3ZXRA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
475
Chain Sequence
b'KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Trisubstituted Imidazoles as Mycobacterium Tuberculosis Glutamine Synthetase Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 160
structure length 475
sequence length 475
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3zxrA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3zxrA02
3JU5A 2CRKA 3M10A 4GVYA 1U6RA 3FKYA 2D3CA 1RL9A 1FPYA 3L2EB 3ZXRA 1VRPA 4RF6A 1LGRA 3DREA 2WHIA 4LNNA 1CRKA 4GVZA 4AM1A 3JQ3A 4LNIA 3DRBA 3L2EA 4HPPA 4LNOA 4Q2RA 4BHLA 5J9AA 4GW2A 1P50A 2BVCA 2UU7A 1G0WA 2OJWA 4LNKA 5J99A 4ACFA 1M15A 4RF8A 1HTOA 3NG0A 4S17A 4BAXA 1F1HA 1QH4A 3B6RA 3L2DA 4GW0A 4LNFA 1BG0A 1F52A 3ZXVA 2LGSA 1P52A 3JU6A 4RF7A 2D3AA 4S0RA 1I0EA 4BG4B 3JPZA 4RF9A 2WGSA 4XYCA 2QC8A 1QK1A 2GLSA 1SD0A 4BG4A 4Z9MA 1HTQA 2D3BA 2J1QA
chains in the Genus database with same CATH superfamily
1L5PA 4TKNA 1HZ6A 1SE2A 5DCNA 2ASQA 3LDZE 1T0SC 3VAWA 3CWIA 1C4AA 2K39A 1E8WA 3DWGC 1HTOA 1SF0A 3MC0B 4GXBA 4LNFA 1WE7A 2KQSA 2L32A 2O2VB 1ACCA 2KQ7A 4B0EA 1T0RC 1V8CA 3BY4B 4W9DA 1R4NB 3TEXA 3URYA 3HVZA 1JRUA 2L76A 3NUHB 2G1EA 2RDBC 1E7PB 2WX0A 3V62A 1H8CA 2C9WB 1KLGD 1VDVA 1AARA 3E56A 4IUMB 1KF6B 1RLFA 3H7PA 1NBFC 1UWXA 2OHFA 4IM2A 2QCZA 2CHWA 2KDMA 2PEAA 4KZCA 3B2GA 2ZZPB 3DREA 5IP4D 2V0GA 2PVGC 2K8CA 3IG3A 2VZKB 3BK1A 2FCQA 1JCKB 3SFDB 2JQRB 3DPDA 1JALA 1HXYD 2FCNA 5CX3A 1PGBA 4IWPA 1WJ4A 2IZVB 2KLCA 2VRRB 4W9GA 2X8XX 1R7SA 3LVWA 5T8IA 4CHKA 3KVFB 4GLSC 3RNFC 2NR2A 1YD8U 2JX5A 3KUZA 1KOTA 2CR5A 4DHJB 1SE3A 4FJYA 1UZXB 3A9JB 2DNFA 2M56B 4Q2JA 2GB1A 2EKIA 1JWUD 5IN7A 4EFOA 3LJ3A 4ZRJA 1V6EA 3M10A 2C7NB 4WQMA 2WU5B 2MBOA 3QA8A 1R4MI 1GNUA 2X38A 4HPPA 3L10B 1HEZE 3PLVA 3W5UB 1A70A 2Z0DB 2XEWA 3KLSX 3M3JA 4C56C 4PT5A 5EDSA 1WGRA 1VLBA 2IY1B 3JPZA 2MWSB 4HKZE 3VXWA 4A20A 4LDTD 3NRZA 2MLBA 3NVZA 1WRIA 4RCOA 3NY5A 4O1NA 3JU5A 1V81A 2V3PA 2GBMA 2HTME 4WAFA 1V97A 4EEWA 3KW5B 1G6JA 2NPTB 2E3TA 3ZO5B 5HG2A 1V1PB 3EFUA 2Z8LA 3DBRB 2KOXA 5EE1A 4YTMB 1Y8RC 2L3ZA 1PGAA 3ZVVA 2J53A 1WXSA 2VH2A 4P1BC 1UF0A 1A5RA 1L0VB 2JU6X 3VHTC 3FILA 2KDEB 1E7VA 4OZAA 2L0FA 1FMAD 3UINB 1YQ4B 1ZW7A 4B0MA 1L7YA 1G0WA 1PUTA 3NG0A 4BAXA 4AJWA 2J42A 2WXNA 4WJOA 3APCA 2KVZA 2JY6A 3RULA 4LJPB 3AE3B 1JQ4A 1I4PA 3V60A 5G55A 4M0WA 3VVWB 3MJWA 1RWSA 3HM3A 5IKCM 5D6JB 3RZFA 1EM7A 1CMXB 4L23A 1PDXA 2D11A 3VR8B 3PZ8A 4FADA 4S0RA 4YWGG 2W3SA 2XK5B 3TCAA 2N7EA 5BMIA 3Q69A 1D5ZC 4I6NB 1EO6A 2W82A 2ZEQA 2NPTA 1N6ZA 3RNAC 1D6EC 1V1PA 2ZNVB 2KWVB 4WIPA 4JL9A 1UBQA 4OVVA 4F1SA 1GAQB 4BFRA 1U4AA 2JYTA 4ICUA 2GMIC 5EE0A 4GU2A 4W9KA 4NZLB 3ZLZA 2LRWA 1EWYC 4RM9A 3X0WA 2AQ3B 3I57A 2M4NA 1DOIA 2YVCA 1WMHB 3KUDB 1YX6B 4IKGA 2RDHA 3VTUA 3U52E 3R2IA 3L2DA 4ANVA 4ZRIA 2JVCA 1NENB 1UUPA 3EC8A 4WWOA 3Q3OC 2AL6A 2V1YA 2QHOA 1IBXB 2LGYA 4KX6B 3N1YC 2CU1A 2ZCCA 1FNWA 3SDLC 3N32A 2JF5A 2G4DB 2NTSA 4B6WA 2WXMA 3BIID 4AP4C 1SJED 3LVVA 4GGQA 4A8XC 3RNCC 4MH8A 1SBBB 4ZRPA 2L0TA 1ZP0B 1RM6C 3U8ZA 3VRBB 5HHDG 2XK5A 1FCCC 3ZYYX 2IGGA 2CKHB 4N58A 2LJ5A 1L4DB 1XLNA 2ZJDA 3U30A 2SEBD 2D10A 3CSTA 3H8HA 2AL3A 2BF8B 2K8HA 3CIRB 1OQRA 4NY0A 1CZPA 3NZTA 2TSSA 3PPAA 5D3IB 1L6VA 2PJHA 3I9V1 3APFA 3KYCD 2JPHA 1ZXIA 4HLEA 1XLPA 4PK1A 3R3MA 1WGYA 4HKQA 4RF1A 4G3XB 1WMHA 2D3GA 4BHLA 4BZAA 3H6NA 2LHDA 5E6NA 4W9LA 4AWJA 1IUEA 4HPLB 3AEBB 3AN1A 2KD0A 3OJ4B 1BUIC 2R2OA 3LN6A 3IG8A 4RM8A 3Q8CA 2D2QA 3WCQA 3Q8FA 1E8ZA 3APDA 5JHAA 1TKYA 2I38A 1IBXA 1JWAD 3UI3A 2MCNB 2DYBA 1TT5B 1TKGA 3KUCB 1KLVA 3VUWA 4W9CA 2OOBB 1FM0D 4S17A 2MRPA 3LYYA 3DHIC 3HRDD 2WGSA 3CMMB 3KWLA 4GIVA 4A90A 2D3BA 1HTQA 2GRIA 4MEMA 4EKUA 1SIFA 1AW7A 5AZHA 4JWSC 2RDGA 2N0SB 3O13A 1SSNA 4W9EA 2GOWA 5DPTA 1FD6A 2BKFA 3QHTA 3QIJA 1QOGA 3DBRI 3Q2AC 2PIAA 4NAMA 2QC8A 1E10A 4KDLB 2MW5A 2V4LA 4JLCA 1DGJA 2NBWB 2ZVOA 3ZNZB 3ONSA 1GUAB 3HM6X 4LNNA 4QAYA 3U2SC 4A3OA 3MTNB 2MH7A 4TQ1A 4RNAA 2KC1A 2LFIA 1FCLA 1VZ8A 3IG5A 