3ZXRA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxrA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxrA02
4LNKA 3L2EA 4ACFA 2BVCA 4BG4B 4LNIA 4GVZA 3B6RA 1HTOA 2D3BA 1SD0A 4RF6A 4RF7A 2D3AA 4GVYA 4HPPA 3JQ3A 4XYCA 1I0EA 4BG4A 2GLSA 1F1HA 2WHIA 4GW2A 1HTQA 1G0WA 1P52A 2UU7A 4LNFA 5J99A 5J9AA 4S0RA 1QH4A 3M10A 3JPZA 3DREA 4RF9A 2CRKA 1RL9A 1M15A 2QC8A 4BAXA 1P50A 1FPYA 1BG0A 4LNOA 1LGRA 1VRPA 2J1QA 1CRKA 4AM1A 3DRBA 4BHLA 3JU6A 3L2DA 3L2EB 1U6RA 2D3CA 1F52A 2WGSA 4S17A 4LNNA 3ZXVA 4GW0A 4Q2RA 4RF8A 4Z9MA 2LGSA 3JU5A 1QK1A 3ZXRA 3FKYA 3NG0A 2OJWA
chains in the Genus database with same CATH superfamily
4KSKC 1RAXA 2AQ2B 3B6RA 4AJYB 4BKSD 2D3AA 3EGRA 2FE8A 2JZZA 4B95A 1WJNA 3U8ZA 4AUQC 2RPVA 3RD2A 4EFOA 4DXFA 5BYQA 1WR1A 3AE4B 2IPKD 4K7WA 4W9HA 5J9AA 1NBFC 3JPZA 2IGGA 2ZJDA 1EWYC 2Y3AA 3ZUNA 1XD3B 1YOVB 2BYVE 4HKZE 2INCC 2D33A 1OEYA 2B76B 3A4SC 3M95A 4YSZB 2BT6A 2IDYA 3L2EA 5KHOA 2MJEA 1H8CA 3WAOA 1TYGB 3O65B 1QH4A 1F77A 1DOYA 2KJRA 1I7HA 1DGJA 1WXAA 1YJIA 1BUIC 4FLHA 2KD0A 4ZRKA 3KH0A 4M02A 1SBBB 4NQLB 2KN4A 5EE9A 3VRAB 1JRUA 4MM3B 3RNAC 1SGHA 2ACZB 3QQ8B 4JLCA 3PLVA 4HRSA 4P1BC 3NZTA 3WIMA 1TIFA 2QC8A 5LXIB 3LVVA 2PKOA 1T0SC 1D5ZC 3V6CB 4WWMA 3R3MA 2N9XA 2BWFA 2KFJA 3LDZE 1KLVA 2FNJB 4I6PA 1GAQB 1AARA 1E8WA 2L8JA 3ZVVA 3ZJVA 4ZYSA 2JPHA 3B08A 2JUOA 3SEBA 3W5UB 3MFGA 2IO1B 2ZW1A 3CWIA 3ZNHB 5FR6A 1XQQA 1SE2A 5AUKA 1D5XC 1ZUD2 1LO5D 4WJQA 2BPSA 4CYEA 4BKGA 3H9DA 3HVDA 1TTNA 1GB1A 4M8MA 3NHEB 1LXDA 2KDBA 1P1AA 2NBWB 3M10A 4NAMA 1N6ZA 4A3OA 3NY5A 5JHAA 3HVZA 3ZLZA 1JWSD 1E7VA 2KQSA 3EECA 2K0PA 1QK1A 2G4SA 2W54A 2AX5A 1QLBB 2N9EB 3EA6A 2LXCA 5EDSA 1TT4A 1R7SA 2J0JA 4JPSA 5G2NA 4KIKB 3Q3MC 3HIZA 3UINB 2GBNA 3MC0B 2FCMA 5FK9C 1D6EC 2L0TA 3AE7B 4BBNC 2OJWA 5CTRC 3RULA 1SJHD 4M01A 4K3CA 2ON8A 3OJ4B 3BYYB 5EE1A 1WXVA 1HTQA 3X0WA 1QQRA 2WXPA 1YNTE 2C7NB 2AL6A 2JU6X 1XXGA 2V3NA 1L0YB 1QF6A 2PW9A 4ZRJA 3V6EB 1V1PB 3RNBC 2W82A 2O6VA 3V62A 4K7SA 2M0AA 2AYOB 5DPRA 4AOFA 4K1RB 2KN5A 4RF7A 2MBQA 1WGGA 3BVMA 3N20C 2ONQA 1G0WA 1E6EB 2MBOA 3VAWA 2NBUA 3FILB 3NVYA 2QEJC 4RM8A 3BWUD 5IA7A 2WXRA 3PO0A 1FD6A 2HD5B 2FUHB 2W3RA 3IBEA 3AECB 2AQ1B 4FA6A 1VCBA 1IGCA 3N30A 4F8CB 1V1PA 2QCZA 2JYEA 5FKAC 5D3DA 3GB1A 4XDCA 1E5WA 2C9WB 2WXNA 2XK5B 2WNMA 3A9KA 3HRDD 1JW9D 2L3ZA 2IJ0A 1R4MI 3FILA 1T0RC 1G6JA 3QIJA 2BF8B 1N60A 1T0QC 4YSYB 1ZPSA 3A33B 2QILA 4GU2A 1UNSA 1NYQA 1PQSA 2KQ4X 2L0FA 2XK5A 1IP9A 2WXLA 2M56B 3AXCA 3DBRI 3JU6A 2L1AA 3QAQA 3ECIA 1XF5L 2KTRA 1M94A 5LNK1 4IM0A 1FRDA 3MJ5A 4C4VA 2JZPA 4DHJB 2IO3B 2WXIA 4N6EB 1E7UA 1ZE3D 4A20A 2L83A 3OJ3A 2K3UA 3JU5A 1KJTA 4KDIC 2JVCA 4PYZA 2YEPF 1D5MC 2D3BA 1P7EA 3TSSA 2ZNVB 2NMQA 4J6IA 4ZYNA 2INDC 3AE5B 2KWCA 2PMVA 2INPE 1V97A 5DPWA 1H4RA 2ICIA 1FM0D 3AN1A 3SFEB 1FXAA 2JX5A 3GE3C 2BYTA 4N58A 5FR3A 1YN3A 2VZKB 4KKJA 1ZGUB 4LLGM 4PS7A 4TV3A 4NY0A 5BMHA 3ZNGC 1JWMD 3C0RB 4Q2JA 3VUYA 1P3QU 4K3BA 1TZ1A 2WS3B 2EKIA 2N0SB 3IAM1 1UWMA 4EZJA 3IG5A 4US9A 1HE8A 5EE0A 5AZHA 2NTTA 3A9JA 3JSVA 3ZO5B 3V05A 4F7ZA 2FCQA 2HJ8A 3AU4A 1UGMA 5JH5C 2WXKA 2LRWA 4IW0A 1OQRA 2OHFA 1WJUA 1J7CA 1K52A 4RF8A 1K53A 2A5UA 2IY1B 2IGDA 1M4VA 2I2YA 1LFDA 4KGRA 3FAHA 4L23A 4XYCA 1FXIA 1MJDA 2KVRA 2LVPA 1TY0A 4LNOA 1PYWD 4CHKA 4ITKA 4EE2A 4PS3A 1HQRD 1SF0A 5D94A 4HDOA 2GBKA 1DOXA 3GE8C 4HROA 1PGXA 2KFKA 2KACA 3KYCD 4GW2A 3IAS1 2XN9C 1NDDA 5HFYA 3WALA 4TQ0A 1SE4A 2KWUB 3Q3OC 1DYQA 4MGYE 2LGYA 5CHFA 3SR6A 4W9EA 3PVLA 3Q8AA 4LCDE 3VQIA 2L00B 1WJ6A 2DZKA 2KJHB 3EHVA 3V3XA 3N1ZC 4KV2A 1C78A 3U52E 1V9JA 1ACCA 1PGBA 4LNFA 3T8MA 1J7AA 4P7IA 4MT5A 4JWSC 3PRZA 2KLGA 2KZRA 2BS2B 2L32A 1IYFA 2MHJA 2ZZPB 2FIFA 4MGZE 4M0WB 2MH7A 2FCSA 4W9IA 2Y5CA 5G5GA 1B1ZA 1VDVA 2NTSA 3RN9C 5JZEB 1FO4A 1GPXA 2L76A 1QOAA 2N1VA 4HJKA 1NENB 4IWQA 2KOXA 2K8BA 3KW5B 1MHHE 4EKUA 2MLBA 2J52A 1Q5WB 2FBWB 2J7QB 4RF6A 1OEYJ 2JSVX 3TEWA 4WJOA 5HI1A 2DAFA 2L7RA 4RNAA 1WX7A 4M0WA 1A5RA 3W1SC 3KQ4A 4KZCA 1VRPA 