3ZXRA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxrA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxrA02
2D3AA 2GLSA 4S17A 1HTQA 4AM1A 1RL9A 3ZXVA 4Z9MA 2UU7A 3DREA 3L2EB 3FKYA 3NG0A 4BHLA 4LNFA 1SD0A 4Q2RA 3JQ3A 3L2DA 2BVCA 4XYCA 2J1QA 1M15A 2D3CA 1CRKA 4RF6A 2LGSA 2OJWA 4GW2A 1BG0A 1HTOA 2QC8A 1QK1A 2WGSA 3DRBA 3L2EA 2WHIA 4GVZA 1G0WA 3JPZA 3JU5A 4GVYA 4RF7A 1F1HA 4BAXA 4HPPA 5J9AA 4RF9A 1VRPA 4ACFA 3JU6A 1P50A 5J99A 4BG4B 1I0EA 1QH4A 3ZXRA 4LNNA 1U6RA 4GW0A 1P52A 4LNKA 2CRKA 4S0RA 3B6RA 1LGRA 4BG4A 1F52A 3M10A 4RF8A 2D3BA 1FPYA 4LNIA 4LNOA
chains in the Genus database with same CATH superfamily
4MGKE 2GRIA 2REXA 3AB5A 1WY8A 2PTLA 4MGZE 2JX5A 2INPE 3DVGX 3X23A 3RN9C 4G3XB 4WJOA 2DYMA 5H92C 1GPXA 3JSVA 3H9DA 2FNJB 1I4HA 3R7QA 1PGBA 4YSZB 2BS3B 3PRPB 1SE2A 3NVZA 1L4DB 1L5PA 4YL8A 4K7UA 1YD8U 1TBEA 4WAFA 4LNFA 2J7QB 3DBRI 1QK1A 4GOCA 2NBUA 4EEWA 2KQSA 1F2RC 3H7SA 2MBQA 4IOIE 3GP7A 1NVID 1ZDVA 2HTME 3AM9A 3EECA 3KYCD 4YT0B 3FILB 2IDYA 1KH0A 1WGYA 2O6VB 2CHWA 2N0SB 3JW0X 3LYYA 1UGMA 4RM8A 1WRIA 3BIID 1FMAD 1ROEA 4RFBA 1EO6A 1NBFC 2K8CA 3NUHB 2MCNB 4MM3B 4ZRKA 1GG3A 2K8HA 2INCC 2QHOA 5LLIA 4BKSD 3I9V1 4A90A 2DZIA 2K22A 4GW0A 2KWCA 2PLPA 1WRDB 5D2MB 4MGYE 2NCNA 1FO4A 4WJPA 1DOYA 2M4NA 2D5GA 2DZMA 2LI5A 2G4DB 3Q14C 1V81A 1M15A 1AW7A 2PJHA 2PE6B 2PKOA 2O6VA 3H8HA 3RNFC 1ZE3D 3LN6A 4IWQA 2WXJA 3B1LX 3PGEA 5BO4B 1WXAA 3HRDD 1F77A 3AN1A 4BVUC 2ICIA 4C7ZA 1WGGA 3ZKJC 1VCBA 4ZHOA 2JQRB 3C0RB 2DAFA 3MHSD 1EUVB 4LNKA 2WU5B 3L0WB 3DHIC 4JX1C 1Q0WB 1KJTA 3I57A 3ZXVA 2K0PA 1L6VA 3KVFB 5AUIA 3QIJA 3N1ZC 4LTUA 5E6JA 4R3DA 3JU5A 4EZKA 2EMSA 2CHZA 1S1QB 2GOWA 4C56C 1CQVA 3DBHB 1OGWA 3HUIA 1TS4A 2KO3A 3PHWB 1D6EC 4S0RA 2LFIA 2L05A 2PVOD 2ON8A 1BXTA 2KWUB 2J4XA 2LVPA 2AL3A 2ZPYA 4LJOB 2C60A 1VLBA 4RM9A 2OEDA 5CTRC 4MH8A 2IPKD 3FAHA 2LXAA 3H7PA 3M3JA 2V1YA 4KSKC 1YQ3B 4GMVA 4ICVA 3ZRCA 4JL9A 3MC0B 3PS6A 4RF1A 5G55A 3P4QB 4HJKA 3VXWA 2G1EA 2CKHB 2JSVX 2PEAA 2M17A 4AUQC 2QDFA 4BG4B 1EWCA 3NZ3A 2KN4A 3MP9A 1R4NI 2FCNA 3C8YA 3Q6BA 1P7EA 1P7FA 4TQ1A 1E8ZA 4TMAB 1I35A 1YJ1A 3KWLA 2KMCA 3OAWA 3LB8C 3GOEA 1N60A 1T0QC 3RNCC 1ACCA 2XBBC 3FILA 3W2DA 4M0WA 1MG8A 3M95A 4B95A 5J9AA 2LVQA 2L0TA 1K50A 2MBHA 2K6DB 4MSQB 5J18A 1N61A 2CR5A 4KGTA 1TY2A 2IBIB 3GZNB 4AQ7A 2LXCA 5C3JB 4KGSA 1V9JA 2L1AA 2LJIA 1ZGUB 3JU6A 3AE7B 4US8A 2N1WA 3MJWA 3AE9B 1YQ4B 3ZTDA 2BQQA 4W9CA 1NENB 3BK1A 4WWOA 4WH4A 3VTVA 2CS4A 3R8BA 1E8WA 2G4SA 3WAMA 4ZYSA 1MPEA 3QWZB 4XWTA 2IY1B 3TL5A 1JWMD 2MA9B 2WXKA 3U8ZA 3VFKA 5FR3A 3VAWA 5C2TB 4NJ6A 3WALA 1MI0A 3A9JA 3VQIA 1OEYJ 3N1XC 1T0YA 4LK0M 1UD7A 3A33B 3AEEB 5EE3A 2D3GA 1WMHB 5G2NA 3Q2AC 2A4ZA 1F52A 3LN7A 2HJ1A 2V3SA 3DWGC 2ACZB 4ZDVA 1RFAA 2BB5A 2WGSA 4M0WB 1IUEA 1CZPA 2E3TA 3N1YC 3Q8FA 1GB4A 2NVUI 3KH0A 3RNEC 3CSFA 3AE6B 5FKAC 3DVNV 3ZXRA 3AXCA 2WXIA 4M01A 3D32A 2FUG1 3AEGB 2QEJC 2D33A 2WLBA 4W9EA 2NBWB 1S3SG 4B9KA 3AE5B 1P3QU 1YN5A 4M8MA 2WS3B 4XGAB 3ZGZA 2RDGA 1KTKA 2BYTA 1PDXA 2QJLA 2CJOA 3QHTA 3W5UB 4JWUC 2ZW1A 2GBKA 2MRPA 3IT4B 2LMCA 3BVGA 4RCOA 3QK0A 2RPVA 4YXDB 2E6XA 4TSSA 4ZRJA 3ML8A 2V4IB 5TSSA 2KYWA 2PE9A 4ANUA 1MJDA 2VZKD 3LJ3A 1J0GA 4WJQA 3GS2A 4BBNF 3NVYA 2MEKA 5BMGA 3NVVA 2WX0A 1LM8B 5GXGB 2GI9A 2N4FA 1ZP0B 1L2NA 3EFUA 3IG5A 5T8IA 3IBEA 2AQ1B 2NPTA 3RT3B 4AM1A 1R4MI 1SE4A 4W9GA 3LDZE 4IM0A 5HKHA 2CHXA 1UUPA 3Q69A 3SEBA 4JPSA 3NY5A 1YJIA 3MJ5A 2O2VB 3GZNI 3PZ7A 2BB6A 3B0AA 3IAS1 5JHBA 4MH0E 1T5XD 3ZJVA 2C5LC 2LGYA 2MHJA 5IP4D 4EFOA 1I4XA 2D3AA 3B9JA 1XLQA 2K3UA 1RL9A 3IAM1 4C4VA 3PRMB 3RZFA 2L32A 3A9KA 4FJYA 1FRRA 4NQLB 3LVVA 4FHJA 4A3OA 3IXSA 5JXVA 1J7CA 3DRBA 1WF9A 1ZW7A 2MBEA 3K9PB 3L54A 3ZQ4A 1OQRA 3CWIA 3AE1B 3ZRFA 1P50A 3MTNB 2KHWB 2PPHA 2WXFA 2ASQA 2IJ0A 4P1BC 3U30A 2M0XA 1C77A 3L17A 3DDCB 2JRHA 3A1QA 2KC1A 2LGXA 5EE0A 1WX9A 1TY0A 1E7PB 4MM3A 1V49A 1SE3A 2HDEA 2I38A 4XX5A 4FHKA 2KWVB 2LRWA 1KRHA 3T3OA 3M10A 3Q3OC 1TYGB 1WJ4A 1SJHD 4L2YA 2BYFA 