1TBEA 3PZ7A 1MJDA 3GS2A 4MSQB 1DOYA 1C78A 1FFUA 3IT6B 4ARIA 3M63B 3P4SB 4DXAB 4C4VB 3PT2B 2WYQA 3GZNI 1E8YA 3N1ZC 1E8XA 4AJYB 1MFWA 2ZW1A 4ZDVA 3ZQ4A 2RR9A 4GW2A 1ZDXA 1T0YA 2DZMA 2WXQA 4E74A 1I4HA 1XCQL 3ZTCA 2N9KA 1EF1A 2KTRA 2MQJA 1YN3A 3L17A 1KLUD 2KANA 2Z0EB 2IO1B 4HPMB 3NVYA 1NVID 3NVVA 4IWOA 3MHSD 3WA0A 1FPYA 3AECB 3EHVA 4CYEA 5HFYA 1P1AA 4BKSA 2LHEA 4WJPA 3SFEB 2IO3B 1CK1A 4TV3A 5GXGB 1KJTA 3DWMA 3O65B 4DDID 2J52A 3AU5A 4RGOS 3ZDTA 1BT0A 4DHZB 3U7ZA 3ZNID 2KVRA 3ZUNA 2O6VB 4Q2RA 1WF9A 2LZ6A 1M94A 2G9HD 5TSSA 1WRDB 1YJJA 1NI2A 2K6DB 2PLPA 1OQQA 2WXHA 3VRAB 3VUYA 4MH0E 1FEHA 3Q8EA 3OWEB 4HDOA 4GVYA 3WAOA 3U7DA 1WYGA 2WXGA 4C4VA 4LCDE 4N9F4 2WXFA 5BYQA 2DLBA 4P16A 3ZTDA 4TMAB 3WAPA 2JZZA 2WS3B 2GI9A 2NS5A 3H7PB 2BTEA 3MC9A 1I42A 1ZDVA 2ZVNA 1GJZA 4NPNA 2LXAA 1F77A 2GLSA 2BS2B 5G2NA 1ZUD2 2W9NA 2PMVA 2KC2A 4G11A 4M01A 4FLHA 3BK2A 3EECA 3RNBC 1FO4A 2KMCA 2Y3AA 1PYWD 1J8CA 3UGBB 2D5GA 3N20C 1UGMA 1F1HA 1P0RA 5E6OA 1QH4A 3BZDB 3VDZA 1WGGA 2LRUA 3H1UA 3DQVA 4DDGD 2OJRA 2KAJA 4Z9MA 2PVOD 4BKSD 1EUVB 1UELA 2PW9A 3N9YC 4YSXB 1RAXA 2N9LA 2N1VA 5FK9C 2K0PA 2KT7A 3H9DA 3ZXRA 4B9KA 5C23A 1VRPA 1WR6E 3PLUA 2C7HA 2BW2A 1FRRA 2O6VA 4HCNB 2DX5B 2KKCA 1ET9A 1KH0A 1WY8A 2N7JA 1VA6A 1I35A 4KDIC 1BXTA 3AI5A 1T3QA 4ICVA 1UWMA 2WQYB 2OEDA 4L2YA 4JGHB 1L0YB 4RMAA 3ETRA 4NAWA 2D32A 1TZOA 2NMQA 4HRSA 3ZDMC 4KSLC 4EE2A 1MG8A 3DDCB 1V4GA 2MJDA 2W3RA 2J0MA 2ONQA 2FUG1 3SEBA 2WDRB 3C8YA 4W9FA 2J7QB 4ZRKA 4KZ0A 3AMZA 1T5XD 4LLGM 3A4RA 2KDFB 1EU3A 4AUQC 1TS4A 3BVZA 4B95A 4NNJB 1AN8A 3FILB 3Q14C 3VTVA 3LN7A 4FULA 3BYYB 3TEYA 2FUHB 3AE7B 4GB9A 1FIQA 4NJCA 3VUXA 3ZIMA 3I5JC 2REXA 3AE2B 2FE8A 2M1MA 3W5VB 2KO3A 4GVZA 3BVMA 2FCMA 4YXDB 1TS5A 4WJQA 1V5OA 2K6QA 4RF8A 2JSVX 3ALBA 4BKTA 2K25A 5G5GA 4HXDA 4M0WB 1E7UA 2O6VD 4FHJA 3ABVB 3AB5A 2JXXA 1VR9A 4AS1A 3UF8A 2HE7A 1S3SG 3KWVA 4J3OD 4HJKA 4REZA 4IWQA 2QSDA 1Q0WB 2KNBA 3WAMA 3DBLI 1Z5SB 5D3DA 4HK2A 2SAKA 2XBBC 1V2YA 1YN4A 3AE9B 5LXIB 4AM1A 1WM3A 3QQ8B 2JWZA 1GC6A 2BYEA 3RT3B 1K50A 2WDQB 5L95C 3ZXVA 4ASWC 4GMVA 4K7SA 2FNJB 2N9PC 2M19A 2NVUI 2RPQA 1FNUA 3TL5A 1P3QU 5MPOA 3IHPC 1TJEA 5J9AA 3Q6BA 3AULA 1WM2A 5CHFA 2K1FA 3LB8C 4K1RB 4MGZE 4DXFA 1SD0A 2AQ1B 1IGDA 1V5TA 3QX1A 1C76A 3SD5A 1ESFA 2IDYA 3MJ5A 3SHQA 1P50A 2BPSA 4MT5A 5JZEB 3DVNU 2WX1A 3NHEB 2KWCA 2MBEA 3DVNV 1ZPSA 1P52A 4PS8A 1C9FA 4PYUA 5DPRA 4JE3B 2LI5A 2WXOA 3JSVA 3DCGA 1XLOA 1C4CA 3A1QA 4KGSA 1WXVA 3AE4B 3DVGX 4YSYB 5IOIA 4FJZA 1SB3C 2NBVB 4K3CA 1D5XC 2PTLA 4HCPB 4XC2A 2A4ZA 4XX5A 3VR9B 1SJHD 1V86A 2D3AA 5AZGA 3A33B 1OFFA 3Q3NC 2J4XA 3Q3JA 1XXGA 3K9PB 1N5WA 2JWUA 2KHWB 4F7ZA 1TS2A 3A9KB 2CU3A 3GP7A 4TQ0A 2JRHA 4MGKE 3L4PA 5AUIA 4DBGA 1GB4A 3PO0A 4C00A 5L83A 5D2MB 4RF7A 1VD2A 2D33A 1I4RA 1QT9A 3P4PB 4KIKB 1KFYB 4NQKE 1C4PA 1NI3A 1QLBB 3N30A 4EZKA 3L16A 4BBNC 1B1ZA 2BYFA 1ROEA 1R4NI 3W9CB 4M8NA 2WDVB 1XT9B 2ZNVC 1PQSA 3ECIA 3JU6A 4W9HA 1N63A 5LLIA 1D4BA 3WALA 1YJIA 1E0ZA 2ZPYA 3BVGA 2I2YA 3IT4B 1FRDA 2INNE 4BOSC 3P63A 5IA7A 3JQ3A 4ANUA 2RD0A 4RF0A 3AEAB 1DOXA 1D5MC 2GBJA 2LGXA 4YTPB 2L52A 4MGIE 2RMMA 1EF5A 3T8MA 4EOYA 1WI0A 2XNAC 4NJ6A 1E9MA 2DYOA 4CO7A 3UQAA 4WURA 2LGDA 5C1ZA 3QCAA 1PGXA 1ZXHA 2UWQA 2UYZB 1TT4A 2NBUA 4IOIE 3A9KA 1F52A 2WXPA 3I63C 5IO9A 5BO4B 4A6QA 1WYWB 2G45B 3RZWC 3PV1A 3NOBA 3P1MA 3IBEA 2IBIB 3BWUD 3L2EB 2Y5BB 1ENFA 1L2NA 4XZ4A 4KIKA 5GMVA 3VTWA 3PTFC 4G0NB 2KTRB 1N61A 2WDTB 1UGJA 1WJUA 2MHJA 3V6EB 1I7HA 3QAQA 2J1QA 3S2AA 2IGDA 1WZ3A 1Y56A 2JZ3B 1TYGB 1KTKA 1OGWA 5C3JB 2N1WA 1E90A 4C80A 3DVGY 1GOZA 2YEPF 1P98A 3DBHB 2GWCA 2PE6B 4WH4A 4A55A 5CTRC 3I3TB 3PVLA 2HJ8A 1S1QB 3EA6A 2ACZB 4OVZA 3UQBA 1TY0A 4ARCA 1WH3A 3PREA 4BKGA 4E3CA 1OEYA 4LNKA 4XDDA 4LJOB 3P42A 1YQ3B 4RGNA 1UD7A 1U6RA 1JROA 4KGRA 1WGDA 4NQLB 3V05A 3M62B 1LGRA 3NZSA 1CRKA 3TJPA 4AOFA 3L2EA 5D7GA 4I6LB 1XO3A 2EMSA 3TIXA 4ACFA 2KX3A 4MSMB 3AEEB 3M95A 3DHHC 2IO2B 1R4MB 2XN9C 1P9DU 4P6VF 3E9SA 1EWCA 3VQIA 1XD3B 1L6UA 5DPSA 1F9JA 2Z59B 1N62A 2WWZA 