3L0WB 3TUOA 2BKFA 1RWSA 3AE9B 3P4PB 4RF9A 4H2AA 1V5TA 4MSMB 3RNEC 5IOIA 3B9JA 4TUUA 4NNJB 4PS8A 1YQ4B 2WXQA 3W5VB 2VZKD 2BB6A 4KX6B 3EFCA 4W9JA 2DNFA 3TL5A 1WMHB 4GIVA 2DYMA 4W9DA 4B0EA 2UWQA 2JF5A 3ZQ4A 1Q1OA 4DDID 4B0MA 2WXHA 1E0ZA 2BVCA 1OGWA 3B2FA 3KUCB 2LRUA 3Q2AC 4LDTD 1TY2A 4JL9A 1E8ZA 1XLNA 4L1BA 5BYRA 3L2EB 3I5JC 4ZRQA 4GDKA 4EUTA 1HA5A 3HK0A 2KDIA 1JALA 3U7DA 2LGDA 1WZ3A 2G1EA 3Q8EA 3AULA 4RGTA 1IUEA 3SD5A 3LN6A 1K50A 3AE2B 2ZPNA 4F1SA 2ZVNA 1EUVB 1Z2MA 1VZ6A 1GC6A 1L2NA 1XCTL 1L6UA 3R7RA 2N1WA 2LI5A 1P98A 2NCNA 2V3SA 4YSXB 2LGIA 2JYTA 3DDCB 2GI9A 1HTOA 4LJPB 2KMCA 1FIQA 4RM9A 2NR2A 2CU1A 2V3PA 3OG5A 2NS5A 2JWZA 3P4QB 3QCAA 3ALBA 5E6NA 1QT9A 1RL9A 2CHWA 1FEHA 1ZDVA 3KWVA 2X8XX 1VRAB 4JX1C 1NYRA 2IO2B 2VH1A 3TEYA 5G55A 4MGIE 5JHBA 4BFRA 3NOBA 1IPGA 4X57B 2PIAA 2EKEC 4GSWA 1B9RA 3L17A 2DZIA 2WQYB 3L16A 1TJEA 3ZJUA 1WGRA 2KT7A 2DZMA 4DWFA 3QJZA 3WA0A 2PE9A 3RZFA 4YXDB 2Y5PA 2BS3B 3DHGC 5G5HA 2J0MA 4FJYA 3T3OA 4FJZA 5IP4D 4HCNB 4WQOB 1I35A 3MHZA 2LVQA 2ZCBA 2BYEA 3APCA 1JRPA 1ZDXA 4G50A 3RCZA 2ZCCA 3VR8B 1VZ7A 2WHIA 3H1UA 3VDZA 4LJOB 4ANUA 4RFBA 3AB5A 3QC8B 3Q3NC 2BW2A 1CK1A 4ARCA 4GGQA 1K8RB 3SHQA 4W9CA 4ZOHC 1WWTA 1L5PA 1FNUA 4GW0A 3ZGZA 1V86A 1VZ8A 5BYSA 4EZLA 3NVVA 3VR9B 3KVFB 1NEKB 1N5XA 3K9PB 3NJTA 1EU4A 2C5LC 3TJPA 3X23A 2TSSA 2LD9A 1M15A 2K8CA 2O6VB 2VRRB 1CRKA 1WX8A 1V6EA 4NAWA 3N3KB 4FULA 1FRRA 2K6DB 2NVUI 3AE6B 2Z8LA 1PUTA 3MJWA 3IT6B 2HE7A 2WXJA 2RDGA 4JQWC 3P4RB 1WE6A 3TMPB 5IKCM 4FBJB 1D3ZA 4P1CC 1MPEA 2MQJA 1QILA 3VH4B 3AE1B 4W9GA 3M62B 3A9KB 3ETRA 3PRPB 5IAAC 4ANXA 1SXTA 2WX1A 2MRPA 1WY8A 2K8HA 4ZHPA 3I3TB 4GB9A 1OTRB 3RUIB 3DWGC 3U7ZA 5HKHA 3NZ3A 1JQ4A 3BK2A 2J0KA 4KSLC 2CS4A 1I4GA 2LWPA 2AQ3B 2GBJA 1YN5A 1J0GA 2K39A 3ML8A 4XDDA 2PLPA 2C60A 2WYQA 3NUHB 1ZXIA 5D3IB 2H88B 2DX5B 2KTRB 2J53A 4LNNA 2FCNA 4ACFA 3ZRFA 4GVZA 2CJNA 4HKQA 3AH7A 1WRIA 4GMVA 4C4VB 3C8YA 2JY6A 1N61A 2RD0A 2LFIA 3L54A 3HM3A 1DOIA 1GOZA 4PT5A 1A70A 3R66C 1MFWA 2OOBB 3H6NA 3VUWA 1FPYA 2N7DA 2MJ3A 1KF6B 2HJ1A 4AJWA 1U4AA 2Z0EB 1QOGA 2Q5WD 3Q8BA 4A6QA 1KRHA 3ENEA 4RF0A 3VTVA 2QHOA 3P2BA 4HPMB 1I4HA 5DCNA 1E8YA 3N32A 4RGOS 4DQOC 5IN7A 4HCPB 2K6QA 2KWDA 1WXQA 4MSQB 4BKTA 4BVUC 2KK8A 2C7MB 5KHQA 3HHMA 1TKYA 2K22A 4JGHB 2LXAA 4MEMA 3ZNZB 3FKYA 2PPHA 1ESFA 1ZW7A 3P1MA 1KM7A 1VLBA 3RYTA 1JWAD 3AM9A 3ZKJC 2QDFA 1PGAA 3LJ3A 4RGMA 5L83A 1QOBA 2WX0A 2H89B 1XT9B 2EMSA 5C3JB 4ANVA 1TKEA 3VXWA 2C7HA 2D2QA 4EZKA 1TBEA 2NPTB 1I4PA 1Z5SB 3A9JB 3JSVB 1IBXA 2JQRB 1R4MB 1WE7A 2KNBA 4GLSC 2GLSA 3EUB2 3ZDMC 4WWPA 3ABVB 2KVZA 1T0YA 2G9HD 1C79A 3DVNU 3GS2A 3VVWB 1SE3A 3R2TA 1P50A 2CKHB 2O6VD 3ML9A 3Q3FA 2AEHA 2L05A 2DBYA 3DBRB 2NPTA 3RI7C 2M0XA 1JMLA 1IGDA 2REXA 3ZTCA 1Y56A 3PLUA 4NJ6A 2D3GA 4IOIE 5H92C 2LEKA 2I38A 2KFKB 3AEGB 4HJGE 3Q69A 4WWOA 2QIEB 4LNIA 2AL3A 2DWQA 4AP4C 3RFZB 1J8CA 1FFUA 1VD2A 5DPSA 4EEWA 3VRBB 1YJ1A 3I9V1 1WIAA 2X38A 3E9SA 2KO3A 1C3TA 3T3NA 1OQQA 5HHDG 2PVGC 3SDLC 1WXMA 1XCQL 3W1SA 4YTNB 4MELA 2MBHA 1T3QA 2CU3A 3IVFA 1LQBA 1ET9A 4C80A 1MHXA 3GZNI 3V61A 4ZDVA 3RNGC 1YMHE 4L2YA 1R8GA 5J18A 3DREA 1NVID 3SFDB 3N1XC 1V80A 4Z9MA 4OVZA 3WANA 4OW0A 3W1YA 1UBIA 4WJPA 2HTME 5E6PA 3QHTA 2WLBA 3Q14C 1FXTB 3S2AA 4BKSA 4N9F4 3KWLA 3EC8A 1XO3A 3IFWB 4DDGD 1L6VA 1V5OA 1WGDA 1GJZA 3AEFB 4NQKE 2G3QB 2PTLA 2JWUA 4HLEA 2KJ6A 1J7BA 3R8BA 3QK0A 3Q6BA 2CR5A 4GDLA 4KKIA 4FADA 4FXCA 3H7PA 2Z59B 4MGKE 1E9MA 4HXDA 1BXTA 4TMAB 3NS1A 1SD0A 3CSTA 3R7QA 3DVNV 2WXGA 1V49A 2RR9A 2N4FA 3RNCC 2D11A 2ZVOA 4DHZE 1JWUD 3QA8A 2M1MA 2MA9B 1HZ6A 3C19A 3KYDD 1WYWB 4KDLB 4DHJD 1I4QA 3UF8A 4DXAB 4KVGB 1WM2A 4REZA 3ZRCA 2PJHA 2WDTB 2IGHA 4I6NB 1L0VB 2MSED 1SIFA 4E71A 1V1OA 3JVZX 4W9LA 3U2SC 3PHXB 2FUG1 3DBHI 4WQMA 3APFA 4LTUA 1SEBD 5GMVA 2UYZB 1Y8RC 4MJSA 4XWTA 4KGSA 4PK1A 2MW5A 2J42A 4GOCA 1BT0A 3J9CA 3QWZB 2D3CA 3PGEA 4Q2RA 2KTFA 4N59A 5AZFA 3CF6E 3CMMB 4YWGG 4GN1A 1WYGA 2N7JA 2GRIA 4KZ0A 3A1QA 3RPFC 3JQ3A 3U4EG 