2MP2A 5L95C 1J8CA 1UNSA 5FR6A 1C4AA 4ANXA 2R2QA 1VZ8A 1DYQA 4M02A 2KTRA 4RF0A 3V05A 4E71A 2KLGA 1QZEA 2MX2A 1XO3A 2K8BA 2B76B 3RFZB 1Z5SB 1J7BA 1PGAA 4NAWA 4DHJB 4X57B 3KUZA 2GBRA 3JSVB 4A3PA 3RULA 3R3MA 2DLBA 3UI3A 3SFEB 4CQNA 5L83A 1I42A 2G9HD 2IGHA 1YN4A 1ET9A 4PS3A 1FFVA 1V2YA 1YNTE 4WJNA 1BUIC 3DREA 3L2EB 3A4SC 4RGMA 4TV3A 3NOBA 4ZRPA 5H8YE 3UINB 3ZO5B 1BG0A 2LASA 3I3TB 3WIMA 2FBWB 1EU3A 3JYUA 3IFWB 2UWQA 3TSSA 3KUDB 1F9JA 2GB1A 1YX6B 4MELA 2J0KA 3EUB2 2OHFA 2L00B 1Z2MA 2MBBB 4ARCA 2M56B 2LGSA 1AN8A 4A6QA 4YTPB 3QJZA 3T3NA 2WXMA 2BS2B 2RMMA 3VUWA 1IYFA 1KFYB 1NYQA 2V3NA 2FCMA 1Y8RC 4GSWA 2M0AA 1G6JA 4AOFA 4CO7A 2QMTA 2JU6X 2KMMA 2OOBB 4JLCA 4L23A 1MHXA 1R4MB 1XXGA 4MEMA 3W9CB 3ZJTA 3TJPA 4WWNA 4KIKB 4IWOA 4HKQA 4PYZA 4K81A 1HXYD 1C79A 1EF5A 4G0NB 4US9A 1XLOA 2XN9C 1TTNA 2Y5PA 1A70A 1M4VA 1U6RA 1P0RA 1V86A 4JQWC 2W9NA 3PO0A 3NS8A 4P6VF 2IY0B 1GB1A 2WWZA 4WWPA 1VD2A 2DZJA 4M8NA 2JZ3B 3IG8A 1PYWD 4FJZA 4BKGA 3RNAC 4BOZB 4K3BA 4DDGD 3NHEB 3PLUA 4WWMA 1ZXHA 1HEZE 2RR9A 1UWMA 2WXQA 2AL6A 2VH2A 1FXIA 3BVMA 1RWSA 2WNMA 1SXTA 2GMIC 2CU3A 4HXDA 1WGHA 3APDA 3AMZA 1IGCA 1KM7A 3W1YA 5E6NA 1VRPA 1L0VB 5TR5A 3UGBB 1QF6A 4HCNB 3BYTB 1ENFA 3SU8X 3TEYA 2GBNA 3E56A 3ECIA 4EUTA 3IT6B 5EE1A 2BVCA 4I6PA 4AJYB 1SIJA 4XDDA 3IVFA 3ZTCA 2Z8LA 4WQOB 3APFA 5LXIB 1I4RA 4MGIE 5FK9C 4FLHA 4DK5A 2CU1A 1YJJA 4ARIA 4ANVA 2WX1A 3TUOA 4EZJA 4N58A 1K53A 2W3SA 4N9F4 4P1CC 4F8CB 3OLMD 4KKIA 2C7HA 1GOZA 1EM7A 4J6IA 3WCQA 2KQ4X 4AS1A 1CRKA 3PREA 2LVOA 3AEFB 3KYDD 4RGNA 2BPSA 4GDKB 2VRRB 1IBXA 1TKYA 3DCGA 2VZKB 1VDVA 2KDFB 3P42A 3HHMA 3JVZX 1FXTB 4C00A 3RPFC 3APCA 1SSNA 4HPLB 3VTUA 1QOAA 2J1QA 1N5XA 3NZSA 4I6NB 2V3PA 1DGJA 4LLGM 4N59A 2EKEC 1OQYA 2V0GA 1SGHA 1VJKA 2PIAA 3VH3B 2JT4B 1NI3A 1E0ZA 3ETRA 1LQBA 3CSTA 4WQMA 2HJ8A 3TBLD 3AEDB 1HTOA 4GDLA 4HKZE 1MFWA 1UWXA 3TCAA 2INNE 3V62A 3BK2A 4A55A 4II3B 4RGTA 2RPQA 1WE7A 3KW5B 1LO5D 5IO9A 4K7WA 4P16A 4PYUA 4WIPA 4H2AA 2EKIA 4HROA 4GU2A 3HM3A 1UBIA 1XCTL 1E8XA 5IAAC 1WR1A 2HE7A 3W1SC 5JHAA 4NZLB 1D3ZA 4RF6A 3X0WA 1TJEA 2WHIA 3DBLB 3H6NA 3PTFC 1J7AA 4EKUA 4XE0A 2JXXA 3BY4B 3S2AA 3DBLI 1MVKA 1UF0A 2K6QA 1X1MA 2YLMA 4LDTB 3Q3MC 4OZCA 1JWSD 3U7ZA 3N32A 2WXPA 4K3CA 3ML9A 3ZIMA 2Y3AA 3TEXA 2IYDB 1V1PB 3O13A 2NBVB 1OTRB 3P4PB 5KHQA 1NI2A 1FXAA 1JALA 1XD3B 2NMQA 2BWFA 3NVWA 2ZVNA 3IHPC 3Q8BA 5G5HA 2KQ7A 3HIZA 2LHEA 1CK1A 1BT0A 1KOTA 2RD0A 2XK5B 4I6LB 4A9AA 4BBNC 1TZOA 2N7EA 3K9OB 2N1VA 2MBOA 3BVZA 4W9LA 1JMLA 1Y56A 2MJEA 2I2YA 2KC2A 3QA8A 4IUMB 4KDIC 1D5XC 2JF5A 2K39A 5CHWA 2MSED 1UELA 2X38A 3L08A 3Q8AA 1QQRA 3M63B 4RNAA 3QC8B 3U52E 4XWWA 3Q3FA 2FAZA 4ANWA 2N7JA 3L4PA 4YSXB 1WX7A 1AYFA 3SR6A 3ZLZA 2D2QA 2QIEB 3VDZA 1GAQB 3RCZA 1KLGD 3GE8C 4W9IA 5MPOA 2FUHB 2GLSA 2LWPA 3ZUNA 1MG4A 1L0YB 2YEPF 1JWUD 2KVZA 3A4RA 4M00A 3KWVA 4DXFA 2LD9A 1GC6A 3AE8B 2FIFA 4IKGA 3AH7A 2BBCA 3PPAA 2BYEA 4MACA 4KX6B 4HDQA 5D3IB 1NDDA 3WA0A 5D7GA 2W3RA 5AUKA 2J52A 2QC8A 1N6ZA 1ZPSA 2DYBA 1QOFA 4NY0A 2XK5A 3MC9A 1GJZA 1GUAB 4HEA1 2N9PC 1LGRA 5CHFA 3C19A 3RMKC 3PLVA 4S17A 4IM2A 1N5WA 2JRIB 1C1YB 1N62A 4AP4C 5LXHA 5HFYA 4KKJA 1QT9A 1C78A 5D3DA 1V80A 1UBQA 2FCQA 1T0SC 5CHVC 5J2RA 1I4PA 4RF8A 1FIQA 4DHJD 3TEZA 3R2IA 4GXBA 2LGIA 1ZXIA 1OQQA 5JZEB 4ITKA 4IM3A 1H4RA 3ZDTA 5DCNA 4HJGE 4ZYNA 1U4AA 4URKA 1EF1A 1K51A 2YEPB 1KF6B 2KJ6A 3SD5A 3N3KB 3DVNU 2WXOA 2D32A 3DBSA 1WYGA 1K52A 3DWMA 3VRAB 3OG5A 1D4BA 2K9XA 1WZ3A 2Z59B 4GVYA 3PT2B 2WDRB 3BINA 4W9FA 4RF9A 2MJDA 3LXFA 4ACFA 1I7HA 4E3CA 2KWDA 1RLFA 2RDBC 3V60A 5IN7A 3GE3C 1VR9A 2BW2A 2Q5WD 2OJRA 4DWFA 2FCSA 5E6PA 2INDC 2L3ZA 4IC7B 1WXMA 2RDHA 3CF6E 3P4SB 4TQ0A 2W54A 3U2SC 3WAPA 3ENEA 3CMMB 3LVWA 2PW9A 1G0WA 1WFYA 1KLUD 1D5MC 4FULA 4IG7B 1N63A 3N9YC 1OFFA 5D94A 3SFDB 5BMHA 2KZRA 3UQBA 3H1UA 4O1NA 4TUUA 3UF8A 1F0ZA 1STEA 2LZ6A 2D10A 2SAKA 3UQAA 1ZDXA 4YWGG 1VZ6A 2K5PA 4PT5A 3WANA 1RM6C 2D3BA 1HTQA 1NEKB 1V97A 2AQ2B 4BKSA 3OWEB 3W1SA 4OZAA 5DPWA 