2KJ6A 2W54A 2DBYA 3SR6A 4TSSA 1ISNA 2MBHA 2G4SA 3N3KB 2KN4A 3ZJTA 1AWDA 2CS4A 1T6BX 3W1SA 4KKJA 1E5WA 3C0RB 3PRPB 1YMHE 4GDLB 3AE8B 5KHOA 4HROA 2M0AA 2N9EB 1YN5A 4FHKA 1BG0A 1HE8A 1QK1A 2IY0B 2KMAA 3P4QB 3PSEB 1OQYA 3OG5A 1WE6A 4NAWB 2AQ2B 5C2TB 1QOAA 2KQ4X 2V9HA 1WX7A 1OEYJ 3QJZA 3UIPB 4N59A 4II3B 1QILA 2AWTA 4JX1C 3P4RB 4EZJA 4GW0A 1Z2MA 2LVQA 1C1YB 3FC4A 5FR3A 4ZYNA 2WNMA 4XGAB 2BBCA 2BS4B 2INCC 1LXDA 1L4ZB 2WU2B 2FAZA 1FXTB 1WZ0A 1ZGUB 2LASA 3BYTB 1N5XA 1RFKA 2JXTA 2QMTA 4H2AA 4EZLA 1CQVA 3NS1A 5HKHA 1QZEA 5TR5A 1IYFA 4RF6A 1WWTA 3Q8AA 3VH3B 3OJ3A 4A9AA 3TMPB 2M17A 3B08A 4M8MA 3RCZA 2KZRA 2R61A 1WFYA 1JWBD 1YQBA 3N1XC 4JIOU 3ZKJC 4GDLA 4J6IA 1NYRA 3NVWA 4GN1A 3OLMD 1TTNA 3DHGC 4ZYSA 3WANA 2H89B 1SE9A 3IAS1 2N4FA 4CQNA 2WLBA 4M00A 4WWNA 3TUOA 4ANWA 3L13A 2INPE 4G50A 1TS3A 4DHZE 2FBWB 1Q5WB 1K52A 3GOEA 3R8BA 2GWDA 1R8GA 4HEA1 4IG7B 4GSWA 1K53A 2AEHA 2DAJA 5CHWA 2RGFA 3R7RA 2CJNA 5E6PA 4UDUC 2RSUA 2EKEC 2HD5B 1UBIA 2QIEB 4KSKC 1YOVB 4YTNB 3Q8BA 2ZW0A 3NZUA 4ZHPA 1MHXA 3MFGA 4C7ZA 5BYRA 1QQRA 3D32A 4XE0A 5HI1A 1GC7A 2KX0A 3DBHI 4YSZB 1WJ6A 3X23A 2QEJC 1JRPA 3RD2A 4AQ7A 2D07B 4FXCA 2C5LC 5H92C 1J0GA 1ZE3D 2BVCA 1HA5A 2WXIA 2HDEA 3QWZB 4HJGE 4RF9A 4XYCA 4MELA 1C3TA 2EELA 3MP9A 4RH6A 4ZOHC 2K5PA 2D3CA 3RYTA 3GE3C 3L0WB 3IAM1 3MHZA 5JHBA 2FIDA 2N9XA 3RNEC 1IP9A 1WX8A 2INDC 3JSVB 3L54A 1JMLA 5JH5C 3A1QB 2LGIA 2O2VA 3U4EG 2LVPA 1V80A 1WGHA 2PPHA 2BYVE 3RUIB 3EGRA 1ZKHA 4LNIA 2L00B 2LD9A 3HVDA 3R7QA 4ZHOA 4PS7A 1QKZA 1QF6A 4IM0A 1MVKA 5EE9A 1SIJA 4E71A 1QOBA 3TEZA 2KJRA 1DYQA 4NJ7A 4OZBA 2J0KA 4MACA 1SEBD 4MJSB 5D94A 2KFKB 2C7MB 2R2QA 2IPKD 3B0AA 4F8CB 4DWFA 3WIMA 1MPEA 4JWUC 3B6RA 1NYQA 2V3NA 1AYFA 3T9LA 2BB6A 2DENB 1WXMA 2B76B 2M8SA 1P7FA 1ZOYB 4M02A 4MM3B 2HJ1A 2MEKA 5LNK1 3W2DA 1TIFA 4P7IA 4FJVB 1VRAB 3H7SA 1UH6A 2KWUB 3GZNB 3A9JA 2RPVA 2JUOA 2KLGA 1JWMD 3B1LX 2Y5CA 3VFKA 1NEKB 3FKYA 2MP2B 4RGTA 4OZCA 2BT6A 1KM7A 3QARA 3OAWA 2Y5PA 3CF6E 3IXSA 2JRIB 5BMGA 4XDCA 2YLMA 2DHZA 1I0EA 3TSSA 4X57B 2LEKA 2DZKA 4TUUA 3VH4B 2KDIA 3GB1A 3Q3MC 4OHJA 2YEPB 1I4QA 4W9IA 2W55A 4A3PA 2JZPA 2V4IB 1K51A 3NZ3A 3AH7A 5BMHA 4MJSA 2KFKA 3HIZA 2KN5A 2BS3B 1ET6A 1VZ6A 1D3ZA 5EE3A 5J18A 1C77A 2V3SA 1WJNA 4WJNA 1WSPA 4RFBA 1LQBA 1YNTE 2VZKD 2K3UA 3PRMB 2MBQA 1WGKA 3DRBA 2OJWA 4MM3A 3R2TA 2MA9B 4URKA 2M0XA 4LTUA 3P2BA 2BQQA 3TEWA 2WXLA 1F2RC 1GG3A 2WXJA 3R66C 4DHJD 2MP2A 2CHXA 1N60A 3ZNGC 3PRZA 2KFJA 3FAHA 3QC8B 1IGCA 4K7UA 4BVUC 1JWSD 1J19A 1F0ZA 4R3DA 2IYDB 2IJ0A 2DZJA 1GB1A 4WWPA 3AE1B 3PGEA 4LK0M 3KQ4A 1EU4A 5LXHA 1VCBA 2WHIA 2A5UA 3NS8A 2KMMA 3ZGZA 1XQQA 5KHQA 3AEDB 4KV2A 1V49A 3V61A 2NTTA 3W1YA 2QJLA 5AZFA 2CJOA 4DXGA 2WXRA 3IFWB 1C79A 1RFAA 2L1AA 1FNVA 4OVUA 2IGHA 3DBSA 4W9JA 1P7EA 4WAAA 2UU7A 1HZ5A 3EFCA 2C60A 3JVZX 4US8A 4D2KA 1Q1OA 5G5HA 3ZRFA 2MJEA 2KACA 1J7AA 4GDKB 5CHVC 2BKRB 3NJTA 4XWWA 1JW9D 3ZW3A 1SXTA 4ANXA 2EMTA 4PYZA 2N7DA 1SGHA 2K22A 2LMCA 4K81A 2MJ3A 3RPFC 4IC7B 2VH1A 3PHWB 1M15A 5IAAC 3KYDD 4US9A 5AUKA 1KRHA 1WXAA 3SU8X 1X1MA 1Q10A 3GE8C 4KVGB 3AU4A 4BOZB 2QDFA 3CSFA 1MHHE 1STEA 1H4RA 4L1BA 4BBNF 2JYEA 3RMKC 3K9OB 1HQRD 2MBBB 2KXJA 2KWDA 1BMLC 5J17A 3KH0A 4IM3A 4PS3A 1GPXA 1LFDA 2BWFA 1XF5L 2LGSA 5DPWA 5JXVA 1V1OA 3DOWA 3Q3FA 3AEGB 2GBNA 4WWMA 2LJIA 3V3XA 4HDQA 2WP9B 1TY2A 2K8BA 3AE6B 1J7CA 1T0QC 1SE4A 2J0JA 4JQWC 4ITKA 4N6EB 1J7BA 2KDBA 4RGMA 1YX5B 4XWTA 3ZNHB 3RNGC 4FA6A 4BG4B 2GBKA 3W1SC 3EUB2 1RRBA 3HK0A 2BYTA 2NCNA 2PKOA 3ENEA 3RFZB 2JT4B 3MC8A 4I6PA 1FFVA 2DAFA 4KGTA 4P1CC 3IVFA 2KTFA 2AYOB 1MG4A 2FCSA 2IO0B 5H8YE 4DK5A 2L7RA 4GDKA 3AV8A 2ZPNA 2L8JA 3DBLB 4IDIA 4EUTA 2LUEA 4FN2A 1CJEA 4WQOB 1NDDA 3JYUA 4IW0A 2Q5WD 2AX5A 4ZRQA 2ON8A 2KYWA 3A4SC 2LUMA 3AXCA 2WXKA 2PE9A 5FKAC 5BYSA 3AE5B 4DQOC 2BB5A 3QK0A 3JW0X 4HWIB 1WX9A 1XLQA 2H88B 2MX2A 4K3BA 1F2RI 2KJHB 1LO5D 4MDKE 2DWQA 3T3NA 1FXIA 1XEEA 2L05A 3AEFB 1LM8B 1E6EB 1FXAA 1V9JA 4YL8A 1UNSA 1TZ1A 1QOFA 1TGZB 4OW0A 1VJKA 4YT0B 2LWPA 2B3AA 4LNOA 3L08A 2KK8A 5I4DA 1YIWA 3RN9C 4HVBA 4MGYE 3T3OA 1I4XA 3ZJVA 1TKEA 3HHMA 4FBJB 3ZRCA 1B9RA 3TBLD 4BG4A 2ICIA 1XCTL 2CRKA 2LXCA 3J9CA 4KKIA 4LDTB 4GOCA 1RL9A 2G3QB 3C19A 3PZDA 3ML9A 2DZIA 1K8RB 1OTRB 2HTHA 3LXFA 2LVOA 3B2FA 2I1KA 5J2RA 2MSED 3B9JA 2BWES 3UIOB 1WXQA 3RI7C 1M4VA 4K7WA 1WR1A 1RYJA 2CHZA 5E6JA 2L83A 5AEKB 3PS6A 2I1JA 1L0XB 3PHXB 1MI0A 3AM9A 4JPSA 4USAA 3ZJUA 1YJ1A 2ZCBA 4C7YA 2E6XA 1I4GA 3HUIA 2K9XA 4II2B 5J99A 3V6CB 2FIFA 1IPGA 2GBRA 1VZ7A 5FR6A 1WIAA 2QILA 3ML8A 2BGFA 3BINA 1PFDA 2DYMA