4BZAA 1I42A 2RDHA 4K81A 3BIID 5C1ZA 2R61A 3RMKC 3T9LA 2YLMA 1AYFA 4GDKB 2GB1A 4FN2A 4C56C 1TT5B 2GBRA 1WRDB 2CHXA 2B3AA 3DPDA 1WR6E 5AZGA 2XNAC 3AU5A 4IM2A 3TEXA 2SEBD 4NJ7A 2DAJA 1CZPA 2JXTA 1ZXHA 2DZJA 3DQVA 3OWEB 4DK5A 4J3OD 1GB4A 1T6BX 4IWPA 4RGNA 1S1QB 2L52A 2YVCA 3AMZA 3FC4A 4WAFA 4GXBA 1JROA 4IWOA 3DBHB 2I1KA 2HTHA 1SJED 1MG4A 1VR9A 2W55A 1JWBD 1F52A 1GG3A 4WIPA 5TSSA 4ARIA 1SIJA 3MC9A 1UF0A 2D32A 4II3B 2KHWB 1XEEA 4G0NB 3NS8A 4PYUA 4R3DA 4RF1A 2EELA 1P0RA 3KLSX 4OVVA 2KMAA 1RM6C 4HPLB 4RCOA 3DBLI 3MHSD 4CO7A 4OZAA 3PV1A 3DVGY 1VJKA 4MH8A 2LASA 2BB5A 1R4NI 3AE8B 2Z0DB 4USAA 4GVYA 1F1HA 2W3SA 1WJ4A 2LJIA 2KC1A 4AS1A 2ASQA 2M4NA 2ZPYA 2GWCA 3MTNB 3ZJTA 3KUZA 1FFVA 1U6RA 3PS6A 4W9FA 1UZXB 5BO4B 2BGFA 2OJRA 3GP7A 1WSPA 3NZUA 5MPOA 4IM3A 1YD8U 1ENFA 4RMAA 1UGJA 3B2GA 4OHJA 4XGAB 1SSNA 4HEA1 2VH2A 3RNFC 4DHZB 2QMTA 4JWUC 1RFKA 2KLCA 2J4XA 4HDQA 2IO0B 5H8YE 3H8HA 2LHDA 1MVKA 4EOYA 3L10B 2GWDA 1S3SG 3ZXRA 2MX2A 2KQ7A 3M63B 3APDA 2YEPB 3TCAA 5LLIA 1QZEA 4OZBA 1N5WA 1L4DB 3Q8CA 4OVUA 1UBQA 1C4CA 4MM3A 1WGHA 4C00A 3K9OB 1F2RC 2O2VB 4NAWB 1MG8A 4B6WA 3QARA 2RMMA 3DWMA 3WAPA 2MEKA 5HG2A 1MI0A 3P4SB 4E74A 1YX5B 3UI3A 4JIOU 3NG0A 4LNKA 3O13A 2KAJA 3DBLB 1SB3C 4O1NA 1EF5A 5CX3A 3P42A 4URKA 1YX6B 2MJDA 1P9DU 4IC7B 2V4IB 1R4NB 4AQ7A 2BQQA 1TS2A 2JZ3B 3WCQA 1AW7A 1C4AA 4ASWC 3H7SA 1D4BA 2V0GA 3W9CB 2O2VA 2RDBC 1T5XD 5AUIA 3LN7A 2AWTA 2MBEA 4CQNA 4NPNA 2WWZA 5T8IA 3BY4B 1KH0A 5CHWA 1ROEA 4A90A 3LB8C 1P52A 3JW0X 1UD7A 1QOFA 1Q0WB 4IKGA 3U30A 3PZ7A 2EMTA 4MH0E 4XWWA 3DHIC 4K7UA 2MP2B 4ZHOA 2QJLA 4A55A 1OQYA 1I4RA 1V4GA 2KMMA 4WURA 3UIPB 3TBLD 1RYJA 1STEA 4XC2A 4JE3B 4BOZB 2CJOA 4YT0B 1WGYA 3WAMA 3VH3B 1VA6A 1FCCC 3UIOB 2DLBA 4FHKA 4ICUA 1BG0A 2K25A 2BKRB 4KIKA 3RZWC 1RLFA 4DBGA 2J1QA 3L2DA 1HEZE 1P7FA 2BWES 2INNE 3IHPC 3TEZA 2XEWA 2IBIB 3A4RA 3BVGA 3BYTB 4IDIA 1C4PA 4LK0M 2MP2A 2D5GA 3VUXA 3DVGX 4YTMB 3PSEB 1YJJA 2JRIB 3DBSA 4C7YA 2IY0B 2GOWA 1L0XB 2MCNB 4ZRPA 3PTFC 3N1YC 1E7PB 2LMCA 4MACA 3VTWA 5J17A 4BBNF 3HUIA 3URYA 2WU5B 4TKNA 2R2QA 3ZNID 2BBCA 1UH6A 4RH6A 1XLPA 1WFYA 2BTEA 1TKGA 1KLGD 3NZSA 1GC7A 3L08A 2WXFA 2K9XA 4A8XC 2RGFA 3IG3A 1NI3A 4P6VF 3B0AA 4HVBA 2WP9B 1XLQA 3RT3B 4BG4B 1KLUD 4WH4A 4W9KA 2HDEA 5GXGB 5BMIA 3AEDB 3I63C 2UU7A 2IZVB 4II2B 3BK1A 1EF1A 1LM8B 4UDUC 2K1FA 1EO6A 1K51A 4BHLA 3DRBA 2KANA 4B9KA 3AV8A 1IBXB 2LGSA 2RPQA 2M19A 2WDVB 1X1MA 4C7ZA 1CQVA 2A4ZA 1XLOA 4MDKE 4BG4A 3CIRB 5I4DA 2KDFB 1V2YA 3NVWA 3PT2B 1AN8A 2GMIC 1TS4A 3AEEB 1C9FA 1C77A 2KDMA 1TS3A 5E6OA 4US8A 4G11A 4ICVA 2KYWA 5D2MB 4FJVB 4IG7B 4WWNA 1GNUA 3BZDB 1NI2A 5C2TB 3DHHC 1WZ0A 3OAWA 2PVOD 1JCKB 5TR5A 5EE3A 1V8CA 3R2IA 2KWVB 3AE3B 3W2DA 5JXVA 1LGRA 2WU2B 2V1YA 4M8NA 4AM1A 4KGTA 4IUMB 1YIWA 4G3XB 2I1JA 2ZEQA 1WI0A 2CHZA 2KC2A 3LYYA 2WDRB 3M3JA 3HM6X 3Q3JA 2MBBB 2W9NA 2OEDA 1L4ZB 3P63A 3ZYYX 2KXJA 3NVZA 2FIDA 1PDXA 1L7YA 1ZKHA 4BAXA 1E10A 4DXGA 4XE0A 1YQBA 2N9KA 1TS5A 2JRHA 4LDTB 2LUEA 2E6XA 2E3TA 2JT4B 4WAAA 3DOWA 4TQ1A 1KOTA 3L13A 1HXYD 2BS4B 2G4DB 1ZOYB 2DENB 3AEAB 2N9PC 4XZ4A 2GBMA 5CHVC 2PEAA 2D07B 1AWDA 3EFUA 1I0EA 1FNWA 4ANWA 2DHZA 4AWJA 3LXFA 1CJEA 2N7EA 3LVWA 4BOSC 3ZIMA 1FNVA 4TSSA 2XBBC 1C1YB 3GOEA 2KX3A 4GDLB 2LJ5A 3UGBB 3H7PB 3QX1A 3TIXA 2N9LA 3L4PA 5E6JA 3IT4B 4OZCA 1WF9A 3D32A 4HPPA 3MC8A 5D7GA 3VHTC 3N9YC 2LUMA 3V60A 4I6LB 2CRKA 3UQAA 3UQBA 3IG8A 1UELA 3BINA 4M00A 3ZXVA 1E8XA 2V4LA 3MP9A 2ZNVC 2LGXA 2MWSB 1YQ3B 3ZDTA 3B1LX 5C23A 4MJSB 1KFYB 2KDEB 1J19A 3SU8X 1F2RI 2V9HA 5BMGA 2KX0A 3ONSA 4S0RA 1FMAD 3ZTDA 4HWIB 3VTUA 2LZ6A 2LHEA 2G45B 3A1QB 1ET6A 4NJCA 3PRMB 2RSUA 1WH3A 2DYBA 1PFDA 2WXOA 3CSFA 3VFKA 3AI5A 1N62A 4YL8A 1WXSA 1V81A 3AEBB 1BMLC 1UWXA 1HZ5A 4NZLB 4QAYA 3PZDA 1EM7A 1WX9A 4ZRIA 3GZNB 2BYFA 2PE6B 1F9JA 5AEKB 1I4XA 1N63A 1ISNA 1UUPA 2ZW0A 3JYUA 1CMXB 4XX5A 2K5PA 5DPTA 1WGKA 5IO9A 2Y5BB 2LVOA 1EWCA 1TGZB 4FHJA 2JXXA 4YTPB 2DYOA 4HK2A 1SE9A 2FAZA 1RRBA 3DCGA 5L95C 1WM3A 1KTKA 2NBVB 3PZ8A 4D2KA 2QSDA 3PREA 2WXMA 4P16A 3PHWB 2R2OA 2WDQB 3Q8FA 5LXHA 1OFFA 3IXSA 3E56A 4S17A 5J2RA 4WJNA 3NRZA 3PPAA 2IYDB 4A9AA 2M17A 1FCLA 2D10A 4E3CA 1C76A 2KKCA 1F0ZA 1Q10A 1YN4A 3KUDB 5D6JB 3ZW3A 5J99A 1QKZA 3I57A 3OLMD 1GUAB 2M8SA 1WMHA 3BVZA 1EU3A 1RFAA 2SAKA 1TZOA 2WGSA 1ZP0B 4A3PA 1E90A