1P9DU 4G11A 1Q10A 2D3CA 3NZTA 1XQQA 3P1MA 4NAWB 3Q3JA 4LCDE 1XCQL 2AQ3B 2B3AA 2WXNA 4FJVB 4GIVA 2WXGA 1IGDA 4HCPB 3B2GA 3B6RA 5DPTA 1LFDA 2ONQA 1WGKA 2N9KA 4ICUA 4J3OD 3UIOB 1B1ZA 2MLBA 1SD0A 4BZAA 4XYCA 3Q8CA 2IO3B 2IZVB 4ZOHC 3QQ8B 1PUTA 4KZ0A 2JZZA 1AWDA 1WJUA 2N9XA 2ZNVC 3ZNZB 2J0MA 3EFCA 4FN2A 4MSMB 4FA6A 2L8JA 2X8XX 4MJSB 4JE3B 1UH6A 3P4RB 2CRKA 4IWPA 4GLSC 3O65B 3VH4B 4OHJA 4MT5A 1C9FA 4KSLC 2HD5B 3L10B 2BKRB 2KMAA 2UU7A 3FKYA 2DENB 1CMXB 1TS3A 2OJWA 1PQSA 4RH6A 3P2BA 3PVLA 3R2TA 3T9LA 1WGDA 1FEHA 3ONSA 1RRBA 4RGOS 1WM2A 4UDUC 1KLVA 1T6BX 1B9RA 1SJED 2KD0A 3B2FA 3CIRB 1FNVA 3VUYA 5EE9A 3L2DA 3IG3A 3MC8A 1EU4A 3E9SA 5I4DA 2WP9B 4N6EB 4C4VB 2V9HA 4FADA 2BWES 3NJTA 1XEEA 1FCCC 1FD6A 1IPGA 1TIFA 2I1JA 3ABVB 3AE2B 3VTWA 1SB3C 1P98A 4KV2A 2KKCA 2BT6A 3JQ3A 2G3QB 4II2B 3BWUD 2L83A 5G5GA 3BYYB 2MH7A 5JH5C 4BAXA 2DBYA 1WXVA 1JW9D 2BKFA 4OVVA 5HHDG 2CJNA 2W82A 1V8CA 2JXTA 1QOBA 2MQJA 2MWSB 4JGHB 2KT7A 1FFUA 4ZRIA 2WDTB 2KTFA 1E6EB 1V1PA 4Q2RA 4C80A 2NR2A 3HK0A 3QARA 3NRZA 1L7YA 4XZ4A 2WU2B 2JZPA 4GN1A 5DPRA 2KLCA 4CHKA 3SHQA 2UYZB 1XT9B 3FC4A 3AEAB 1JRPA 4GGQA 1TS5A 2XNAC 1E7UA 2ZZPB 1MHHE 2SEBD 3VVWB 2ZCBA 2XEWA 3QCAA 1WXQA 3PHXB 2QSDA 5AZHA 4K7SA 2AEHA 4KDLB 1QH4A 2KK8A 1LXDA 1ZKHA 2GBJA 2ZPNA 1T0RC 4DXAB 2AX5A 3TIXA 1EWYC 4PS8A 3WAOA 1RYJA 1DOXA 1OEYA 1V4GA 2KTRB 1FNUA 4YTMB 1TKGA 1FCLA 1H8CA 3DBHI 1A5RA 4W9DA 3AE4B 1VRAB 1FM0D 2DZKA 4KVGB 1C76A 1L0XB 3RD2A 2LUMA 4OVUA 2I1KA 2KNBA 4Z9MA 4MJSA 4JWSC 4XC2A 1WIAA 3DHGC 2KVRA 3R66C 2NTTA 4HRSA 1WJNA 1E90A 4IDIA 2WDVB 1J19A 2H88B 2WDQB 2J53A 1M94A 3RZWC 3N20C 4GDKA 1T3QA 3ALBA 1QKZA 1R4NB 2KFJA 3NZUA 3VR8B 2ZEQA 2M1MA 3SDLC 4A8XC 1JWBD 2J42A 2EELA 3V6EB 4NNJB 1WR6E 5IOIA 2LRUA 3EHVA 4FBJB 2BF8B 4MDKE 2W55A 2O2VA 5BYQA 3W5VB 1YOVB 3HM6X 2DNFA 3EC8A 4F7ZA 2M19A 2PMVA 2ZJDA 2WXLA 5AZGA 5DPSA 4ASWC 3KQ4A 4RMAA 3T8MA 4DDID 2V4LA 1C4PA 4HPPA 4DXGA 3VR9B 3PRZA 1R8GA 1YX5B 2L0FA 1XF5L 1XLPA 3ZYYX 2K25A 3BZDB 4CYEA 3AE3B 2JYTA 2AWTA 4BKTA 1WE6A 2IO0B 3ZW3A 4E74A 4AWJA 1HZ5A 2NTSA 5C1ZA 2L7RA 2JY6A 2DAJA 1V5OA 3U4EG 5CX3A 3P63A 4GDLB 2JWZA 2BYVE 1DOIA 4A20A 4PS7A 1ZUD2 2IO2B 3L16A 4QAYA 1YIWA 3AI5A 2N9LA 4BOSC 3ZNHB 2AYOB 2JYEA 1WWTA 2VH1A 5IKCM 4RF7A 3UIPB 4LDTD 4ZRQA 4B0EA 1TZ1A 1HA5A 2ZVOA 1PGXA 4NPNA 2QCZA 4KIKA 2WQYB 3I63C 1Q1OA 1R7SA 2LHDA 4HLEA 3KLSX 2KDEB 4EE2A 1UZXB 1F2RI 4LJPB 5AZFA 2KDIA 4OW0A 4HK2A 2BGFA 1QLBB 3NS1A 2KOXA 3VRBB 3PSEB 2LGDA 1PFDA 2DWQA 3L2EA 1FPYA 4LNIA 2GWCA 2DHZA 3VHTC 3HVZA 3QAQA 2LUEA 2IO1B 2KXJA 2N7DA 2LJ5A 4Q2JA 3R7RA 1SEBD 3RNGC 4GVZA 1Q5WB 3ZNID 2WYQA 3AV8A 2NPTB 1AARA 4XDCA 2ZNVB 5J99A 1I4QA 3Q3NC 3RYTA 1UGJA 2LEKA 3N30A 1D5ZC 3A9JB 4REZA 1WYWB 4BHLA 3RUIB 1E5WA 3URYA 3PV1A 1SIFA 1E10A 3KUCB 2KN5A 1ESFA 4DBGA 2MJ3A 4JIOU 3TMPB 2C7MB 5BMIA 4YSYB 3PZ8A 4HWIB 3MHZA 3NG0A 1QILA 2N9EB 2G45B 1TGZB 4B0MA 3TEWA 1F1HA 1L6UA 1NYRA 2Y5BB 2PVGC 4EZLA 4HVBA 3AULA 4LNNA 4EOYA 1P52A 3ZNGC 1E9MA 3DOWA 4DQOC 3A1QB 4LNOA 1FNWA 2O6VD 2MW5A 4HDOA 1HZ6A 2D11A 3HVDA 4NJCA 1IBXB 2DX5B 2MP2B 5E6OA 3AU5A 4NJ7A 5HI1A 3ZDMC 2QILA 3DHHC 2JVCA 1I0EA 1HE8A 1IP9A 3DBRB 1WX8A 1V1OA 1L4ZB 5GMVA 4BG4A 3RI7C 1C3TA 1TS2A 2JWUA 2KDMA 4W9JA 4DHZB 3U7DA 3OJ4B 4W9HA 4NQKE 3EA6A 1JCKB 1TT5B 5D6JB 2JUOA 3AU4A 1GNUA 1V5TA 5AEKB 2JPHA 5J17A 3RNBC 1WMHA 4G50A 1TT4A 3H7PB 4IW0A 1P1AA 1WGRA 3EGRA 1C4CA 5BYSA 3VUXA 1XLNA 4KZCA 3A9KB 4AJWA 1RAXA 1SE9A 2WXHA 1JQ4A 2D07B 5EDSA 2KX0A 4P7IA 2DYOA 2M8SA 1TKEA 4PK1A 1RFKA 4W9KA 1FRDA 2C9WB 2FE8A 4B6WA 2Z0EB 3OJ3A 1E7VA 1ZOYB 1WI0A 4OVZA 4L1BA 2NS5A 1WSPA 3GB1A 2IGDA 1GC7A 3B08A 1HQRD 2HTHA 2IGGA 1I4GA 4GW2A 1VZ7A 2A5UA 2KACA 2GBMA 3V61A 1ISNA 3Q8EA 3PZDA 2KFKB 2BS4B 4OZBA 1JRUA 4NAMA 2ZW0A 2J0JA 1WH3A 2KX3A 5BYRA 3DVGY 1YN3A 4BFRA 1JWAD 2L76A 2KDBA 2Y5CA 3ZJUA 3DQVA 2KJHB 4TKNA 3QX1A 1QOGA 1YMHE 1SBBB 3MFGA 1VA6A 2BTEA 4WURA 4HPMB 2YVCA 3I5JC 1ET6A 3J9CA 2C7NB 2Z0DB 2ZCCA 1SF0A 4GB9A 4K1RB 3V6CB 3L13A 2R61A 5C23A 1WZ0A 5KHOA 1WM3A 4D2KA 1WJ6A 4C7YA 2KAJA 3JPZA 2TSSA 3V3XA 4DHZE 2K1FA 1YQBA 2RGFA 1JROA 3ZVVA 5LNK1 4FXCA 2KFKA 2FIDA 2GWDA 3AECB 2RSUA 5IA7A 1CJEA 1V6EA 5HG2A 2R2OA 4WAAA 2KANA 3M62B 1WXSA 2EMTA 4YTNB 2KJRA 1K8RB 2H89B 3DPDA 3AEBB 1BMLC 2WXRA 4USAA 1E8YA 4KGRA 4ZHPA 4F1SA 2L52A