chains in the Genus database with same CATH topology
3JU5A 2CRKA 3M10A 4GVYA 1U6RA 3FKYA 2D3CA 1RL9A 1FPYA 3L2EB 3ZXRA 1VRPA 4RF6A 1LGRA 3DREA 2WHIA 4LNNA 1CRKA 4GVZA 4AM1A 3JQ3A 4LNIA 3DRBA 3L2EA 4HPPA 4LNOA 4Q2RA 4BHLA 5J9AA 4GW2A 1P50A 2BVCA 2UU7A 1G0WA 2OJWA 4LNKA 5J99A 4ACFA 1M15A 4RF8A 1HTOA 3NG0A 4S17A 4BAXA 1F1HA 1QH4A 3B6RA 3L2DA 4GW0A 4LNFA 1BG0A 1F52A 3ZXVA 2LGSA 1P52A 3JU6A 4RF7A 2D3AA 4S0RA 1I0EA 4BG4B 3JPZA 4RF9A 2WGSA 4XYCA 2QC8A 1QK1A 2GLSA 1SD0A 4BG4A 4Z9MA 1HTQA 2D3BA 2J1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU5 A;  2CRK A;  3M10 A;  4GVY A;  1U6R A;  3FKY A;  2D3C A;  1RL9 A;  1FPY A;  3L2E B;  3ZXR A;  1VRP A;  4RF6 A;  1LGR A;  3DRE A;  2WHI A;  4LNN A;  1CRK A;  4GVZ A;  4AM1 A;  3JQ3 A;  4LNI A;  3DRB A;  3L2E A;  4HPP A;  4LNO A;  4Q2R A;  4BHL A;  5J9A A;  4GW2 A;  1P50 A;  2BVC A;  2UU7 A;  1G0W A;  2OJW A;  4LNK A;  5J99 A;  4ACF A;  1M15 A;  4RF8 A;  1HTO A;  3NG0 A;  4S17 A;  4BAX A;  1F1H A;  1QH4 A;  3B6R A;  3L2D A;  4GW0 A;  4LNF A;  1BG0 A;  1F52 A;  3ZXV A;  2LGS A;  1P52 A;  3JU6 A;  4RF7 A;  2D3A A;  4S0R A;  1I0E A;  4BG4 B;  3JPZ A;  4RF9 A;  2WGS A;  4XYC A;  2QC8 A;  1QK1 A;  2GLS A;  1SD0 A;  4BG4 A;  4Z9M A;  1HTQ A;  2D3B A;  2J1Q A; 
#chains in the Genus database with same CATH topology
 1L5P A;  4TKN A;  1HZ6 A;  1SE2 A;  5DCN A;  2ASQ A;  3LDZ E;  1T0S C;  3VAW A;  3CWI A;  1C4A A;  2K39 A;  1E8W A;  3DWG C;  1HTO A;  1SF0 A;  3MC0 B;  4GXB A;  4LNF A;  1WE7 A;  2KQS A;  2L32 A;  2O2V B;  1ACC A;  2KQ7 A;  4B0E A;  1T0R C;  1V8C A;  3BY4 B;  4W9D A;  1R4N B;  3TEX A;  3URY A;  3HVZ A;  1JRU A;  2L76 A;  3NUH B;  2G1E A;  2RDB C;  1E7P B;  2WX0 A;  3V62 A;  1H8C A;  2C9W B;  1KLG D;  1VDV A;  1AAR A;  3E56 A;  4IUM B;  1KF6 B;  1RLF A;  3H7P A;  1NBF C;  1UWX A;  2OHF A;  4IM2 A;  2QCZ A;  2CHW A;  2KDM A;  2PEA A;  4KZC A;  3B2G A;  2ZZP B;  3DRE A;  5IP4 D;  2V0G A;  2PVG C;  2K8C A;  3IG3 A;  2VZK B;  3BK1 A;  2FCQ A;  1JCK B;  3SFD B;  2JQR B;  3DPD A;  1JAL A;  1HXY D;  2FCN A;  5CX3 A;  1PGB A;  4IWP A;  1WJ4 A;  2IZV B;  2KLC A;  2VRR B;  4W9G A;  2X8X X;  1R7S A;  3LVW A;  5T8I A;  4CHK A;  3KVF B;  4GLS C;  3RNF C;  2NR2 A;  1YD8 U;  2JX5 A;  3KUZ A;  1KOT A;  2CR5 A;  4DHJ B;  1SE3 A;  4FJY A;  1UZX B;  3A9J B;  2DNF A;  2M56 B;  4Q2J A;  2GB1 A;  2EKI A;  1JWU D;  5IN7 A;  4EFO A;  3LJ3 A;  4ZRJ A;  1V6E A;  3M10 A;  2C7N B;  4WQM A;  2WU5 B;  2MBO A;  3QA8 A;  1R4M I;  1GNU A;  2X38 A;  4HPP A;  3L10 B;  1HEZ E;  3PLV A;  3W5U B;  1A70 A;  2Z0D B;  2XEW A;  3KLS X;  3M3J A;  4C56 C;  4PT5 A;  5EDS A;  1WGR A;  1VLB A;  2IY1 B;  3JPZ A;  2MWS B;  4HKZ E;  3VXW A;  4A20 A;  4LDT D;  3NRZ A;  2MLB A;  3NVZ A;  1WRI A;  4RCO A;  3NY5 A;  4O1N A;  3JU5 A;  1V81 A;  2V3P A;  2GBM A;  2HTM E;  4WAF A;  1V97 A;  4EEW A;  3KW5 B;  1G6J A;  2NPT B;  2E3T A;  3ZO5 B;  5HG2 A;  1V1P B;  3EFU A;  2Z8L A;  3DBR B;  2KOX A;  5EE1 A;  4YTM B;  1Y8R C;  2L3Z A;  1PGA A;  3ZVV A;  2J53 A;  1WXS A;  2VH2 A;  4P1B C;  1UF0 A;  1A5R A;  1L0V B;  2JU6 X;  3VHT C;  3FIL A;  2KDE B;  1E7V A;  4OZA A;  2L0F A;  1FMA D;  3UIN B;  1YQ4 B;  1ZW7 A;  4B0M A;  1L7Y A;  1G0W A;  1PUT A;  3NG0 A;  4BAX A;  4AJW A;  2J42 A;  2WXN A;  4WJO A;  3APC A;  2KVZ A;  2JY6 A;  3RUL A;  4LJP B;  3AE3 B;  1JQ4 A;  1I4P A;  3V60 A;  5G55 A;  4M0W A;  3VVW B;  3MJW A;  1RWS A;  3HM3 