chains in the Genus database with same CATH topology
4LNKA 3L2EA 4ACFA 2BVCA 4BG4B 4LNIA 4GVZA 3B6RA 1HTOA 2D3BA 1SD0A 4RF6A 4RF7A 2D3AA 4GVYA 4HPPA 3JQ3A 4XYCA 1I0EA 4BG4A 2GLSA 1F1HA 2WHIA 4GW2A 1HTQA 1G0WA 1P52A 2UU7A 4LNFA 5J99A 5J9AA 4S0RA 1QH4A 3M10A 3JPZA 3DREA 4RF9A 2CRKA 1RL9A 1M15A 2QC8A 4BAXA 1P50A 1FPYA 1BG0A 4LNOA 1LGRA 1VRPA 2J1QA 1CRKA 4AM1A 3DRBA 4BHLA 3JU6A 3L2DA 3L2EB 1U6RA 2D3CA 1F52A 2WGSA 4S17A 4LNNA 3ZXVA 4GW0A 4Q2RA 4RF8A 4Z9MA 2LGSA 3JU5A 1QK1A 3ZXRA 3FKYA 3NG0A 2OJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNK A;  3L2E A;  4ACF A;  2BVC A;  4BG4 B;  4LNI A;  4GVZ A;  3B6R A;  1HTO A;  2D3B A;  1SD0 A;  4RF6 A;  4RF7 A;  2D3A A;  4GVY A;  4HPP A;  3JQ3 A;  4XYC A;  1I0E A;  4BG4 A;  2GLS A;  1F1H A;  2WHI A;  4GW2 A;  1HTQ A;  1G0W A;  1P52 A;  2UU7 A;  4LNF A;  5J99 A;  5J9A A;  4S0R A;  1QH4 A;  3M10 A;  3JPZ A;  3DRE A;  4RF9 A;  2CRK A;  1RL9 A;  1M15 A;  2QC8 A;  4BAX A;  1P50 A;  1FPY A;  1BG0 A;  4LNO A;  1LGR A;  1VRP A;  2J1Q A;  1CRK A;  4AM1 A;  3DRB A;  4BHL A;  3JU6 A;  3L2D A;  3L2E B;  1U6R A;  2D3C A;  1F52 A;  2WGS A;  4S17 A;  4LNN A;  3ZXV A;  4GW0 A;  4Q2R A;  4RF8 A;  4Z9M A;  2LGS A;  3JU5 A;  1QK1 A;  3ZXR A;  3FKY A;  3NG0 A;  2OJW A; 
#chains in the Genus database with same CATH topology
 4KSK C;  1RAX A;  2AQ2 B;  3B6R A;  4AJY B;  4BKS D;  2D3A A;  3EGR A;  2FE8 A;  2JZZ A;  4B95 A;  1WJN A;  3U8Z A;  4AUQ C;  2RPV A;  3RD2 A;  4EFO A;  4DXF A;  5BYQ A;  1WR1 A;  3AE4 B;  2IPK D;  4K7W A;  4W9H A;  5J9A A;  1NBF C;  3JPZ A;  2IGG A;  2ZJD A;  1EWY C;  2Y3A A;  3ZUN A;  1XD3 B;  1YOV B;  2BYV E;  4HKZ E;  2INC C;  2D33 A;  1OEY A;  2B76 B;  3A4S C;  3M95 A;  4YSZ B;  2BT6 A;  2IDY A;  3L2E A;  5KHO A;  2MJE A;  1H8C A;  3WAO A;  1TYG B;  3O65 B;  1QH4 A;  1F77 A;  1DOY A;  2KJR A;  1I7H A;  1DGJ A;  1WXA A;  1YJI A;  1BUI C;  4FLH A;  2KD0 A;  4ZRK A;  3KH0 A;  4M02 A;  1SBB B;  4NQL B;  2KN4 A;  5EE9 A;  3VRA B;  1JRU A;  4MM3 B;  3RNA C;  1SGH A;  2ACZ B;  3QQ8 B;  4JLC A;  3PLV A;  4HRS A;  4P1B C;  3NZT A;  3WIM A;  1TIF A;  2QC8 A;  5LXI B;  3LVV A;  2PKO A;  1T0S C;  1D5Z C;  3V6C B;  4WWM A;  3R3M A;  2N9X A;  2BWF A;  2KFJ A;  3LDZ E;  1KLV A;  2FNJ B;  4I6P A;  1GAQ B;  1AAR A;  1E8W A;  2L8J A;  3ZVV A;  3ZJV A;  4ZYS A;  2JPH A;  3B08 A;  2JUO A;  3SEB A;  3W5U B;  3MFG A;  2IO1 B;  2ZW1 A;  3CWI A;  3ZNH B;  5FR6 A;  1XQQ A;  1SE2 A;  5AUK A;  1D5X C;  1ZUD 2;  1LO5 D;  4WJQ A;  2BPS A;  4CYE A;  4BKG A;  3H9D A;  3HVD A;  1TTN A;  1GB1 A;  4M8M A;  3NHE B;  1LXD A;  2KDB A;  1P1A A;  2NBW B;  3M10 A;  4NAM A;  1N6Z A;  4A3O A;  3NY5 A;  5JHA A;  3HVZ A;  3ZLZ A;  1JWS D;  1E7V A;  2KQS A;  3EEC A;  2K0P A;  1QK1 A;  2G4S A;  2W54 A;  2AX5 A;  1QLB B;  2N9E B;  3EA6 A;  2LXC A;  5EDS A;  1TT4 A;  1R7S A;  2J0J A;  4JPS A;  5G2N A;  4KIK B;  3Q3M C;  3HIZ A;  3UIN B;  2GBN A;  3MC0 B;  2FCM A;  5FK9 C;  1D6E C;  2L0T A;  3AE7 B;  4BBN C;  2OJW A;  5CTR C;  3RUL A;  1SJH D;  4M01 A;  4K3C A;  2ON8 A;  3OJ4 B;  3BYY B;  5EE1 A;  1WXV A;  1HTQ A;  3X0W A;  1QQR A;  2WXP A;  1YNT E;  2C7N B;  2AL6 A;  2JU6 X;  1XXG A;  2V3N A;  1L0Y B;  1QF6 A;  2PW9 A;  4ZRJ A;  3V6E B;  1V1P B;  3RNB C;  2W82 A;  2O6V A;  3V62 A;  4K7S A;  2M0A A;  2AYO B;  5DPR A;  4AOF A;  4K1R B;  2KN5 A;  4RF7 A;  2MBQ A;  1WGG A;  3BVM A;  3N20 C;  2ONQ A;  1G0W A;  1E6E B;  2MBO A;  3VAW A;  2NBU A;  3FIL B;  3NVY A;  2QEJ C;  4RM8 A;  3BWU D;  5IA7 A;  2WXR A;  3PO0 A;  1FD6 A;  2HD5 B;  2FUH B;  2W3R A;  3IBE A;  3AEC B;  