chains in the Genus database with same CATH topology
2D3AA 2GLSA 4S17A 1HTQA 4AM1A 1RL9A 3ZXVA 4Z9MA 2UU7A 3DREA 3L2EB 3FKYA 3NG0A 4BHLA 4LNFA 1SD0A 4Q2RA 3JQ3A 3L2DA 2BVCA 4XYCA 2J1QA 1M15A 2D3CA 1CRKA 4RF6A 2LGSA 2OJWA 4GW2A 1BG0A 1HTOA 2QC8A 1QK1A 2WGSA 3DRBA 3L2EA 2WHIA 4GVZA 1G0WA 3JPZA 3JU5A 4GVYA 4RF7A 1F1HA 4BAXA 4HPPA 5J9AA 4RF9A 1VRPA 4ACFA 3JU6A 1P50A 5J99A 4BG4B 1I0EA 1QH4A 3ZXRA 4LNNA 1U6RA 4GW0A 1P52A 4LNKA 2CRKA 4S0RA 3B6RA 1LGRA 4BG4A 1F52A 3M10A 4RF8A 2D3BA 1FPYA 4LNIA 4LNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3A A;  2GLS A;  4S17 A;  1HTQ A;  4AM1 A;  1RL9 A;  3ZXV A;  4Z9M A;  2UU7 A;  3DRE A;  3L2E B;  3FKY A;  3NG0 A;  4BHL A;  4LNF A;  1SD0 A;  4Q2R A;  3JQ3 A;  3L2D A;  2BVC A;  4XYC A;  2J1Q A;  1M15 A;  2D3C A;  1CRK A;  4RF6 A;  2LGS A;  2OJW A;  4GW2 A;  1BG0 A;  1HTO A;  2QC8 A;  1QK1 A;  2WGS A;  3DRB A;  3L2E A;  2WHI A;  4GVZ A;  1G0W A;  3JPZ A;  3JU5 A;  4GVY A;  4RF7 A;  1F1H A;  4BAX A;  4HPP A;  5J9A A;  4RF9 A;  1VRP A;  4ACF A;  3JU6 A;  1P50 A;  5J99 A;  4BG4 B;  1I0E A;  1QH4 A;  3ZXR A;  4LNN A;  1U6R A;  4GW0 A;  1P52 A;  4LNK A;  2CRK A;  4S0R A;  3B6R A;  1LGR A;  4BG4 A;  1F52 A;  3M10 A;  4RF8 A;  2D3B A;  1FPY A;  4LNI A;  4LNO A; 
#chains in the Genus database with same CATH topology
 4MGK E;  2GRI A;  2REX A;  3AB5 A;  1WY8 A;  2PTL A;  4MGZ E;  2JX5 A;  2INP E;  3DVG X;  3X23 A;  3RN9 C;  4G3X B;  4WJO A;  2DYM A;  5H92 C;  1GPX A;  3JSV A;  3H9D A;  2FNJ B;  1I4H A;  3R7Q A;  1PGB A;  4YSZ B;  2BS3 B;  3PRP B;  1SE2 A;  3NVZ A;  1L4D B;  1L5P A;  4YL8 A;  4K7U A;  1YD8 U;  1TBE A;  4WAF A;  4LNF A;  2J7Q B;  3DBR I;  1QK1 A;  4GOC A;  2NBU A;  4EEW A;  2KQS A;  1F2R C;  3H7S A;  2MBQ A;  4IOI E;  3GP7 A;  1NVI D;  1ZDV A;  2HTM E;  3AM9 A;  3EEC A;  3KYC D;  4YT0 B;  3FIL B;  2IDY A;  1KH0 A;  1WGY A;  2O6V B;  2CHW A;  2N0S B;  3JW0 X;  3LYY A;  1UGM A;  4RM8 A;  1WRI A;  3BII D;  1FMA D;  1ROE A;  4RFB A;  1EO6 A;  1NBF C;  2K8C A;  3NUH B;  2MCN B;  4MM3 B;  4ZRK A;  1GG3 A;  2K8H A;  2INC C;  2QHO A;  5LLI A;  4BKS D;  3I9V 1;  4A90 A;  2DZI A;  2K22 A;  4GW0 A;  2KWC A;  2PLP A;  1WRD B;  5D2M B;  4MGY E;  2NCN A;  1FO4 A;  4WJP A;  1DOY A;  2M4N A;  2D5G A;  2DZM A;  2LI5 A;  2G4D B;  3Q14 C;  1V81 A;  1M15 A;  1AW7 A;  2PJH A;  2PE6 B;  2PKO A;  2O6V A;  3H8H A;  3RNF C;  1ZE3 D;  3LN6 A;  4IWQ A;  2WXJ A;  3B1L X;  3PGE A;  5BO4 B;  1WXA A;  3HRD D;  1F77 A;  3AN1 A;  4BVU C;  2ICI A;  4C7Z A;  1WGG A;  3ZKJ C;  1VCB A;  4ZHO A;  2JQR B;  3C0R B;  2DAF A;  3MHS D;  1EUV B;  4LNK A;  2WU5 B;  3L0W B;  3DHI C;  4JX1 C;  1Q0W B;  1KJT A;  3I57 A;  3ZXV A;  2K0P A;  1L6V A;  3KVF B;  5AUI A;  3QIJ A;  3N1Z C;  4LTU A;  5E6J A;  4R3D A;  3JU5 A;  4EZK A;  2EMS A;  2CHZ A;  1S1Q B;  2GOW A;  4C56 C;  1CQV A;  3DBH B;  1OGW A;  3HUI A;  1TS4 A;  2KO3 A;  3PHW B;  1D6E C;  4S0R A;  2LFI A;  2L05 A;  2PVO D;  2ON8 A;  1BXT A;  2KWU B;  2J4X A;  2LVP A;  2AL3 A;  2ZPY A;  4LJO B;  2C60 A;  1VLB A;  4RM9 A;  2OED A;  5CTR C;  4MH8 A;  2IPK D;  3FAH A;  2LXA A;  3H7P A;  3M3J A;  2V1Y A;  4KSK C;  1YQ3 B;  4GMV A;  4ICV A;  3ZRC A;  4JL9 A;  3MC0 B;  3PS6 A;  4RF1 A;  5G55 A;  3P4Q B;  4HJK A;  3VXW A;  2G1E A;  2CKH B;  2JSV X;  2PEA A;  2M17 A;  4AUQ C;  2QDF A;  4BG4 B;  1EWC A;  3NZ3 A;  2KN4 A;  3MP9 A;  1R4N I;  2FCN A;  3C8Y A;  3Q6B A;  1P7E A;  1P7F A;  4TQ1 A;  1E8Z A;  4TMA B;  1I35 A;  1YJ1 A;  3KWL A;  2KMC A;  3OAW A;  3LB8 C;  3GOE A;  1N60 A;  1T0Q C;  3RNC C;  1ACC A;  2XBB C;  3FIL A;  