A;  5IKC M;  5D6J B;  3RZF A;  1EM7 A;  1CMX B;  4L23 A;  1PDX A;  2D11 A;  3VR8 B;  3PZ8 A;  4FAD A;  4S0R A;  4YWG G;  2W3S A;  2XK5 B;  3TCA A;  2N7E A;  5BMI A;  3Q69 A;  1D5Z C;  4I6N B;  1EO6 A;  2W82 A;  2ZEQ A;  2NPT A;  1N6Z A;  3RNA C;  1D6E C;  1V1P A;  2ZNV B;  2KWV B;  4WIP A;  4JL9 A;  1UBQ A;  4OVV A;  4F1S A;  1GAQ B;  4BFR A;  1U4A A;  2JYT A;  4ICU A;  2GMI C;  5EE0 A;  4GU2 A;  4W9K A;  4NZL B;  3ZLZ A;  2LRW A;  1EWY C;  4RM9 A;  3X0W A;  2AQ3 B;  3I57 A;  2M4N A;  1DOI A;  2YVC A;  1WMH B;  3KUD B;  1YX6 B;  4IKG A;  2RDH A;  3VTU A;  3U52 E;  3R2I A;  3L2D A;  4ANV A;  4ZRI A;  2JVC A;  1NEN B;  1UUP A;  3EC8 A;  4WWO A;  3Q3O C;  2AL6 A;  2V1Y A;  2QHO A;  1IBX B;  2LGY A;  4KX6 B;  3N1Y C;  2CU1 A;  2ZCC A;  1FNW A;  3SDL C;  3N32 A;  2JF5 A;  2G4D B;  2NTS A;  4B6W A;  2WXM A;  3BII D;  4AP4 C;  1SJE D;  3LVV A;  4GGQ A;  4A8X C;  3RNC C;  4MH8 A;  1SBB B;  4ZRP A;  2L0T A;  1ZP0 B;  1RM6 C;  3U8Z A;  3VRB B;  5HHD G;  2XK5 A;  1FCC C;  3ZYY X;  2IGG A;  2CKH B;  4N58 A;  2LJ5 A;  1L4D B;  1XLN A;  2ZJD A;  3U30 A;  2SEB D;  2D10 A;  3CST A;  3H8H A;  2AL3 A;  2BF8 B;  2K8H A;  3CIR B;  1OQR A;  4NY0 A;  1CZP A;  3NZT A;  2TSS A;  3PPA A;  5D3I B;  1L6V A;  2PJH A;  3I9V 1;  3APF A;  3KYC D;  2JPH A;  1ZXI A;  4HLE A;  1XLP A;  4PK1 A;  3R3M A;  1WGY A;  4HKQ A;  4RF1 A;  4G3X B;  1WMH A;  2D3G A;  4BHL A;  4BZA A;  3H6N A;  2LHD A;  5E6N A;  4W9L A;  4AWJ A;  1IUE A;  4HPL B;  3AEB B;  3AN1 A;  2KD0 A;  3OJ4 B;  1BUI C;  2R2O A;  3LN6 A;  3IG8 A;  4RM8 A;  3Q8C A;  2D2Q A;  3WCQ A;  3Q8F A;  1E8Z A;  3APD A;  5JHA A;  1TKY A;  2I38 A;  1IBX A;  1JWA D;  3UI3 A;  2MCN B;  2DYB A;  1TT5 B;  1TKG A;  3KUC B;  1KLV A;  3VUW A;  4W9C A;  2OOB B;  1FM0 D;  4S17 A;  2MRP A;  3LYY A;  3DHI C;  3HRD D;  2WGS A;  3CMM B;  3KWL A;  4GIV A;  4A90 A;  2D3B A;  1HTQ A;  2GRI A;  4MEM A;  4EKU A;  1SIF A;  1AW7 A;  5AZH A;  4JWS C;  2RDG A;  2N0S B;  3O13 A;  1SSN A;  4W9E A;  2GOW A;  5DPT A;  1FD6 A;  2BKF A;  3QHT A;  3QIJ A;  1QOG A;  3DBR I;  3Q2A C;  2PIA A;  4NAM A;  2QC8 A;  1E10 A;  4KDL B;  2MW5 A;  2V4L A;  4JLC A;  1DGJ A;  2NBW B;  2ZVO A;  3ZNZ B;  3ONS A;  1GUA B;  3HM6 X;  4LNN A;  4QAY A;  3U2S C;  4A3O A;  3MTN B;  2MH7 A;  4TQ1 A;  4RNA A;  2KC1 A;  2LFI A;  1FCL A;  1VZ8 A;  3IG5 A;  1TBE A;  3PZ7 A;  1MJD A;  3GS2 A;  4MSQ B;  1DOY A;  1C78 A;  1FFU A;  3IT6 B;  4ARI A;  3M63 B;  3P4S B;  4DXA B;  4C4V B;  3PT2 B;  2WYQ A;  3GZN I;  1E8Y A;  3N1Z C;  1E8X A;  4AJY B;  1MFW A;  2ZW1 A;  4ZDV A;  3ZQ4 A;  2RR9 A;  4GW2 A;  1ZDX A;  1T0Y A;  2DZM A;  2WXQ A;  4E74 A;  1I4H A;  1XCQ L;  3ZTC A;  2N9K A;  1EF1 A;  2KTR A;  2MQJ A;  1YN3 A;  3L17 A;  1KLU D;  2KAN A;  2Z0E B;  2IO1 B;  4HPM B;  3NVY A;  1NVI D;  3NVV A;  4IWO A;  3MHS D;  3WA0 A;  1FPY A;  3AEC B;  3EHV A;  4CYE A;  5HFY A;  1P1A A;  4BKS A;  2LHE A;  4WJP A;  3SFE B;  2IO3 B;  1CK1 A;  4TV3 A;  5GXG B;  1KJT A;  3DWM A;  3O65 B;  4DDI D;  2J52 A;  3AU5 A;  4RGO S;  3ZDT A;  1BT0 A;  4DHZ B;  3U7Z A;  3ZNI D;  2KVR A;  3ZUN A;  2O6V B;  4Q2R A;  1WF9 A;  2LZ6 A;  1M94 A;  2G9H D;  5TSS A;  1WRD B;  1YJJ A;  1NI2 A;  2K6D B;  2PLP A;  1OQQ A;  2WXH A;  3VRA B;  3VUY A;  4MH0 E;  1FEH A;  3Q8E A;  3OWE B;  4HDO A;  4GVY A;  3WAO A;  3U7D A;  1WYG A;  2WXG A;  4C4V A;  4LCD E;  4N9F 4;  2WXF A;  5BYQ A;  2DLB A;  4P16 A;  3ZTD A;  4TMA B;  3WAP A;  2JZZ A;  2WS3 B;  2GI9 A;  2NS5 A;  3H7P B;  2BTE A;  3MC9 A;  1I42 A;  1ZDV A;  2ZVN A;  1GJZ A;  4NPN A;  2LXA A;  1F77 A;  2GLS A;  2BS2 B;  5G2N A;  1ZUD 2;  2W9N A;  2PMV A;  2KC2 A;  4G11 A;  4M01 A;  4FLH A;  3BK2 A;  3EEC A;  3RNB C;  1FO4 A;  2KMC A;  2Y3A A;  1PYW D;  1J8C A;  3UGB B;  2D5G A;  3N20 C;  1UGM A;  1F1H A;  1P0R A;  5E6O A;  1QH4 A;  3BZD B;  3VDZ A;  1WGG A;  2LRU A;  3H1U A;  3DQV A;  4DDG D;  2OJR A;  2KAJ A;  4Z9M A;  2PVO D;  4BKS D;  