2AQ1 B;  4FA6 A;  1VCB A;  1IGC A;  3N30 A;  4F8C B;  1V1P A;  2QCZ A;  2JYE A;  5FKA C;  5D3D A;  3GB1 A;  4XDC A;  1E5W A;  2C9W B;  2WXN A;  2XK5 B;  2WNM A;  3A9K A;  3HRD D;  1JW9 D;  2L3Z A;  2IJ0 A;  1R4M I;  3FIL A;  1T0R C;  1G6J A;  3QIJ A;  2BF8 B;  1N60 A;  1T0Q C;  4YSY B;  1ZPS A;  3A33 B;  2QIL A;  4GU2 A;  1UNS A;  1NYQ A;  1PQS A;  2KQ4 X;  2L0F A;  2XK5 A;  1IP9 A;  2WXL A;  2M56 B;  3AXC A;  3DBR I;  3JU6 A;  2L1A A;  3QAQ A;  3ECI A;  1XF5 L;  2KTR A;  1M94 A;  5LNK 1;  4IM0 A;  1FRD A;  3MJ5 A;  4C4V A;  2JZP A;  4DHJ B;  2IO3 B;  2WXI A;  4N6E B;  1E7U A;  1ZE3 D;  4A20 A;  2L83 A;  3OJ3 A;  2K3U A;  3JU5 A;  1KJT A;  4KDI C;  2JVC A;  4PYZ A;  2YEP F;  1D5M C;  2D3B A;  1P7E A;  3TSS A;  2ZNV B;  2NMQ A;  4J6I A;  4ZYN A;  2IND C;  3AE5 B;  2KWC A;  2PMV A;  2INP E;  1V97 A;  5DPW A;  1H4R A;  2ICI A;  1FM0 D;  3AN1 A;  3SFE B;  1FXA A;  2JX5 A;  3GE3 C;  2BYT A;  4N58 A;  5FR3 A;  1YN3 A;  2VZK B;  4KKJ A;  1ZGU B;  4LLG M;  4PS7 A;  4TV3 A;  4NY0 A;  5BMH A;  3ZNG C;  1JWM D;  3C0R B;  4Q2J A;  3VUY A;  1P3Q U;  4K3B A;  1TZ1 A;  2WS3 B;  2EKI A;  2N0S B;  3IAM 1;  1UWM A;  4EZJ A;  3IG5 A;  4US9 A;  1HE8 A;  5EE0 A;  5AZH A;  2NTT A;  3A9J A;  3JSV A;  3ZO5 B;  3V05 A;  4F7Z A;  2FCQ A;  2HJ8 A;  3AU4 A;  1UGM A;  5JH5 C;  2WXK A;  2LRW A;  4IW0 A;  1OQR A;  2OHF A;  1WJU A;  1J7C A;  1K52 A;  4RF8 A;  1K53 A;  2A5U A;  2IY1 B;  2IGD A;  1M4V A;  2I2Y A;  1LFD A;  4KGR A;  3FAH A;  4L23 A;  4XYC A;  1FXI A;  1MJD A;  2KVR A;  2LVP A;  1TY0 A;  4LNO A;  1PYW D;  4CHK A;  4ITK A;  4EE2 A;  4PS3 A;  1HQR D;  1SF0 A;  5D94 A;  4HDO A;  2GBK A;  1DOX A;  3GE8 C;  4HRO A;  1PGX A;  2KFK A;  2KAC A;  3KYC D;  4GW2 A;  3IAS 1;  2XN9 C;  1NDD A;  5HFY A;  3WAL A;  4TQ0 A;  1SE4 A;  2KWU B;  3Q3O C;  1DYQ A;  4MGY E;  2LGY A;  5CHF A;  3SR6 A;  4W9E A;  3PVL A;  3Q8A A;  4LCD E;  3VQI A;  2L00 B;  1WJ6 A;  2DZK A;  2KJH B;  3EHV A;  3V3X A;  3N1Z C;  4KV2 A;  1C78 A;  3U52 E;  1V9J A;  1ACC A;  1PGB A;  4LNF A;  3T8M A;  1J7A A;  4P7I A;  4MT5 A;  4JWS C;  3PRZ A;  2KLG A;  2KZR A;  2BS2 B;  2L32 A;  1IYF A;  2MHJ A;  2ZZP B;  2FIF A;  4MGZ E;  4M0W B;  2MH7 A;  2FCS A;  4W9I A;  2Y5C A;  5G5G A;  1B1Z A;  1VDV A;  2NTS A;  3RN9 C;  5JZE B;  1FO4 A;  1GPX A;  2L76 A;  1QOA A;  2N1V A;  4HJK A;  1NEN B;  4IWQ A;  2KOX A;  2K8B A;  3KW5 B;  1MHH E;  4EKU A;  2MLB A;  2J52 A;  1Q5W B;  2FBW B;  2J7Q B;  4RF6 A;  1OEY J;  2JSV X;  3TEW A;  4WJO A;  5HI1 A;  2DAF A;  2L7R A;  4RNA A;  1WX7 A;  4M0W A;  1A5R A;  3W1S C;  3KQ4 A;  4KZC A;  1VRP A;  3L0W B;  3TUO A;  2BKF A;  1RWS A;  3AE9 B;  3P4P B;  4RF9 A;  4H2A A;  1V5T A;  4MSM B;  3RNE C;  5IOI A;  3B9J A;  4TUU A;  4NNJ B;  4PS8 A;  1YQ4 B;  2WXQ A;  3W5V B;  2VZK D;  2BB6 A;  4KX6 B;  3EFC A;  4W9J A;  2DNF A;  3TL5 A;  1WMH B;  4GIV A;  2DYM A;  4W9D A;  4B0E A;  2UWQ A;  2JF5 A;  3ZQ4 A;  1Q1O A;  4DDI D;  4B0M A;  2WXH A;  1E0Z A;  2BVC A;  1OGW A;  3B2F A;  3KUC B;  2LRU A;  3Q2A C;  4LDT D;  1TY2 A;  4JL9 A;  1E8Z A;  1XLN A;  4L1B A;  5BYR A;  3L2E B;  3I5J C;  4ZRQ A;  4GDK A;  4EUT A;  1HA5 A;  3HK0 A;  2KDI A;  1JAL A;  3U7D A;  2LGD A;  1WZ3 A;  2G1E A;  3Q8E A;  3AUL A;  4RGT A;  1IUE A;  3SD5 A;  3LN6 A;  1K50 A;  3AE2 B;  2ZPN A;  4F1S A;  2ZVN A;  1EUV B;  1Z2M A;  1VZ6 A;  1GC6 A;  1L2N A;  1XCT L;  1L6U A;  3R7R A;  2N1W A;  2LI5 A;  1P98 A;  2NCN A;  2V3S A;  4YSX B;  2LGI A;  2JYT A;  3DDC B;  2GI9 A;  1HTO A;  4LJP B;  2KMC A;  1FIQ A;  4RM9 A;  2NR2 A;  2CU1 A;  2V3P A;  3OG5 A;  2NS5 A;  2JWZ A;  3P4Q B;  3QCA A;  3ALB A;  5E6N A;  1QT9 A;  1RL9 A;  2CHW A;  1FEH A;  1ZDV A;  3KWV A;  2X8X X;  1VRA B;  4JX1 C;  1NYR A;  2IO2 B;  2VH1 A;  3TEY A;  5G55 A;  4MGI E;  5JHB A;  4BFR A;  3NOB A;  1IPG A;  4X57 B;  2PIA A;  2EKE C;  4GSW A;  1B9R A;  3L17 A;  2DZI A;  2WQY B;  