3W2D A;  4M0W A;  1MG8 A;  3M95 A;  4B95 A;  5J9A A;  2LVQ A;  2L0T A;  1K50 A;  2MBH A;  2K6D B;  4MSQ B;  5J18 A;  1N61 A;  2CR5 A;  4KGT A;  1TY2 A;  2IBI B;  3GZN B;  4AQ7 A;  2LXC A;  5C3J B;  4KGS A;  1V9J A;  2L1A A;  2LJI A;  1ZGU B;  3JU6 A;  3AE7 B;  4US8 A;  2N1W A;  3MJW A;  3AE9 B;  1YQ4 B;  3ZTD A;  2BQQ A;  4W9C A;  1NEN B;  3BK1 A;  4WWO A;  4WH4 A;  3VTV A;  2CS4 A;  3R8B A;  1E8W A;  2G4S A;  3WAM A;  4ZYS A;  1MPE A;  3QWZ B;  4XWT A;  2IY1 B;  3TL5 A;  1JWM D;  2MA9 B;  2WXK A;  3U8Z A;  3VFK A;  5FR3 A;  3VAW A;  5C2T B;  4NJ6 A;  3WAL A;  1MI0 A;  3A9J A;  3VQI A;  1OEY J;  3N1X C;  1T0Y A;  4LK0 M;  1UD7 A;  3A33 B;  3AEE B;  5EE3 A;  2D3G A;  1WMH B;  5G2N A;  3Q2A C;  2A4Z A;  1F52 A;  3LN7 A;  2HJ1 A;  2V3S A;  3DWG C;  2ACZ B;  4ZDV A;  1RFA A;  2BB5 A;  2WGS A;  4M0W B;  1IUE A;  1CZP A;  2E3T A;  3N1Y C;  3Q8F A;  1GB4 A;  2NVU I;  3KH0 A;  3RNE C;  3CSF A;  3AE6 B;  5FKA C;  3DVN V;  3ZXR A;  3AXC A;  2WXI A;  4M01 A;  3D32 A;  2FUG 1;  3AEG B;  2QEJ C;  2D33 A;  2WLB A;  4W9E A;  2NBW B;  1S3S G;  4B9K A;  3AE5 B;  1P3Q U;  1YN5 A;  4M8M A;  2WS3 B;  4XGA B;  3ZGZ A;  2RDG A;  1KTK A;  2BYT A;  1PDX A;  2QJL A;  2CJO A;  3QHT A;  3W5U B;  4JWU C;  2ZW1 A;  2GBK A;  2MRP A;  3IT4 B;  2LMC A;  3BVG A;  4RCO A;  3QK0 A;  2RPV A;  4YXD B;  2E6X A;  4TSS A;  4ZRJ A;  3ML8 A;  2V4I B;  5TSS A;  2KYW A;  2PE9 A;  4ANU A;  1MJD A;  2VZK D;  3LJ3 A;  1J0G A;  4WJQ A;  3GS2 A;  4BBN F;  3NVY A;  2MEK A;  5BMG A;  3NVV A;  2WX0 A;  1LM8 B;  5GXG B;  2GI9 A;  2N4F A;  1ZP0 B;  1L2N A;  3EFU A;  3IG5 A;  5T8I A;  3IBE A;  2AQ1 B;  2NPT A;  3RT3 B;  4AM1 A;  1R4M I;  1SE4 A;  4W9G A;  3LDZ E;  4IM0 A;  5HKH A;  2CHX A;  1UUP A;  3Q69 A;  3SEB A;  4JPS A;  3NY5 A;  1YJI A;  3MJ5 A;  2O2V B;  3GZN I;  3PZ7 A;  2BB6 A;  3B0A A;  3IAS 1;  5JHB A;  4MH0 E;  1T5X D;  3ZJV A;  2C5L C;  2LGY A;  2MHJ A;  5IP4 D;  4EFO A;  1I4X A;  2D3A A;  3B9J A;  1XLQ A;  2K3U A;  1RL9 A;  3IAM 1;  4C4V A;  3PRM B;  3RZF A;  2L32 A;  3A9K A;  4FJY A;  1FRR A;  4NQL B;  3LVV A;  4FHJ A;  4A3O A;  3IXS A;  5JXV A;  1J7C A;  3DRB A;  1WF9 A;  1ZW7 A;  2MBE A;  3K9P B;  3L54 A;  3ZQ4 A;  1OQR A;  3CWI A;  3AE1 B;  3ZRF A;  1P50 A;  3MTN B;  2KHW B;  2PPH A;  2WXF A;  2ASQ A;  2IJ0 A;  4P1B C;  3U30 A;  2M0X A;  1C77 A;  3L17 A;  3DDC B;  2JRH A;  3A1Q A;  2KC1 A;  2LGX A;  5EE0 A;  1WX9 A;  1TY0 A;  1E7P B;  4MM3 A;  1V49 A;  1SE3 A;  2HDE A;  2I38 A;  4XX5 A;  4FHK A;  2KWV B;  2LRW A;  1KRH A;  3T3O A;  3M10 A;  3Q3O C;  1TYG B;  1WJ4 A;  1SJH D;  4L2Y A;  2BYF A;  2MP2 A;  5L95 C;  1J8C A;  1UNS A;  5FR6 A;  1C4A A;  4ANX A;  2R2Q A;  1VZ8 A;  1DYQ A;  4M02 A;  2KTR A;  4RF0 A;  3V05 A;  4E71 A;  2KLG A;  1QZE A;  2MX2 A;  1XO3 A;  2K8B A;  2B76 B;  3RFZ B;  1Z5S B;  1J7B A;  1PGA A;  4NAW A;  4DHJ B;  4X57 B;  3KUZ A;  2GBR A;  3JSV B;  4A3P A;  3RUL A;  3R3M A;  2DLB A;  3UI3 A;  3SFE B;  4CQN A;  5L83 A;  1I42 A;  2G9H D;  2IGH A;  1YN4 A;  1ET9 A;  4PS3 A;  1FFV A;  1V2Y A;  1YNT E;  4WJN A;  1BUI C;  3DRE A;  3L2E B;  3A4S C;  4RGM A;  4TV3 A;  3NOB A;  4ZRP A;  5H8Y E;  3UIN B;  3ZO5 B;  1BG0 A;  2LAS A;  3I3T B;  3WIM A;  2FBW B;  1EU3 A;  3JYU A;  3IFW B;  2UWQ A;  3TSS A;  3KUD B;  1F9J A;  2GB1 A;  1YX6 B;  4MEL A;  2J0K A;  3EUB 2;  2OHF A;  2L00 B;  1Z2M A;  2MBB B;  4ARC A;  2M56 B;  2LGS A;  1AN8 A;  4A6Q A;  4YTP B;  3QJZ A;  3T3N A;  2WXM A;  2BS2 B;  2RMM A;  3VUW A;  1IYF A;  1KFY B;  1NYQ A;  2V3N A;  2FCM A;  1Y8R C;  4GSW A;  2M0A A;  1G6J A;  4AOF A;  4CO7 A;  2QMT A;  2JU6 X;  2KMM A;  2OOB B;  4JLC A;  4L23 A;  1MHX A;  1R4M B;  1XXG A;  4MEM A;  3W9C B;  3ZJT A;  3TJP A;  4WWN A;  4KIK B;  4IWO A;  4HKQ A;  4PYZ A;  4K81 A;  1HXY D;  1C79 A;  1EF5 A;  4G0N B;  4US9 A;  1XLO A;  2XN9 C;  1TTN A;  2Y5P A;  1A70 A;  1M4V A;  1U6R A;  1P0R A;  