1EUV B;  1UEL A;  2PW9 A;  3N9Y C;  4YSX B;  1RAX A;  2N9L A;  2N1V A;  5FK9 C;  2K0P A;  2KT7 A;  3H9D A;  3ZXR A;  4B9K A;  5C23 A;  1VRP A;  1WR6 E;  3PLU A;  2C7H A;  2BW2 A;  1FRR A;  2O6V A;  4HCN B;  2DX5 B;  2KKC A;  1ET9 A;  1KH0 A;  1WY8 A;  2N7J A;  1VA6 A;  1I35 A;  4KDI C;  1BXT A;  3AI5 A;  1T3Q A;  4ICV A;  1UWM A;  2WQY B;  2OED A;  4L2Y A;  4JGH B;  1L0Y B;  4RMA A;  3ETR A;  4NAW A;  2D32 A;  1TZO A;  2NMQ A;  4HRS A;  3ZDM C;  4KSL C;  4EE2 A;  1MG8 A;  3DDC B;  1V4G A;  2MJD A;  2W3R A;  2J0M A;  2ONQ A;  2FUG 1;  3SEB A;  2WDR B;  3C8Y A;  4W9F A;  2J7Q B;  4ZRK A;  4KZ0 A;  3AMZ A;  1T5X D;  4LLG M;  3A4R A;  2KDF B;  1EU3 A;  4AUQ C;  1TS4 A;  3BVZ A;  4B95 A;  4NNJ B;  1AN8 A;  3FIL B;  3Q14 C;  3VTV A;  3LN7 A;  4FUL A;  3BYY B;  3TEY A;  2FUH B;  3AE7 B;  4GB9 A;  1FIQ A;  4NJC A;  3VUX A;  3ZIM A;  3I5J C;  2REX A;  3AE2 B;  2FE8 A;  2M1M A;  3W5V B;  2KO3 A;  4GVZ A;  3BVM A;  2FCM A;  4YXD B;  1TS5 A;  4WJQ A;  1V5O A;  2K6Q A;  4RF8 A;  2JSV X;  3ALB A;  4BKT A;  2K25 A;  5G5G A;  4HXD A;  4M0W B;  1E7U A;  2O6V D;  4FHJ A;  3ABV B;  3AB5 A;  2JXX A;  1VR9 A;  4AS1 A;  3UF8 A;  2HE7 A;  1S3S G;  3KWV A;  4J3O D;  4HJK A;  4REZ A;  4IWQ A;  2QSD A;  1Q0W B;  2KNB A;  3WAM A;  3DBL I;  1Z5S B;  5D3D A;  4HK2 A;  2SAK A;  2XBB C;  1V2Y A;  1YN4 A;  3AE9 B;  5LXI B;  4AM1 A;  1WM3 A;  3QQ8 B;  2JWZ A;  1GC6 A;  2BYE A;  3RT3 B;  1K50 A;  2WDQ B;  5L95 C;  3ZXV A;  4ASW C;  4GMV A;  4K7S A;  2FNJ B;  2N9P C;  2M19 A;  2NVU I;  2RPQ A;  1FNU A;  3TL5 A;  1P3Q U;  5MPO A;  3IHP C;  1TJE A;  5J9A A;  3Q6B A;  3AUL A;  1WM2 A;  5CHF A;  2K1F A;  3LB8 C;  4K1R B;  4MGZ E;  4DXF A;  1SD0 A;  2AQ1 B;  1IGD A;  1V5T A;  3QX1 A;  1C76 A;  3SD5 A;  1ESF A;  2IDY A;  3MJ5 A;  3SHQ A;  1P50 A;  2BPS A;  4MT5 A;  5JZE B;  3DVN U;  2WX1 A;  3NHE B;  2KWC A;  2MBE A;  3DVN V;  1ZPS A;  1P52 A;  4PS8 A;  1C9F A;  4PYU A;  5DPR A;  4JE3 B;  2LI5 A;  2WXO A;  3JSV A;  3DCG A;  1XLO A;  1C4C A;  3A1Q A;  4KGS A;  1WXV A;  3AE4 B;  3DVG X;  4YSY B;  5IOI A;  4FJZ A;  1SB3 C;  2NBV B;  4K3C A;  1D5X C;  2PTL A;  4HCP B;  4XC2 A;  2A4Z A;  4XX5 A;  3VR9 B;  1SJH D;  1V86 A;  2D3A A;  5AZG A;  3A33 B;  1OFF A;  3Q3N C;  2J4X A;  3Q3J A;  1XXG A;  3K9P B;  1N5W A;  2JWU A;  2KHW B;  4F7Z A;  1TS2 A;  3A9K B;  2CU3 A;  3GP7 A;  4TQ0 A;  2JRH A;  4MGK E;  3L4P A;  5AUI A;  4DBG A;  1GB4 A;  3PO0 A;  4C00 A;  5L83 A;  5D2M B;  4RF7 A;  1VD2 A;  2D33 A;  1I4R A;  1QT9 A;  3P4P B;  4KIK B;  1KFY B;  4NQK E;  1C4P A;  1NI3 A;  1QLB B;  3N30 A;  4EZK A;  3L16 A;  4BBN C;  1B1Z A;  2BYF A;  1ROE A;  1R4N I;  3W9C B;  4M8N A;  2WDV B;  1XT9 B;  2ZNV C;  1PQS A;  3ECI A;  3JU6 A;  4W9H A;  1N63 A;  5LLI A;  1D4B A;  3WAL A;  1YJI A;  1E0Z A;  2ZPY A;  3BVG A;  2I2Y A;  3IT4 B;  1FRD A;  2INN E;  4BOS C;  3P63 A;  5IA7 A;  3JQ3 A;  4ANU A;  2RD0 A;  4RF0 A;  3AEA B;  1DOX A;  1D5M C;  2GBJ A;  2LGX A;  4YTP B;  2L52 A;  4MGI E;  2RMM A;  1EF5 A;  3T8M A;  4EOY A;  1WI0 A;  2XNA C;  4NJ6 A;  1E9M A;  2DYO A;  4CO7 A;  3UQA A;  4WUR A;  2LGD A;  5C1Z A;  3QCA A;  1PGX A;  1ZXH A;  2UWQ A;  2UYZ B;  1TT4 A;  2NBU A;  4IOI E;  3A9K A;  1F52 A;  2WXP A;  3I63 C;  5IO9 A;  5BO4 B;  4A6Q A;  1WYW B;  2G45 B;  3RZW C;  3PV1 A;  3NOB A;  3P1M A;  3IBE A;  2IBI B;  3BWU D;  3L2E B;  2Y5B B;  1ENF A;  1L2N A;  4XZ4 A;  4KIK A;  5GMV A;  3VTW A;  3PTF C;  4G0N B;  2KTR B;  1N61 A;  2WDT B;  1UGJ A;  1WJU A;  2MHJ A;  3V6E B;  1I7H A;  3QAQ A;  2J1Q A;  3S2A A;  2IGD A;  1WZ3 A;  1Y56 A;  2JZ3 B;  1TYG B;  1KTK A;  1OGW A;  5C3J B;  2N1W A;  1E90 A;  4C80 A;  3DVG Y;  1GOZ A;  2YEP F;  1P98 A;  3DBH B;  2GWC A;  2PE6 B;  4WH4 A;  4A55 A;  5CTR C;  3I3T B;  3PVL A;  2HJ8 A;  1S1Q B;  3EA6 A;  2ACZ B;  4OVZ A;  3UQB A;  1TY0 A;  4ARC A;  1WH3 A;  3PRE A;  4BKG A;  4E3C A;  1OEY A;  4LNK A;  4XDD A;  4LJO B;  3P42 A;  1YQ3 