3L16 A;  1TJE A;  3ZJU A;  1WGR A;  2KT7 A;  2DZM A;  4DWF A;  3QJZ A;  3WA0 A;  2PE9 A;  3RZF A;  4YXD B;  2Y5P A;  2BS3 B;  3DHG C;  5G5H A;  2J0M A;  4FJY A;  3T3O A;  4FJZ A;  5IP4 D;  4HCN B;  4WQO B;  1I35 A;  3MHZ A;  2LVQ A;  2ZCB A;  2BYE A;  3APC A;  1JRP A;  1ZDX A;  4G50 A;  3RCZ A;  2ZCC A;  3VR8 B;  1VZ7 A;  2WHI A;  3H1U A;  3VDZ A;  4LJO B;  4ANU A;  4RFB A;  3AB5 A;  3QC8 B;  3Q3N C;  2BW2 A;  1CK1 A;  4ARC A;  4GGQ A;  1K8R B;  3SHQ A;  4W9C A;  4ZOH C;  1WWT A;  1L5P A;  1FNU A;  4GW0 A;  3ZGZ A;  1V86 A;  1VZ8 A;  5BYS A;  4EZL A;  3NVV A;  3VR9 B;  3KVF B;  1NEK B;  1N5X A;  3K9P B;  3NJT A;  1EU4 A;  2C5L C;  3TJP A;  3X23 A;  2TSS A;  2LD9 A;  1M15 A;  2K8C A;  2O6V B;  2VRR B;  1CRK A;  1WX8 A;  1V6E A;  4NAW A;  3N3K B;  4FUL A;  1FRR A;  2K6D B;  2NVU I;  3AE6 B;  2Z8L A;  1PUT A;  3MJW A;  3IT6 B;  2HE7 A;  2WXJ A;  2RDG A;  4JQW C;  3P4R B;  1WE6 A;  3TMP B;  5IKC M;  4FBJ B;  1D3Z A;  4P1C C;  1MPE A;  2MQJ A;  1QIL A;  3VH4 B;  3AE1 B;  4W9G A;  3M62 B;  3A9K B;  3ETR A;  3PRP B;  5IAA C;  4ANX A;  1SXT A;  2WX1 A;  2MRP A;  1WY8 A;  2K8H A;  4ZHP A;  3I3T B;  4GB9 A;  1OTR B;  3RUI B;  3DWG C;  3U7Z A;  5HKH A;  3NZ3 A;  1JQ4 A;  3BK2 A;  2J0K A;  4KSL C;  2CS4 A;  1I4G A;  2LWP A;  2AQ3 B;  2GBJ A;  1YN5 A;  1J0G A;  2K39 A;  3ML8 A;  4XDD A;  2PLP A;  2C60 A;  2WYQ A;  3NUH B;  1ZXI A;  5D3I B;  2H88 B;  2DX5 B;  2KTR B;  2J53 A;  4LNN A;  2FCN A;  4ACF A;  3ZRF A;  4GVZ A;  2CJN A;  4HKQ A;  3AH7 A;  1WRI A;  4GMV A;  4C4V B;  3C8Y A;  2JY6 A;  1N61 A;  2RD0 A;  2LFI A;  3L54 A;  3HM3 A;  1DOI A;  1GOZ A;  4PT5 A;  1A70 A;  3R66 C;  1MFW A;  2OOB B;  3H6N A;  3VUW A;  1FPY A;  2N7D A;  2MJ3 A;  1KF6 B;  2HJ1 A;  4AJW A;  1U4A A;  2Z0E B;  1QOG A;  2Q5W D;  3Q8B A;  4A6Q A;  1KRH A;  3ENE A;  4RF0 A;  3VTV A;  2QHO A;  3P2B A;  4HPM B;  1I4H A;  5DCN A;  1E8Y A;  3N32 A;  4RGO S;  4DQO C;  5IN7 A;  4HCP B;  2K6Q A;  2KWD A;  1WXQ A;  4MSQ B;  4BKT A;  4BVU C;  2KK8 A;  2C7M B;  5KHQ A;  3HHM A;  1TKY A;  2K22 A;  4JGH B;  2LXA A;  4MEM A;  3ZNZ B;  3FKY A;  2PPH A;  1ESF A;  1ZW7 A;  3P1M A;  1KM7 A;  1VLB A;  3RYT A;  1JWA D;  3AM9 A;  3ZKJ C;  2QDF A;  1PGA A;  3LJ3 A;  4RGM A;  5L83 A;  1QOB A;  2WX0 A;  2H89 B;  1XT9 B;  2EMS A;  5C3J B;  4ANV A;  1TKE A;  3VXW A;  2C7H A;  2D2Q A;  4EZK A;  1TBE A;  2NPT B;  1I4P A;  1Z5S B;  3A9J B;  3JSV B;  1IBX A;  2JQR B;  1R4M B;  1WE7 A;  2KNB A;  4GLS C;  2GLS A;  3EUB 2;  3ZDM C;  4WWP A;  3ABV B;  2KVZ A;  1T0Y A;  2G9H D;  1C79 A;  3DVN U;  3GS2 A;  3VVW B;  1SE3 A;  3R2T A;  1P50 A;  2CKH B;  2O6V D;  3ML9 A;  3Q3F A;  2AEH A;  2L05 A;  2DBY A;  3DBR B;  2NPT A;  3RI7 C;  2M0X A;  1JML A;  1IGD A;  2REX A;  3ZTC A;  1Y56 A;  3PLU A;  4NJ6 A;  2D3G A;  4IOI E;  5H92 C;  2LEK A;  2I38 A;  2KFK B;  3AEG B;  4HJG E;  3Q69 A;  4WWO A;  2QIE B;  4LNI A;  2AL3 A;  2DWQ A;  4AP4 C;  3RFZ B;  1J8C A;  1FFU A;  1VD2 A;  5DPS A;  4EEW A;  3VRB B;  1YJ1 A;  3I9V 1;  1WIA A;  2X38 A;  3E9S A;  2KO3 A;  1C3T A;  3T3N A;  1OQQ A;  5HHD G;  2PVG C;  3SDL C;  1WXM A;  1XCQ L;  3W1S A;  4YTN B;  4MEL A;  2MBH A;  1T3Q A;  2CU3 A;  3IVF A;  1LQB A;  1ET9 A;  4C80 A;  1MHX A;  3GZN I;  3V61 A;  4ZDV A;  3RNG C;  1YMH E;  4L2Y A;  1R8G A;  5J18 A;  3DRE A;  1NVI D;  3SFD B;  3N1X C;  1V80 A;  4Z9M A;  4OVZ A;  3WAN A;  4OW0 A;  3W1Y A;  1UBI A;  4WJP A;  2HTM E;  5E6P A;  3QHT A;  2WLB A;  3Q14 C;  1FXT B;  3S2A A;  4BKS A;  4N9F 4;  3KWL A;  3EC8 A;  1XO3 A;  3IFW B;  4DDG D;  1L6V A;  1V5O A;  1WGD A;  1GJZ A;  3AEF B;  4NQK E;  2G3Q B;  2PTL A;  2JWU A;  4HLE A;  2KJ6 A;  1J7B A;  3R8B A;  3QK0 A;  3Q6B A;  2CR5 A;  4GDL A;  4KKI A;  4FAD A;  4FXC A;  3H7P A;  2Z59 B;  4MGK E;  1E9M A;  4HXD A;  1BXT A;  4TMA B;  3NS1 A;  1SD0 A;  3CST A;  3R7Q A;  3DVN V;  2WXG A;  1V49 A;  2RR9 A;  2N4F A;  