1V86 A;  4JQW C;  2W9N A;  3PO0 A;  3NS8 A;  4P6V F;  2IY0 B;  1GB1 A;  2WWZ A;  4WWP A;  1VD2 A;  2DZJ A;  4M8N A;  2JZ3 B;  3IG8 A;  1PYW D;  4FJZ A;  4BKG A;  3RNA C;  4BOZ B;  4K3B A;  4DDG D;  3NHE B;  3PLU A;  4WWM A;  1ZXH A;  1HEZ E;  2RR9 A;  1UWM A;  2WXQ A;  2AL6 A;  2VH2 A;  1FXI A;  3BVM A;  1RWS A;  2WNM A;  1SXT A;  2GMI C;  2CU3 A;  4HXD A;  1WGH A;  3APD A;  3AMZ A;  1IGC A;  1KM7 A;  3W1Y A;  5E6N A;  1VRP A;  1L0V B;  5TR5 A;  3UGB B;  1QF6 A;  4HCN B;  3BYT B;  1ENF A;  3SU8 X;  3TEY A;  2GBN A;  3E56 A;  3ECI A;  4EUT A;  3IT6 B;  5EE1 A;  2BVC A;  4I6P A;  4AJY B;  1SIJ A;  4XDD A;  3IVF A;  3ZTC A;  2Z8L A;  4WQO B;  3APF A;  5LXI B;  1I4R A;  4MGI E;  5FK9 C;  4FLH A;  4DK5 A;  2CU1 A;  1YJJ A;  4ARI A;  4ANV A;  2WX1 A;  3TUO A;  4EZJ A;  4N58 A;  1K53 A;  2W3S A;  4N9F 4;  4P1C C;  4F8C B;  3OLM D;  4KKI A;  2C7H A;  1GOZ A;  1EM7 A;  4J6I A;  3WCQ A;  2KQ4 X;  4AS1 A;  1CRK A;  3PRE A;  2LVO A;  3AEF B;  3KYD D;  4RGN A;  2BPS A;  4GDK B;  2VRR B;  1IBX A;  1TKY A;  3DCG A;  2VZK B;  1VDV A;  2KDF B;  3P42 A;  3HHM A;  3JVZ X;  1FXT B;  4C00 A;  3RPF C;  3APC A;  1SSN A;  4HPL B;  3VTU A;  1QOA A;  2J1Q A;  1N5X A;  3NZS A;  4I6N B;  2V3P A;  1DGJ A;  4LLG M;  4N59 A;  2EKE C;  1OQY A;  2V0G A;  1SGH A;  1VJK A;  2PIA A;  3VH3 B;  2JT4 B;  1NI3 A;  1E0Z A;  3ETR A;  1LQB A;  3CST A;  4WQM A;  2HJ8 A;  3TBL D;  3AED B;  1HTO A;  4GDL A;  4HKZ E;  1MFW A;  1UWX A;  3TCA A;  2INN E;  3V62 A;  3BK2 A;  4A55 A;  4II3 B;  4RGT A;  2RPQ A;  1WE7 A;  3KW5 B;  1LO5 D;  5IO9 A;  4K7W A;  4P16 A;  4PYU A;  4WIP A;  4H2A A;  2EKI A;  4HRO A;  4GU2 A;  3HM3 A;  1UBI A;  1XCT L;  1E8X A;  5IAA C;  1WR1 A;  2HE7 A;  3W1S C;  5JHA A;  4NZL B;  1D3Z A;  4RF6 A;  3X0W A;  1TJE A;  2WHI A;  3DBL B;  3H6N A;  3PTF C;  1J7A A;  4EKU A;  4XE0 A;  2JXX A;  3BY4 B;  3S2A A;  3DBL I;  1MVK A;  1UF0 A;  2K6Q A;  1X1M A;  2YLM A;  4LDT B;  3Q3M C;  4OZC A;  1JWS D;  3U7Z A;  3N32 A;  2WXP A;  4K3C A;  3ML9 A;  3ZIM A;  2Y3A A;  3TEX A;  2IYD B;  1V1P B;  3O13 A;  2NBV B;  1OTR B;  3P4P B;  5KHQ A;  1NI2 A;  1FXA A;  1JAL A;  1XD3 B;  2NMQ A;  2BWF A;  3NVW A;  2ZVN A;  3IHP C;  3Q8B A;  5G5H A;  2KQ7 A;  3HIZ A;  2LHE A;  1CK1 A;  1BT0 A;  1KOT A;  2RD0 A;  2XK5 B;  4I6L B;  4A9A A;  4BBN C;  1TZO A;  2N7E A;  3K9O B;  2N1V A;  2MBO A;  3BVZ A;  4W9L A;  1JML A;  1Y56 A;  2MJE A;  2I2Y A;  2KC2 A;  3QA8 A;  4IUM B;  4KDI C;  1D5X C;  2JF5 A;  2K39 A;  5CHW A;  2MSE D;  1UEL A;  2X38 A;  3L08 A;  3Q8A A;  1QQR A;  3M63 B;  4RNA A;  3QC8 B;  3U52 E;  4XWW A;  3Q3F A;  2FAZ A;  4ANW A;  2N7J A;  3L4P A;  4YSX B;  1WX7 A;  1AYF A;  3SR6 A;  3ZLZ A;  2D2Q A;  2QIE B;  3VDZ A;  1GAQ B;  3RCZ A;  1KLG D;  3GE8 C;  4W9I A;  5MPO A;  2FUH B;  2GLS A;  2LWP A;  3ZUN A;  1MG4 A;  1L0Y B;  2YEP F;  1JWU D;  2KVZ A;  3A4R A;  4M00 A;  3KWV A;  4DXF A;  2LD9 A;  1GC6 A;  3AE8 B;  2FIF A;  4IKG A;  3AH7 A;  2BBC A;  3PPA A;  2BYE A;  4MAC A;  4KX6 B;  4HDQ A;  5D3I B;  1NDD A;  3WA0 A;  5D7G A;  2W3R A;  5AUK A;  2J52 A;  2QC8 A;  1N6Z A;  1ZPS A;  2DYB A;  1QOF A;  4NY0 A;  2XK5 A;  3MC9 A;  1GJZ A;  1GUA B;  4HEA 1;  2N9P C;  1LGR A;  5CHF A;  3C19 A;  3RMK C;  3PLV A;  4S17 A;  4IM2 A;  1N5W A;  2JRI B;  1C1Y B;  1N62 A;  4AP4 C;  5LXH A;  5HFY A;  4KKJ A;  1QT9 A;  1C78 A;  5D3D A;  1V80 A;  1UBQ A;  2FCQ A;  1T0S C;  5CHV C;  5J2R A;  1I4P A;  4RF8 A;  1FIQ A;  4DHJ D;  3TEZ A;  3R2I A;  4GXB A;  2LGI A;  1ZXI A;  1OQQ A;  5JZE B;  4ITK A;  4IM3 A;  1H4R A;  3ZDT A;  5DCN A;  4HJG E;  4ZYN A;  1U4A A;  4URK A;  1EF1 A;  1K51 A;  2YEP B;  1KF6 B;  2KJ6 A;  3SD5 A;  3N3K B;  3DVN U;  2WXO A;  2D32 A;  3DBS A;  1WYG A;  1K52 A;  3DWM A;  3VRA B;  3OG5 A;  1D4B A;  2K9X A;  1WZ3 A;  2Z59 B;  4GVY A;  3PT2 B;  2WDR B;  3BIN A;  4W9F A;  4RF9 A;  2MJD A;  3LXF A;  4ACF A;  