B;  4RGN A;  1UD7 A;  1U6R A;  1JRO A;  4KGR A;  1WGD A;  4NQL B;  3V05 A;  3M62 B;  1LGR A;  3NZS A;  1CRK A;  3TJP A;  4AOF A;  3L2E A;  5D7G A;  4I6L B;  1XO3 A;  2EMS A;  3TIX A;  4ACF A;  2KX3 A;  4MSM B;  3AEE B;  3M95 A;  3DHH C;  2IO2 B;  1R4M B;  2XN9 C;  1P9D U;  4P6V F;  3E9S A;  1EWC A;  3VQI A;  1XD3 B;  1L6U A;  5DPS A;  1F9J A;  2Z59 B;  1N62 A;  2WWZ A;  2KJ6 A;  2W54 A;  2DBY A;  3SR6 A;  4TSS A;  1ISN A;  2MBH A;  2G4S A;  3N3K B;  2KN4 A;  3ZJT A;  1AWD A;  2CS4 A;  1T6B X;  3W1S A;  4KKJ A;  1E5W A;  3C0R B;  3PRP B;  1YMH E;  4GDL B;  3AE8 B;  5KHO A;  4HRO A;  2M0A A;  2N9E B;  1YN5 A;  4FHK A;  1BG0 A;  1HE8 A;  1QK1 A;  2IY0 B;  2KMA A;  3P4Q B;  3PSE B;  1OQY A;  3OG5 A;  1WE6 A;  4NAW B;  2AQ2 B;  5C2T B;  1QOA A;  2KQ4 X;  2V9H A;  1WX7 A;  1OEY J;  3QJZ A;  3UIP B;  4N59 A;  4II3 B;  1QIL A;  2AWT A;  4JX1 C;  3P4R B;  4EZJ A;  4GW0 A;  1Z2M A;  2LVQ A;  1C1Y B;  3FC4 A;  5FR3 A;  4ZYN A;  2WNM A;  4XGA B;  2BBC A;  2BS4 B;  2INC C;  1LXD A;  1L4Z B;  2WU2 B;  2FAZ A;  1FXT B;  1WZ0 A;  1ZGU B;  2LAS A;  3BYT B;  1N5X A;  1RFK A;  2JXT A;  2QMT A;  4H2A A;  4EZL A;  1CQV A;  3NS1 A;  5HKH A;  1QZE A;  5TR5 A;  1IYF A;  4RF6 A;  1WWT A;  3Q8A A;  3VH3 B;  3OJ3 A;  4A9A A;  3TMP B;  2M17 A;  3B08 A;  4M8M A;  3RCZ A;  2KZR A;  2R61 A;  1WFY A;  1JWB D;  1YQB A;  3N1X C;  4JIO U;  3ZKJ C;  4GDL A;  4J6I A;  1NYR A;  3NVW A;  4GN1 A;  3OLM D;  1TTN A;  3DHG C;  4ZYS A;  3WAN A;  2H89 B;  1SE9 A;  3IAS 1;  2N4F A;  4CQN A;  2WLB A;  4M00 A;  4WWN A;  3TUO A;  4ANW A;  3L13 A;  2INP E;  4G50 A;  1TS3 A;  4DHZ E;  2FBW B;  1Q5W B;  1K52 A;  3GOE A;  3R8B A;  2GWD A;  1R8G A;  4HEA 1;  4IG7 B;  4GSW A;  1K53 A;  2AEH A;  2DAJ A;  5CHW A;  2RGF A;  3R7R A;  2CJN A;  5E6P A;  4UDU C;  2RSU A;  2EKE C;  2HD5 B;  1UBI A;  2QIE B;  4KSK C;  1YOV B;  4YTN B;  3Q8B A;  2ZW0 A;  3NZU A;  4ZHP A;  1MHX A;  3MFG A;  4C7Z A;  5BYR A;  1QQR A;  3D32 A;  4XE0 A;  5HI1 A;  1GC7 A;  2KX0 A;  3DBH I;  4YSZ B;  1WJ6 A;  3X23 A;  2QEJ C;  1JRP A;  3RD2 A;  4AQ7 A;  2D07 B;  4FXC A;  2C5L C;  5H92 C;  1J0G A;  1ZE3 D;  2BVC A;  1HA5 A;  2WXI A;  2HDE A;  3QWZ B;  4HJG E;  4RF9 A;  4XYC A;  4MEL A;  1C3T A;  2EEL A;  3MP9 A;  4RH6 A;  4ZOH C;  2K5P A;  2D3C A;  3RYT A;  3GE3 C;  3L0W B;  3IAM 1;  3MHZ A;  5JHB A;  2FID A;  2N9X A;  3RNE C;  1IP9 A;  1WX8 A;  2IND C;  3JSV B;  3L54 A;  1JML A;  5JH5 C;  3A1Q B;  2LGI A;  2O2V A;  3U4E G;  2LVP A;  1V80 A;  1WGH A;  2PPH A;  2BYV E;  3RUI B;  3EGR A;  1ZKH A;  4LNI A;  2L00 B;  2LD9 A;  3HVD A;  3R7Q A;  4ZHO A;  4PS7 A;  1QKZ A;  1QF6 A;  4IM0 A;  1MVK A;  5EE9 A;  1SIJ A;  4E71 A;  1QOB A;  3TEZ A;  2KJR A;  1DYQ A;  4NJ7 A;  4OZB A;  2J0K A;  4MAC A;  1SEB D;  4MJS B;  5D94 A;  2KFK B;  2C7M B;  2R2Q A;  2IPK D;  3B0A A;  4F8C B;  4DWF A;  3WIM A;  1MPE A;  4JWU C;  3B6R A;  1NYQ A;  2V3N A;  1AYF A;  3T9L A;  2BB6 A;  2DEN B;  1WXM A;  2B76 B;  2M8S A;  1P7F A;  1ZOY B;  4M02 A;  4MM3 B;  2HJ1 A;  2MEK A;  5LNK 1;  3W2D A;  1TIF A;  4P7I A;  4FJV B;  1VRA B;  3H7S A;  1UH6 A;  2KWU B;  3GZN B;  3A9J A;  2RPV A;  2JUO A;  2KLG A;  1JWM D;  3B1L X;  2Y5C A;  3VFK A;  1NEK B;  3FKY A;  2MP2 B;  4RGT A;  4OZC A;  2BT6 A;  1KM7 A;  3QAR A;  3OAW A;  2Y5P A;  3CF6 E;  3IXS A;  2JRI B;  5BMG A;  4XDC A;  2YLM A;  2DHZ A;  1I0E A;  3TSS A;  4X57 B;  2LEK A;  2DZK A;  4TUU A;  3VH4 B;  2KDI A;  3GB1 A;  3Q3M C;  4OHJ A;  2YEP B;  1I4Q A;  4W9I A;  2W55 A;  4A3P A;  2JZP A;  2V4I B;  1K51 A;  3NZ3 A;  3AH7 A;  5BMH A;  4MJS A;  2KFK A;  3HIZ A;  2KN5 A;  2BS3 B;  1ET6 A;  1VZ6 A;  1D3Z A;  5EE3 A;  5J18 A;  1C77 A;  2V3S A;  1WJN A;  4WJN A;  1WSP A;  4RFB A;  1LQB A;  1YNT E;  2VZK D;  2K3U A;  3PRM B;  2MBQ A;  1WGK A;  3DRB A;  2OJW A;  4MM3 A;  3R2T A;  2MA9 B;  4URK A;  2M0X A;  4LTU A;  3P2B A;  2BQQ A;  3TEW A;  2WXL A;  1F2R C;  1GG3 A;  2WXJ A;  