3RNC C;  2D11 A;  2ZVO A;  4DHZ E;  1JWU D;  3QA8 A;  2M1M A;  2MA9 B;  1HZ6 A;  3C19 A;  3KYD D;  1WYW B;  4KDL B;  4DHJ D;  1I4Q A;  3UF8 A;  4DXA B;  4KVG B;  1WM2 A;  4REZ A;  3ZRC A;  2PJH A;  2WDT B;  2IGH A;  4I6N B;  1L0V B;  2MSE D;  1SIF A;  4E71 A;  1V1O A;  3JVZ X;  4W9L A;  3U2S C;  3PHX B;  2FUG 1;  3DBH I;  4WQM A;  3APF A;  4LTU A;  1SEB D;  5GMV A;  2UYZ B;  1Y8R C;  4MJS A;  4XWT A;  4KGS A;  4PK1 A;  2MW5 A;  2J42 A;  4GOC A;  1BT0 A;  3J9C A;  3QWZ B;  2D3C A;  3PGE A;  4Q2R A;  2KTF A;  4N59 A;  5AZF A;  3CF6 E;  3CMM B;  4YWG G;  4GN1 A;  1WYG A;  2N7J A;  2GRI A;  4KZ0 A;  3A1Q A;  3RPF C;  3JQ3 A;  3U4E G;  4BZA A;  1I42 A;  2RDH A;  4K81 A;  3BII D;  5C1Z A;  2R61 A;  3RMK C;  3T9L A;  2YLM A;  1AYF A;  4GDK B;  2GB1 A;  4FN2 A;  4C56 C;  1TT5 B;  2GBR A;  1WRD B;  2CHX A;  2B3A A;  3DPD A;  1WR6 E;  5AZG A;  2XNA C;  3AU5 A;  4IM2 A;  3TEX A;  2SEB D;  4NJ7 A;  2DAJ A;  1CZP A;  2JXT A;  1ZXH A;  2DZJ A;  3DQV A;  3OWE B;  4DK5 A;  4J3O D;  1GB4 A;  1T6B X;  4IWP A;  4RGN A;  1S1Q B;  2L52 A;  2YVC A;  3AMZ A;  3FC4 A;  4WAF A;  4GXB A;  1JRO A;  4IWO A;  3DBH B;  2I1K A;  2HTH A;  1SJE D;  1MG4 A;  1VR9 A;  2W55 A;  1JWB D;  1F52 A;  1GG3 A;  4WIP A;  5TSS A;  4ARI A;  1SIJ A;  3MC9 A;  1UF0 A;  2D32 A;  4II3 B;  2KHW B;  1XEE A;  4G0N B;  3NS8 A;  4PYU A;  4R3D A;  4RF1 A;  2EEL A;  1P0R A;  3KLS X;  4OVV A;  2KMA A;  1RM6 C;  4HPL B;  4RCO A;  3DBL I;  3MHS D;  4CO7 A;  4OZA A;  3PV1 A;  3DVG Y;  1VJK A;  4MH8 A;  2LAS A;  2BB5 A;  1R4N I;  3AE8 B;  2Z0D B;  4USA A;  4GVY A;  1F1H A;  2W3S A;  1WJ4 A;  2LJI A;  2KC1 A;  4AS1 A;  2ASQ A;  2M4N A;  2ZPY A;  2GWC A;  3MTN B;  3ZJT A;  3KUZ A;  1FFV A;  1U6R A;  3PS6 A;  4W9F A;  1UZX B;  5BO4 B;  2BGF A;  2OJR A;  3GP7 A;  1WSP A;  3NZU A;  5MPO A;  4IM3 A;  1YD8 U;  1ENF A;  4RMA A;  1UGJ A;  3B2G A;  4OHJ A;  4XGA B;  1SSN A;  4HEA 1;  2VH2 A;  3RNF C;  4DHZ B;  2QMT A;  4JWU C;  1RFK A;  2KLC A;  2J4X A;  4HDQ A;  2IO0 B;  5H8Y E;  3H8H A;  2LHD A;  1MVK A;  4EOY A;  3L10 B;  2GWD A;  1S3S G;  3ZXR A;  2MX2 A;  2KQ7 A;  3M63 B;  3APD A;  2YEP B;  3TCA A;  5LLI A;  1QZE A;  4OZB A;  1N5W A;  1L4D B;  3Q8C A;  4OVU A;  1UBQ A;  1C4C A;  4MM3 A;  1WGH A;  4C00 A;  3K9O B;  1F2R C;  2O2V B;  4NAW B;  1MG8 A;  4B6W A;  3QAR A;  2RMM A;  3DWM A;  3WAP A;  2MEK A;  5HG2 A;  1MI0 A;  3P4S B;  4E74 A;  1YX5 B;  3UI3 A;  4JIO U;  3NG0 A;  4LNK A;  3O13 A;  2KAJ A;  3DBL B;  1SB3 C;  4O1N A;  1EF5 A;  5CX3 A;  3P42 A;  4URK A;  1YX6 B;  2MJD A;  1P9D U;  4IC7 B;  2V4I B;  1R4N B;  4AQ7 A;  2BQQ A;  1TS2 A;  2JZ3 B;  3WCQ A;  1AW7 A;  1C4A A;  4ASW C;  3H7S A;  1D4B A;  2V0G A;  3W9C B;  2O2V A;  2RDB C;  1T5X D;  5AUI A;  3LN7 A;  2AWT A;  2MBE A;  4CQN A;  4NPN A;  2WWZ A;  5T8I A;  3BY4 B;  1KH0 A;  5CHW A;  1ROE A;  4A90 A;  3LB8 C;  1P52 A;  3JW0 X;  1UD7 A;  1QOF A;  1Q0W B;  4IKG A;  3U30 A;  3PZ7 A;  2EMT A;  4MH0 E;  4XWW A;  3DHI C;  4K7U A;  2MP2 B;  4ZHO A;  2QJL A;  4A55 A;  1OQY A;  1I4R A;  1V4G A;  2KMM A;  4WUR A;  3UIP B;  3TBL D;  1RYJ A;  1STE A;  4XC2 A;  4JE3 B;  4BOZ B;  2CJO A;  4YT0 B;  1WGY A;  3WAM A;  3VH3 B;  1VA6 A;  1FCC C;  3UIO B;  2DLB A;  4FHK A;  4ICU A;  1BG0 A;  2K25 A;  2BKR B;  4KIK A;  3RZW C;  1RLF A;  4DBG A;  2J1Q A;  3L2D A;  1HEZ E;  1P7F A;  2BWE S;  2INN E;  3IHP C;  3TEZ A;  2XEW A;  2IBI B;  3A4R A;  3BVG A;  3BYT B;  4IDI A;  1C4P A;  4LK0 M;  2MP2 A;  2D5G A;  3VUX A;  3DVG X;  4YTM B;  3PSE B;  1YJJ A;  2JRI B;  3DBS A;  4C7Y A;  2IY0 B;  2GOW A;  1L0X B;  2MCN B;  4ZRP A;  3PTF C;  3N1Y C;  1E7P B;  2LMC A;  4MAC A;  3VTW A;  5J17 A;  4BBN F;  3HUI A;  3URY A;  2WU5 B;  4TKN A;  2R2Q A;  3ZNI D;  2BBC A;  1UH6 A;  4RH6 A;  1XLP A;  1WFY A;  2BTE A;  1TKG A;  1KLG D;  3NZS A;  1GC7 A;  3L08 A;  2WXF A;  2K9X A;  4A8X C;  2RGF A;  3IG3 A;  1NI3 