1I7H A;  4E3C A;  2KWD A;  1RLF A;  2RDB C;  3V60 A;  5IN7 A;  3GE3 C;  1VR9 A;  2BW2 A;  2Q5W D;  2OJR A;  4DWF A;  2FCS A;  5E6P A;  2IND C;  2L3Z A;  4IC7 B;  1WXM A;  2RDH A;  3CF6 E;  3P4S B;  4TQ0 A;  2W54 A;  3U2S C;  3WAP A;  3ENE A;  3CMM B;  3LVW A;  2PW9 A;  1G0W A;  1WFY A;  1KLU D;  1D5M C;  4FUL A;  4IG7 B;  1N63 A;  3N9Y C;  1OFF A;  5D94 A;  3SFD B;  5BMH A;  2KZR A;  3UQB A;  3H1U A;  4O1N A;  4TUU A;  3UF8 A;  1F0Z A;  1STE A;  2LZ6 A;  2D10 A;  2SAK A;  3UQA A;  1ZDX A;  4YWG G;  1VZ6 A;  2K5P A;  4PT5 A;  3WAN A;  1RM6 C;  2D3B A;  1HTQ A;  1NEK B;  1V97 A;  2AQ2 B;  4BKS A;  3OWE B;  3W1S A;  4OZA A;  5DPW A;  1P9D U;  4G11 A;  1Q10 A;  2D3C A;  3NZT A;  1XQQ A;  3P1M A;  4NAW B;  3Q3J A;  4LCD E;  1XCQ L;  2AQ3 B;  2B3A A;  2WXN A;  4FJV B;  4GIV A;  2WXG A;  1IGD A;  4HCP B;  3B2G A;  3B6R A;  5DPT A;  1LFD A;  2ONQ A;  1WGK A;  2N9K A;  4ICU A;  4J3O D;  3UIO B;  1B1Z A;  2MLB A;  1SD0 A;  4BZA A;  4XYC A;  3Q8C A;  2IO3 B;  2IZV B;  4ZOH C;  3QQ8 B;  1PUT A;  4KZ0 A;  2JZZ A;  1AWD A;  1WJU A;  2N9X A;  2ZNV C;  3ZNZ B;  2J0M A;  3EFC A;  4FN2 A;  4MSM B;  4FA6 A;  2L8J A;  2X8X X;  4MJS B;  4JE3 B;  1UH6 A;  3P4R B;  2CRK A;  4IWP A;  4GLS C;  3O65 B;  3VH4 B;  4OHJ A;  4MT5 A;  1C9F A;  4KSL C;  2HD5 B;  3L10 B;  2BKR B;  2KMA A;  2UU7 A;  3FKY A;  2DEN B;  1CMX B;  1TS3 A;  2OJW A;  1PQS A;  4RH6 A;  3P2B A;  3PVL A;  3R2T A;  3T9L A;  1WGD A;  1FEH A;  3ONS A;  1RRB A;  4RGO S;  1WM2 A;  4UDU C;  1KLV A;  1T6B X;  1B9R A;  1SJE D;  2KD0 A;  3B2F A;  3CIR B;  1FNV A;  3VUY A;  5EE9 A;  3L2D A;  3IG3 A;  3MC8 A;  1EU4 A;  3E9S A;  5I4D A;  2WP9 B;  4N6E B;  4C4V B;  2V9H A;  4FAD A;  2BWE S;  3NJT A;  1XEE A;  1FCC C;  1FD6 A;  1IPG A;  1TIF A;  2I1J A;  3ABV B;  3AE2 B;  3VTW A;  1SB3 C;  1P98 A;  4KV2 A;  2KKC A;  2BT6 A;  3JQ3 A;  2G3Q B;  4II2 B;  3BWU D;  2L83 A;  5G5G A;  3BYY B;  2MH7 A;  5JH5 C;  4BAX A;  2DBY A;  1WXV A;  1JW9 D;  2BKF A;  4OVV A;  5HHD G;  2CJN A;  2W82 A;  1V8C A;  2JXT A;  1QOB A;  2MQJ A;  2MWS B;  4JGH B;  2KT7 A;  1FFU A;  4ZRI A;  2WDT B;  2KTF A;  1E6E B;  1V1P A;  4Q2R A;  4C80 A;  2NR2 A;  3HK0 A;  3QAR A;  3NRZ A;  1L7Y A;  4XZ4 A;  2WU2 B;  2JZP A;  4GN1 A;  5DPR A;  2KLC A;  4CHK A;  3SHQ A;  2UYZ B;  1XT9 B;  3FC4 A;  3AEA B;  1JRP A;  4GGQ A;  1TS5 A;  2XNA C;  1E7U A;  2ZZP B;  1MHH E;  2SEB D;  3VVW B;  2ZCB A;  2XEW A;  3QCA A;  1WXQ A;  3PHX B;  2QSD A;  5AZH A;  4K7S A;  2AEH A;  4KDL B;  1QH4 A;  2KK8 A;  1LXD A;  1ZKH A;  2GBJ A;  2ZPN A;  1T0R C;  4DXA B;  2AX5 A;  3TIX A;  1EWY C;  4PS8 A;  3WAO A;  1RYJ A;  1DOX A;  1OEY A;  1V4G A;  2KTR B;  1FNU A;  4YTM B;  1TKG A;  1FCL A;  1H8C A;  3DBH I;  1A5R A;  4W9D A;  3AE4 B;  1VRA B;  1FM0 D;  2DZK A;  4KVG B;  1C76 A;  1L0X B;  3RD2 A;  2LUM A;  4OVU A;  2I1K A;  2KNB A;  4Z9M A;  4MJS A;  4JWS C;  4XC2 A;  1WIA A;  3DHG C;  2KVR A;  3R66 C;  2NTT A;  4HRS A;  1WJN A;  1E90 A;  4IDI A;  2WDV B;  1J19 A;  2H88 B;  2WDQ B;  2J53 A;  1M94 A;  3RZW C;  3N20 C;  4GDK A;  1T3Q A;  3ALB A;  1QKZ A;  1R4N B;  2KFJ A;  3NZU A;  3VR8 B;  2ZEQ A;  2M1M A;  3SDL C;  4A8X C;  1JWB D;  2J42 A;  2EEL A;  3V6E B;  4NNJ B;  1WR6 E;  5IOI A;  2LRU A;  3EHV A;  4FBJ B;  2BF8 B;  4MDK E;  2W55 A;  2O2V A;  5BYQ A;  3W5V B;  1YOV B;  3HM6 X;  2DNF A;  3EC8 A;  4F7Z A;  2M19 A;  2PMV A;  2ZJD A;  2WXL A;  5AZG A;  5DPS A;  4ASW C;  3KQ4 A;  4RMA A;  3T8M A;  4DDI D;  2V4L A;  1C4P A;  4HPP A;  4DXG A;  3VR9 B;  3PRZ A;  1R8G A;  1YX5 B;  2L0F A;  1XF5 L;  1XLP A;  3ZYY X;  2K25 A;  3BZD B;  4CYE A;  3AE3 B;  2JYT A;  2AWT A;  4BKT A;  1WE6 A;  2IO0 B;  3ZW3 A;  4E74 A;  4AWJ A;  1HZ5 A;  2NTS A;  5C1Z A;  2L7R A;  2JY6 A;  2DAJ A;  1V5O A;  3U4E G;  5CX3 A;  3P63 A;  4GDL B;  2JWZ A;  2BYV E;  1DOI A;  4A20 A;  4PS7 A;  1ZUD 2;  2IO2 B;  3L16 A;  4QAY A;  1YIW