3R66 C;  4DHJ D;  2MP2 A;  2CHX A;  1N60 A;  3ZNG C;  3PRZ A;  2KFJ A;  3FAH A;  3QC8 B;  1IGC A;  4K7U A;  4BVU C;  1JWS D;  1J19 A;  1F0Z A;  4R3D A;  2IYD B;  2IJ0 A;  2DZJ A;  1GB1 A;  4WWP A;  3AE1 B;  3PGE A;  4LK0 M;  3KQ4 A;  1EU4 A;  5LXH A;  1VCB A;  2WHI A;  2A5U A;  3NS8 A;  2KMM A;  3ZGZ A;  1XQQ A;  5KHQ A;  3AED B;  4KV2 A;  1V49 A;  3V61 A;  2NTT A;  3W1Y A;  2QJL A;  5AZF A;  2CJO A;  4DXG A;  2WXR A;  3IFW B;  1C79 A;  1RFA A;  2L1A A;  1FNV A;  4OVU A;  2IGH A;  3DBS A;  4W9J A;  1P7E A;  4WAA A;  2UU7 A;  1HZ5 A;  3EFC A;  2C60 A;  3JVZ X;  4US8 A;  4D2K A;  1Q1O A;  5G5H A;  3ZRF A;  2MJE A;  2KAC A;  1J7A A;  4GDK B;  5CHV C;  2BKR B;  3NJT A;  4XWW A;  1JW9 D;  3ZW3 A;  1SXT A;  4ANX A;  2EMT A;  4PYZ A;  2N7D A;  1SGH A;  2K22 A;  2LMC A;  4K81 A;  2MJ3 A;  3RPF C;  4IC7 B;  2VH1 A;  3PHW B;  1M15 A;  5IAA C;  3KYD D;  4US9 A;  5AUK A;  1KRH A;  1WXA A;  3SU8 X;  1X1M A;  1Q10 A;  3GE8 C;  4KVG B;  3AU4 A;  4BOZ B;  2QDF A;  3CSF A;  1MHH E;  1STE A;  1H4R A;  4L1B A;  4BBN F;  2JYE A;  3RMK C;  3K9O B;  1HQR D;  2MBB B;  2KXJ A;  2KWD A;  1BML C;  5J17 A;  3KH0 A;  4IM3 A;  4PS3 A;  1GPX A;  1LFD A;  2BWF A;  1XF5 L;  2LGS A;  5DPW A;  5JXV A;  1V1O A;  3DOW A;  3Q3F A;  3AEG B;  2GBN A;  4WWM A;  2LJI A;  3V3X A;  4HDQ A;  2WP9 B;  1TY2 A;  2K8B A;  3AE6 B;  1J7C A;  1T0Q C;  1SE4 A;  2J0J A;  4JQW C;  4ITK A;  4N6E B;  1J7B A;  2KDB A;  4RGM A;  1YX5 B;  4XWT A;  3ZNH B;  3RNG C;  4FA6 A;  4BG4 B;  2GBK A;  3W1S C;  3EUB 2;  1RRB A;  3HK0 A;  2BYT A;  2NCN A;  2PKO A;  3ENE A;  3RFZ B;  2JT4 B;  3MC8 A;  4I6P A;  1FFV A;  2DAF A;  4KGT A;  4P1C C;  3IVF A;  2KTF A;  2AYO B;  1MG4 A;  2FCS A;  2IO0 B;  5H8Y E;  4DK5 A;  2L7R A;  4GDK A;  3AV8 A;  2ZPN A;  2L8J A;  3DBL B;  4IDI A;  4EUT A;  2LUE A;  4FN2 A;  1CJE A;  4WQO B;  1NDD A;  3JYU A;  4IW0 A;  2Q5W D;  2AX5 A;  4ZRQ A;  2ON8 A;  2KYW A;  3A4S C;  2LUM A;  3AXC A;  2WXK A;  2PE9 A;  5FKA C;  5BYS A;  3AE5 B;  4DQO C;  2BB5 A;  3QK0 A;  3JW0 X;  4HWI B;  1WX9 A;  1XLQ A;  2H88 B;  2MX2 A;  4K3B A;  1F2R I;  2KJH B;  1LO5 D;  4MDK E;  2DWQ A;  3T3N A;  1FXI A;  1XEE A;  2L05 A;  3AEF B;  1LM8 B;  1E6E B;  1FXA A;  1V9J A;  4YL8 A;  1UNS A;  1TZ1 A;  1QOF A;  1TGZ B;  4OW0 A;  1VJK A;  4YT0 B;  2LWP A;  2B3A A;  4LNO A;  3L08 A;  2KK8 A;  5I4D A;  1YIW A;  3RN9 C;  4HVB A;  4MGY E;  3T3O A;  1I4X A;  3ZJV A;  1TKE A;  3HHM A;  4FBJ B;  3ZRC A;  1B9R A;  3TBL D;  4BG4 A;  2ICI A;  1XCT L;  2CRK A;  2LXC A;  3J9C A;  4KKI A;  4LDT B;  4GOC A;  1RL9 A;  2G3Q B;  3C19 A;  3PZD A;  3ML9 A;  2DZI A;  1K8R B;  1OTR B;  2HTH A;  3LXF A;  2LVO A;  3B2F A;  2I1K A;  5J2R A;  2MSE D;  3B9J A;  2BWE S;  3UIO B;  1WXQ A;  3RI7 C;  1M4V A;  4K7W A;  1WR1 A;  1RYJ A;  2CHZ A;  5E6J A;  2L83 A;  5AEK B;  3PS6 A;  2I1J A;  1L0X B;  3PHX B;  1MI0 A;  3AM9 A;  4JPS A;  4USA A;  3ZJU A;  1YJ1 A;  2ZCB A;  4C7Y A;  2E6X A;  1I4G A;  3HUI A;  2K9X A;  4II2 B;  5J99 A;  3V6C B;  2FIF A;  1IPG A;  2GBR A;  1VZ7 A;  5FR6 A;  1WIA A;  2QIL A;  3ML8 A;  2BGF A;  3BIN A;  1PFD A;  2DYM A; 
#chains in the Genus database with same CATH homology
 3JU5 A;  2CRK A;  3M10 A;  4GVY A;  1U6R A;  3FKY A;  2D3C A;  1RL9 A;  1FPY A;  3L2E B;  3ZXR A;  1VRP A;  4RF6 A;  1LGR A;  3DRE A;  2WHI A;  4LNN A;  1CRK A;  4GVZ A;  4AM1 A;  3JQ3 A;  4LNI A;  3DRB A;  3L2E A;  4HPP A;  4LNO A;  4Q2R A;  4BHL A;  5J9A A;  4GW2 A;  1P50 A;  2BVC A;  2UU7 A;  1G0W A;  2OJW A;  4LNK A;  5J99 A;  4ACF A;  1M15 A;  4RF8 A;  1HTO A;  3NG0 A;  4S17 A;  4BAX A;  1F1H A;  1QH4 A;  3B6R A;  3L2D A;  4GW0 A;  4LNF A;  1BG0 A;  1F52 A;  3ZXV A;  2LGS A;  1P52 A;  3JU6 A;  4RF7 A;  2D3A A;  4S0R A;  1I0E A;  4BG4 B;  3JPZ A;  4RF9 A;  2WGS A;  4XYC A;  2QC8 A;  1QK1 A;  2GLS A;  1SD0 A;  4BG4 A;  4Z9M A;  1HTQ A;  2D3B A;  2J1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...