q U;  3H7S A;  4HRO A;  1H8C A;  3N20 C;  4N6E B;  2A5U A;  2ASQ A;  2R61 A;  4OW0 A;  1K52 A;  1ZKH A;  4ZHO A;  3ONS A;  2IO2 B;  3DQV A;  3PRP B;  4A3O A;  3C8Y A;  3BZD B;  4M02 A;  3NVY A;  3TEY A;  1C9F A;  2V4L A;  1JWS D;  4KIK B;  3IG5 A;  2KDE B;  3DWM A;  2L3Z A;  4YWG G;  3IHP C;  1GAQ B;  1M4V A;  1FNU A;  1I4Q A;  2KQ4 X;  3DWG C;  4IDI A;  2FUH B;  2NBW B;  2WNM A;  1YMH E;  4YTM B;  4I6N B;  2JUO A;  1D5Z C;  3U8Z A;  2BVC A;  2ZEQ A;  3P42 A;  1FRR A;  3DHG C;  1C3T A;  2QDF A;  1R4N B;  4IM0 A;  4GVZ A;  4BBN C;  3TMP B;  4DHZ E;  2TSS A;  2CKH B;  2FIF A;  3TBL D;  2CJO A;  3AEF B;  3N1X C;  2LXC A;  1X1M A;  4KGT A;  1WE7 A;  5J99 A;  4HJK A;  4K81 A;  2KWD A;  2BKF A;  2AQ3 B;  3NOB A;  5G2N A;  3GE8 C;  3GZN B;  1V81 A;  2KFK B;  4GIV A;  2MJE A;  3T9L A;  2KVR A;  1C1Y B;  2G4S A;  2V1Y A;  1V8C A;  3I3T B;  2MWS B;  3VFK A;  1E9M A;  2DZM A;  2YLM A;  1XCT L;  2QIL A;  4FAD A;  2MBO A;  1BG0 A;  2KAN A;  3QX1 A;  2WXL A;  3BIN A;  3VTV A;  2WXG A;  2KYW A;  1R4M B;  4HKQ A;  3AI5 A;  3NJT A;  2INN E;  2UWQ A;  4W9D A;  3PZ8 A;  2IO0 B;  2LAS A;  3DHH C;  1KM7 A;  3V05 A;  4JX1 C;  1VZ8 A;  2HJ1 A;  4LLG M;  2GOW A;  4G0N B;  4YXD B;  1JWU D;  1L2N A;  1P0R A;  1G0W A;  2VZK D;  4NAW A;  4BOS C;  5IKC M;  2N9X A;  2I1K A;  5E6J A;  1JCK B;  2JZZ A;  1WXQ A;  2D3C A;  2DYO A;  2MBE A;  3PHW B;  1UF0 A;  3BWU D;  4D2K A;  2BS4 B;  5CHV C;  5J9A A;  3HRD D;  2J0M A;  3HM6 X;  2ZNV C;  3AEA B;  5HI1 A;  2JZP A;  1HXY D;  3QJZ A;  5EE0 A;  4XDC A;  3GP7 A;  4KIK A;  4C4V B;  4M00 A;  4HPL B;  1LM8 B;  3PLU A;  1F9J A;  1E8Y A;  4RM8 A;  2ZPY A;  4HK2 A;  2NPT B;  2X8X X;  1WX8 A;  1WXV A;  3BVG A;  2KDF B;  4P6V F;  1N6Z A;  3V60 A;  5HHD G;  3SHQ A;  4C56 C;  3UQA A;  1AWD A;  2JRH A;  2L05 A;  3MP9 A;  4NJ6 A;  3R66 C;  3V6C B;  2EMT A;  2DBY A;  1ZP0 B;  2MJ3 A;  3AEB B;  4MH0 E;  4RF7 A;  3BII D;  3EUB 2;  2OED A;  3KLS X;  4KZC A;  2WU2 B;  2W3R A;  2BS3 B;  2IO1 B;  4W9C A;  4C00 A;  1K50 A;  1SBB B;  4AUQ C;  3OG5 A;  1E0Z A;  5AUI A;  4MEM A;  1C77 A;  3DHI C;  2V3N A;  1T0Q C;  4MDK E;  3ZO5 B;  3FIL A;  3JW0 X;  4NJC A;  5DPS A;  3VDZ A;  1N5X A;  4RM9 A;  1P9D U;  1YQB A;  3B2F A;  2IYD B;  4DQO C;  3KYD D;  1I35 A;  2JWZ A;  3ALB A;  5DPR A;  1D5X C;  1JWA D;  3CWI A;  3DBR I;  3K9O B;  5E6O A;  1GB1 A;  1ZPS A;  1UH6 A;  2RD0 