A;  4P6V F;  3B0A A;  4HVB A;  2WP9 B;  1XLQ A;  3RT3 B;  4BG4 B;  1KLU D;  4WH4 A;  4W9K A;  2HDE A;  5GXG B;  5BMI A;  3AED B;  3I63 C;  2UU7 A;  2IZV B;  4II2 B;  3BK1 A;  1EF1 A;  1LM8 B;  4UDU C;  2K1F A;  1EO6 A;  1K51 A;  4BHL A;  3DRB A;  2KAN A;  4B9K A;  3AV8 A;  1IBX B;  2LGS A;  2RPQ A;  2M19 A;  2WDV B;  1X1M A;  4C7Z A;  1CQV A;  2A4Z A;  1XLO A;  4MDK E;  4BG4 A;  3CIR B;  5I4D A;  2KDF B;  1V2Y A;  3NVW A;  3PT2 B;  1AN8 A;  2GMI C;  1TS4 A;  3AEE B;  1C9F A;  1C77 A;  2KDM A;  1TS3 A;  5E6O A;  4US8 A;  4G11 A;  4ICV A;  2KYW A;  5D2M B;  4FJV B;  4IG7 B;  4WWN A;  1GNU A;  3BZD B;  1NI2 A;  5C2T B;  3DHH C;  1WZ0 A;  3OAW A;  2PVO D;  1JCK B;  5TR5 A;  5EE3 A;  1V8C A;  3R2I A;  2KWV B;  3AE3 B;  3W2D A;  5JXV A;  1LGR A;  2WU2 B;  2V1Y A;  4M8N A;  4AM1 A;  4KGT A;  4IUM B;  1YIW A;  4G3X B;  2I1J A;  2ZEQ A;  1WI0 A;  2CHZ A;  2KC2 A;  3LYY A;  2WDR B;  3M3J A;  3HM6 X;  3Q3J A;  2MBB B;  2W9N A;  2OED A;  1L4Z B;  3P63 A;  3ZYY X;  2KXJ A;  3NVZ A;  2FID A;  1PDX A;  1L7Y A;  1ZKH A;  4BAX A;  1E10 A;  4DXG A;  4XE0 A;  1YQB A;  2N9K A;  1TS5 A;  2JRH A;  4LDT B;  2LUE A;  2E6X A;  2E3T A;  2JT4 B;  4WAA A;  3DOW A;  4TQ1 A;  1KOT A;  3L13 A;  1HXY D;  2BS4 B;  2G4D B;  1ZOY B;  2DEN B;  3AEA B;  2N9P C;  4XZ4 A;  2GBM A;  5CHV C;  2PEA A;  2D07 B;  1AWD A;  3EFU A;  1I0E A;  1FNW A;  4ANW A;  2DHZ A;  4AWJ A;  3LXF A;  1CJE A;  2N7E A;  3LVW A;  4BOS C;  3ZIM A;  1FNV A;  4TSS A;  2XBB C;  1C1Y B;  3GOE A;  2KX3 A;  4GDL B;  2LJ5 A;  3UGB B;  3H7P B;  3QX1 A;  3TIX A;  2N9L A;  3L4P A;  5E6J A;  3IT4 B;  4OZC A;  1WF9 A;  3D32 A;  4HPP A;  3MC8 A;  5D7G A;  3VHT C;  3N9Y C;  2LUM A;  3V60 A;  4I6L B;  2CRK A;  3UQA A;  3UQB A;  3IG8 A;  1UEL A;  3BIN A;  4M00 A;  3ZXV A;  1E8X A;  2V4L A;  3MP9 A;  2ZNV C;  2LGX A;  2MWS B;  1YQ3 B;  3ZDT A;  3B1L X;  5C23 A;  4MJS B;  1KFY B;  2KDE B;  1J19 A;  3SU8 X;  1F2R I;  2V9H A;  5BMG A;  2KX0 A;  3ONS A;  4S0R A;  1FMA D;  3ZTD A;  4HWI B;  3VTU A;  2LZ6 A;  2LHE A;  2G45 B;  3A1Q B;  1ET6 A;  4NJC A;  3PRM B;  2RSU A;  1WH3 A;  2DYB A;  1PFD A;  2WXO A;  3CSF A;  3VFK A;  3AI5 A;  1N62 A;  4YL8 A;  1WXS A;  1V81 A;  3AEB B;  1BML C;  1UWX A;  1HZ5 A;  4NZL B;  4QAY A;  3PZD A;  1EM7 A;  1WX9 A;  4ZRI A;  3GZN B;  2BYF A;  2PE6 B;  1F9J A;  5AEK B;  1I4X A;  1N63 A;  1ISN A;  1UUP A;  2ZW0 A;  3JYU A;  1CMX B;  4XX5 A;  2K5P A;  5DPT A;  1WGK A;  5IO9 A;  2Y5B B;  2LVO A;  1EWC A;  1TGZ B;  4FHJ A;  2JXX A;  4YTP B;  2DYO A;  4HK2 A;  1SE9 A;  2FAZ A;  1RRB A;  3DCG A;  5L95 C;  1WM3 A;  1KTK A;  2NBV B;  3PZ8 A;  4D2K A;  2QSD A;  3PRE A;  2WXM A;  4P16 A;  3PHW B;  2R2O A;  2WDQ B;  3Q8F A;  5LXH A;  1OFF A;  3IXS A;  3E56 A;  4S17 A;  5J2R A;  4WJN A;  3NRZ A;  3PPA A;  2IYD B;  4A9A A;  2M17 A;  1FCL A;  2D10 A;  4E3C A;  1C76 A;  2KKC A;  1F0Z A;  1Q10 A;  1YN4 A;  3KUD B;  5D6J B;  3ZW3 A;  5J99 A;  1QKZ A;  3I57 A;  3OLM D;  1GUA B;  2M8S A;  1WMH A;  3BVZ A;  1EU3 A;  1RFA A;  2SAK A;  1TZO A;  2WGS A;  1ZP0 B;  4A3P A;  1E90 A; 
#chains in the Genus database with same CATH homology
 4LNK A;  3L2E A;  4ACF A;  2BVC A;  4BG4 B;  4LNI A;  4GVZ A;  3B6R A;  1HTO A;  2D3B A;  1SD0 A;  4RF6 A;  4RF7 A;  2D3A A;  4GVY A;  4HPP A;  3JQ3 A;  4XYC A;  1I0E A;  4BG4 A;  2GLS A;  1F1H A;  2WHI A;  4GW2 A;  1HTQ A;  1G0W A;  1P52 A;  2UU7 A;  4LNF A;  5J99 A;  5J9A A;  4S0R A;  1QH4 A;  3M10 A;  3JPZ A;  3DRE A;  4RF9 A;  2CRK A;  1RL9 A;  1M15 A;  2QC8 A;  4BAX A;  1P50 A;  1FPY A;  1BG0 A;  4LNO A;  1LGR A;  1VRP A;  2J1Q A;  1CRK A;  4AM1 A;  3DRB A;  4BHL A;  3JU6 A;  3L2D A;  3L2E B;  1U6R A;  2D3C A;  1F52 A;  2WGS A;  4S17 A;  4LNN A;  3ZXV A;  4GW0 A;  4Q2R A;  4RF8 A;  4Z9M A;  2LGS A;  3JU5 A;  1QK1 A;  3ZXR A;  3FKY A;  3NG0 A;  2OJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...