A;  3AI5 A;  2N9L A;  4BOS C;  3ZNH B;  2AYO B;  2JYE A;  1WWT A;  2VH1 A;  5IKC M;  4RF7 A;  3UIP B;  4LDT D;  4ZRQ A;  4B0E A;  1TZ1 A;  1HA5 A;  2ZVO A;  1PGX A;  4NPN A;  2QCZ A;  4KIK A;  2WQY B;  3I63 C;  1Q1O A;  1R7S A;  2LHD A;  4HLE A;  3KLS X;  2KDE B;  4EE2 A;  1UZX B;  1F2R I;  4LJP B;  5AZF A;  2KDI A;  4OW0 A;  4HK2 A;  2BGF A;  1QLB B;  3NS1 A;  2KOX A;  3VRB B;  3PSE B;  2LGD A;  1PFD A;  2DWQ A;  3L2E A;  1FPY A;  4LNI A;  2GWC A;  2DHZ A;  3VHT C;  3HVZ A;  3QAQ A;  2LUE A;  2IO1 B;  2KXJ A;  2N7D A;  2LJ5 A;  4Q2J A;  3R7R A;  1SEB D;  3RNG C;  4GVZ A;  1Q5W B;  3ZNI D;  2WYQ A;  3AV8 A;  2NPT B;  1AAR A;  4XDC A;  2ZNV B;  5J99 A;  1I4Q A;  3Q3N C;  3RYT A;  1UGJ A;  2LEK A;  3N30 A;  1D5Z C;  3A9J B;  4REZ A;  1WYW B;  4BHL A;  3RUI B;  1E5W A;  3URY A;  3PV1 A;  1SIF A;  1E10 A;  3KUC B;  2KN5 A;  1ESF A;  4DBG A;  2MJ3 A;  4JIO U;  3TMP B;  2C7M B;  5BMI A;  4YSY B;  3PZ8 A;  4HWI B;  3MHZ A;  3NG0 A;  1QIL A;  2N9E B;  2G45 B;  1TGZ B;  4B0M A;  3TEW A;  1F1H A;  1L6U A;  1NYR A;  2Y5B B;  2PVG C;  4EZL A;  4HVB A;  3AUL A;  4LNN A;  4EOY A;  1P52 A;  3ZNG C;  1E9M A;  3DOW A;  4DQO C;  3A1Q B;  4LNO A;  1FNW A;  2O6V D;  2MW5 A;  4HDO A;  1HZ6 A;  2D11 A;  3HVD A;  4NJC A;  1IBX B;  2DX5 B;  2MP2 B;  5E6O A;  3AU5 A;  4NJ7 A;  5HI1 A;  3ZDM C;  2QIL A;  3DHH C;  2JVC A;  1I0E A;  1HE8 A;  1IP9 A;  3DBR B;  1WX8 A;  1V1O A;  1L4Z B;  5GMV A;  4BG4 A;  3RI7 C;  1C3T A;  1TS2 A;  2JWU A;  2KDM A;  4W9J A;  4DHZ B;  3U7D A;  3OJ4 B;  4W9H A;  4NQK E;  3EA6 A;  1JCK B;  1TT5 B;  5D6J B;  2JUO A;  3AU4 A;  1GNU A;  1V5T A;  5AEK B;  2JPH A;  5J17 A;  3RNB C;  1WMH A;  4G50 A;  1TT4 A;  3H7P B;  4IW0 A;  1P1A A;  1WGR A;  3EGR A;  1C4C A;  5BYS A;  3VUX A;  1XLN A;  4KZC A;  3A9K B;  4AJW A;  1RAX A;  1SE9 A;  2WXH A;  1JQ4 A;  2D07 B;  5EDS A;  2KX0 A;  4P7I A;  2DYO A;  2M8S A;  1TKE A;  4PK1 A;  1RFK A;  4W9K A;  1FRD A;  2C9W B;  2FE8 A;  4B6W A;  2Z0E B;  3OJ3 A;  1E7V A;  1ZOY B;  1WI0 A;  4OVZ A;  4L1B A;  2NS5 A;  1WSP A;  3GB1 A;  2IGD A;  1GC7 A;  3B08 A;  1HQR D;  2HTH A;  2IGG A;  1I4G A;  4GW2 A;  1VZ7 A;  2A5U A;  2KAC A;  2GBM A;  3V61 A;  1ISN A;  3Q8E A;  3PZD A;  2KFK B;  2BS4 B;  4OZB A;  1JRU A;  4NAM A;  2ZW0 A;  2J0J A;  1WH3 A;  2KX3 A;  5BYR A;  3DVG Y;  1YN3 A;  4BFR A;  1JWA D;  2L76 A;  2KDB A;  2Y5C A;  3ZJU A;  3DQV A;  2KJH B;  4TKN A;  3QX1 A;  1QOG A;  1YMH E;  1SBB B;  3MFG A;  1VA6 A;  2BTE A;  4WUR A;  4HPM B;  2YVC A;  3I5J C;  1ET6 A;  3J9C A;  2C7N B;  2Z0D B;  2ZCC A;  1SF0 A;  4GB9 A;  4K1R B;  3V6C B;  3L13 A;  2R61 A;  5C23 A;  1WZ0 A;  5KHO A;  1WM3 A;  4D2K A;  1WJ6 A;  4C7Y A;  2KAJ A;  3JPZ A;  2TSS A;  3V3X A;  4DHZ E;  2K1F A;  1YQB A;  2RGF A;  1JRO A;  3ZVV A;  5LNK 1;  4FXC A;  2KFK A;  2FID A;  2GWD A;  3AEC B;  2RSU A;  5IA7 A;  1CJE A;  1V6E A;  5HG2 A;  2R2O A;  4WAA A;  2KAN A;  3M62 B;  1WXS A;  2EMT A;  4YTN B;  2KJR A;  1K8R B;  2H89 B;  3DPD A;  3AEB B;  1BML C;  2WXR A;  4USA A;  1E8Y A;  4KGR A;  4ZHP A;  4F1S A;  2L52 A; 
#chains in the Genus database with same CATH homology
 2D3A A;  2GLS A;  4S17 A;  1HTQ A;  4AM1 A;  1RL9 A;  3ZXV A;  4Z9M A;  2UU7 A;  3DRE A;  3L2E B;  3FKY A;  3NG0 A;  4BHL A;  4LNF A;  1SD0 A;  4Q2R A;  3JQ3 A;  3L2D A;  2BVC A;  4XYC A;  2J1Q A;  1M15 A;  2D3C A;  1CRK A;  4RF6 A;  2LGS A;  2OJW A;  4GW2 A;  1BG0 A;  1HTO A;  2QC8 A;  1QK1 A;  2WGS A;  3DRB A;  3L2E A;  2WHI A;  4GVZ A;  1G0W A;  3JPZ A;  3JU5 A;  4GVY A;  4RF7 A;  1F1H A;  4BAX A;  4HPP A;  5J9A A;  4RF9 A;  1VRP A;  4ACF A;  3JU6 A;  1P50 A;  5J99 A;  4BG4 B;  1I0E A;  1QH4 A;  3ZXR A;  4LNN A;  1U6R A;  4GW0 A;  1P52 A;  4LNK A;  2CRK A;  4S0R A;  3B6R A;  1LGR A;  4BG4 A;  1F52 A;  3M10 A;  4RF8 A;  2D3B A;  1FPY A;  4LNI A;  4LNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...