A;  3MJW A;  5CTR C;  4KDL B;  4YTN B;  4E71 A;  3V62 A;  3PZD A;  1DOI A;  2C7N B;  3DDC B;  4P16 A;  3MC9 A;  1EM7 A;  1WGG A;  2C60 A;  3PPA A;  3KWV A;  2NR2 A;  3Q8C A;  2DLB A;  1GB4 A;  3PVL A;  3JVZ X;  4W9G A;  2BS2 B;  1V2Y A;  2W82 A;  2LWP A;  2KAJ A;  2KO3 A;  4M8M A;  2BBC A;  1J7A A;  4FA6 A;  4NZL B;  1YQ4 B;  2D2Q A;  3R7Q A;  1QKZ A;  4C4V A;  2C9W B;  2CU1 A;  1ZUD 2;  5BYS A;  2RPV A;  4FBJ B;  5JH5 C;  3P63 A;  2PKO A;  2WXN A;  4K3B A;  4GB9 A;  2L7R A;  2NMQ A;  4NQL B;  2LGS A;  2L0T A;  2WXK A;  2CS4 A;  5BMI A;  5MPO A;  2PTL A;  3LYY A;  3ZQ4 A;  3AH7 A;  1SB3 C;  1T3Q A;  1WH3 A;  2WXM A;  2JT4 B;  2CRK A;  2LHE A;  1OGW A;  2QSD A;  3TL5 A;  3OJ4 B;  4GU2 A;  3NVV A;  2IND C;  1UWX A;  1DOY A;  3Q3F A;  4R3D A;  2XNA C;  3L13 A;  2IGG A;  4C80 A;  2J1Q A;  2BYT A;  3R7R A;  3WCQ A;  2RDH A;  2GBR A;  3APF A;  3A4S C;  1WXS A;  1ESF A;  1XLN A;  2JYE A;  2KDB A;  2INP E;  1WX9 A;  4K3C A;  4LJO B;  4US9 A;  3EHV A;  1WGH A;  1K51 A;  1ZDX A;  2MEK A;  4KGS A;  2Y3A A;  3T3O A;  3H6N A;  4FJV B;  2FCS A;  2K25 A;  4GOC A;  4HCP B;  4AS1 A;  2IY1 B;  3GOE A;  3IG3 A;  1RL9 A;  1F1H A;  4LNO A;  4A3P A;  4GDK A;  2DAJ A;  1TS2 A;  1LFD A;  2KWC A;  1T0Y A;  4G3X B;  2KMA A;  2K1F A;  3QWZ B;  3A9J B;  4XX5 A;  4LDT B;  1H4R A;  4K1R B;  1Y8R C;  2L8J A;  4XWT A;  2LRW A;  1FIQ A;  3DRE A;  2INC C;  2M1M A;  3B1L X;  3ZTD A;  4XDD A;  4BZA A;  2PVG C;  3IT4 B;  1FMA D;  1L6V A;  1STE A;  1B1Z A;  2C7M B;  4B0M A;  4A90 A;  2DX5 B;  2L52 A;  1IUE A;  5DPT A;  2BF8 B;  3B0A A;  4KSK C;  2BB5 A;  4IWQ A;  3ZVV A;  1RM6 C;  2LGD A;  4H2A A;  3UIP B;  1JML A;  2J52 A;  4LNI A;  3L08 A;  1LXD A;  5KHQ A;  1SE3 A;  2WDT B;  2N9P C;  1QOG A;  3OJ3 A;  1YQ3 B;  5DCN A;  3FAH A;  1E8X A;  3BYY B;  1NYQ A;  1V86 A;  4M0W B;  3EC8 A;  5LXH A;  4LK0 M;  2Y5B B;  3FKY A;  1HTO A;  1IGC A;  4F1S A;  2WDV B;  3U52 E;  2L0F A;  3Q3N C;  3ECI A;  4WWO A;  4BAX A;  2KC2 A;  3VHT C;  5BYR A;  1V9J A;  3UGB B;  4FJZ A;  5EE1 A;  1L4Z B;  3AE2 B;  2Y5C A;  1JWM D;  1WGY A;  3VR9 B;  3NHE B;  2LGI A;  3RZF A;  3I5J C;  2LVP A;  4FUL A;  1Z2M A;  3UI3 A;  4WH4 A;  2ZVN A;  4BFR A;  1AAR A;  4AM1 A;  2XEW A;  3VVW B;  1JRU A;  2JXT A;  3VAW A;  2MBH A;  1U4A A;  4OVU A;  3BYT B;  1EF1 A;  3S2A A;  2CR5 A;  4F8C B;  1PYW D;  4I6P A;  2DNF A;  2RMM A;  1WFY A;  2GB1 A;  3SDL C;  3B08 A;  3NG0 A;  1SE4 A;  3KUZ A;  4EKU A;  4JQW C;  2ZPN A;  2DWQ A;  3V61 A;  3MTN B;  3TEW A;  1IP9 A;  2W54 A;  2KWU B;  2HDE A;  2E3T A;  4GW0 A;  5TR5 A;  2KK8 A;  1QIL A;  1WM2 A;  1I4H A;  1WJN A;  1WGD A;  3RNA C;  2IBI B;  1L0V B;  4RF0 A;  1FXT B;  3JPZ A;  5IO9 A;  4HKZ E;  1WMH B;  4B9K A;  2WXF A;  1E10 A;  4WAF A;  1OEY J;  3HK0 A;  4MM3 B;  2MCN B;  1C4P A;  5T8I A;  3KVF B;  4TKN A;  3GS2 A;  3M95 A;  1WJ6 A;  2CHZ A;  1QT9 A;  2K6Q A;  4KZ0 A;  1SSN A;  2L00 B;  1UD7 A;  1VRP A;  2YVC A;  4HLE A;  3AB5 A;  4B95 A;  5C3J B;  1WYG A;  4IW0 A;  3RCZ A;  1XCQ L;  2ZCC A;  2PMV A;  3BY4 B;  1N60 A;  1KFY B;  2WHI A;  4PK1 A;  1S1Q B;  2O2V B;  4PYZ A;  1Q0W B;  4HVB A;  2JSV X;  4IWO A;  3H7P B;  1DGJ A;  2BW2 A;  2G3Q B;  3Q8B A;  1FCC C;  2K3U A;  1YIW A;  2LGY A;  1Z5S B;  1TTN A;  2LUE A;  4AJY B;  4A20 A;  1WF9 A;  3PHX B;  2KMM A;  4BG4 A;  3PRZ A;  3M63 B;  3SD5 A;  2JF5 A;  2MP2 A;  2KZR A;  1BXT A;  5E6P A;  1WGR A;  5CHW A;  1MVK A;  4RFB A;  5G5G A;  1FD6 A;  3Q69 A;  2L83 A;  2ZZP B;  1EUV B;  3BVM A;  2D33 A;  2EMS A;  3APC A;  1C79 A;  2Z59 B;  4HPP A;  2KWV B;  2M0X A;  3Q8A A;  2MSE D;  1XT9 B;  3CSF A;  2QJL A;  2LJI A;  1T0S C;  1FCL A;  2DAF A;  1FRD A;  1EO6 A;  2WQY B;  1BML C;  2D3G A;  5IAA C;  3VUX A;  1MG8 A;  1J7C A;  2G4D B;  4CHK A;  3WAM A;  3R2T A;  3MFG A;  2WGS A;  2KJH B;  3TCA A;  2LHD A;  5IP4 D;  2WXI A;  4JPS A;  1WMH A;  1DYQ A;  1WJU A;  4EZK A;  1F0Z A;  3EEC A;  5LXI B;  3RNB C;  4MM3 A;  1JRO A;  3DPD A;  1LGR A;  3E9S A; 
#chains in the Genus database with same CATH homology
 5J99 A;  2CRK A;  4XYC A;  4LNN A;  2D3A A;  3M10 A;  4HPP A;  4RF8 A;  3ZXV A;  3FKY A;  3L2E A;  1HTO A;  1QH4 A;  1SD0 A;  1M15 A;  4BHL A;  3ZXR A;  1F52 A;  2D3C A;  1QK1 A;  2BVC A;  2QC8 A;  1HTQ A;  4Z9M A;  4BG4 B;  1P50 A;  4LNK A;  4S17 A;  1I0E A;  3B6R A;  2WGS A;  2WHI A;  2GLS A;  2UU7 A;  1FPY A;  2LGS A;  4BAX A;  4GW0 A;  4GVY A;  4LNF A;  3L2E B;  1CRK A;  4RF6 A;  4RF7 A;  2OJW A;  1U6R A;  4GVZ A;  4LNI A;  3JQ3 A;  5J9A A;  1P52 A;  1VRP A;  2J1Q A;  4ACF A;  3DRE A;  4AM1 A;  1RL9 A;  4GW2 A;  1F1H A;  3NG0 A;  2D3B A;  3DRB A;  3JPZ A;  4LNO A;  3JU6 A;  4Q2R A;  1BG0 A;  3L2D A;  4RF9 A;  1G0W A;  3JU5 A;  1LGR A;  4S0R A;  4BG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...