3FKYA

Crystal structure of the glutamine synthetase gln1deltan18 from the yeast saccharomyces cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
346
structure length
336
Chain Sequence
RGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPLKGDWNGAGCHANVSTKEMRQPGGTKYIEQAIEKLSKRHAEHIKLYGSDNDMRSMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNADMTKEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structure of Saccharomyces cerevisiae glutamine synthetase Gln1 suggests a nanotube-like supramolecular assembly
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 98
structure length 336
sequence length 346
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3fkyA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 3fkyA02
2WGSA 4ACFA 4LNKA 2GLSA 1F52A 1LGRA 2BVCA 3FKYA 2D3CA 4LNOA 1FPYA 4LNNA 4S17A 1HTQA 2OJWA 4LNFA 3ZXRA 2D3AA 2D3BA 2LGSA 4LNIA 4XYCA 1HTOA 4S0RA 4HPPA 2UU7A 1F1HA 2WHIA 3NG0A 4BAXA 2QC8A 3ZXVA
chains in the Genus database with same CATH superfamily
1EWCA 1J19A 1L4ZB 4LCDE 5TR5A 1RL9A 3QHTA 1TBEA 2KANA 3M95A 4ZRJA 5D7GA 1I35A 2FUHB 2IGGA 4FHKA 3TMPB 4KVGB 3BY4B 4G50A 4FJZA 4W9CA 2LGYA 1MJDA 3KUDB 3E56A 3TCAA 3AMZA 2WNMA 4NAWA 2L0TA 1F77A 3WALA 4XZ4A 1EUVB 4MH0E 3AH7A 1QZEA 4LLGM 3TEXA 2J42A 3EUB2 1V9JA 1FXTB 1IBXA 3ZUNA 1R4MI 1JRUA 1C3TA 2GBRA 5KHQA 2INPE 4GB9A 2ZNVB 2MBEA 4ASWC 4KGTA 4BOZB 4HROA 1G0WA 4US8A 2WLBA 2Z0DB 4HDOA 1P3QU 2PE6B 1VDVA 3I3TB 1TT4A 1DYQA 1WM2A 4KIKB 1GC6A 4I6NB 1VR9A 5D94A 3EA6A 5JHAA 1DOXA 1VRAB 3HRDD 2WYQA 3T3NA 2EELA 1SD0A 3BWUD 2FE8A 2R2OA 4AOFA 3U2SC 3VTVA 3PV1A 3GS2A 4E3CA 1C77A 4DXAB 3B6RA 1U4AA 1M4VA 2MBBB 4HEA1 2G9HD 4ZDVA 4S0RA 2EMSA 1ZKHA 5HFYA 1BT0A 2RDHA 2J0MA 3QX1A 3FILB 5FR3A 1Y56A 2HDEA 2MP2B 3DBRI 2N4FA 4JWSC 4LDTB 2O6VD 4Q2JA 2VH2A 1SGHA 1YJ1A 1E7VA 2BS2B 2VZKD 4A55A 2BF8B 2DHZA 2WU5B 4RGNA 3W5UB 4KSLC 3U4EG 3ECIA 4LJPB 3LYYA 1CZPA 2Z0EB 4LNNA 4GVZA 3GZNI 1WJ6A 2LUEA 2D32A 2G1EA 4M00A 1ZW7A 2OOBB 4ZHOA 4K7WA 4AWJA 1JW9D 1SBBB 1WGHA 1AARA 2Y5BB 3UI3A 2PTLA 3AE5B 1P7FA 3K9PB 1AW7A 1BXTA 3VR9B 3A9KA 3H9DA 1WYWB 4HCNB 2PKOA 1VZ8A 3RI7C 2A4ZA 2B76B 2WU2B 4YTPB 2KVZA 3JW0X 2EMTA 2KDMA 1SSNA 1WFYA 2PJHA 3BK2A 2Q5WD 1VCBA 2OHFA 3DWGC 3R7QA 2FCSA 4EUTA 3I63C 1GG3A 3RT3B 2KLCA 2MJDA 4XX5A 1M15A 2I38A 2GWDA 3PZ8A 2MJEA 2REXA 4FBJB 2PPHA 5KHOA 2L7RA 3SFEB 2D07B 3HUIA 1WR6E 4YT0B 4P16A 2BYEA 2V3PA 1Q5WB 2DZKA 3JPZA 2M0AA 3X0WA 3RNEC 2AYOB 2KXJA 2ZPNA 2C7NB 3DQVA 4XDDA 3CIRB 4W9LA 2IO3B 1V97A 5G5HA 1IPGA 4KZ0A 1G6JA 4PS8A 2KTRA 2K5PA 5BYSA 1KM7A 1C76A 2DNFA 3JSVA 1FCLA 5FKAC 3Q69A 2I1KA 1WXQA 2MX2A 4FJYA 1GB4A 4M8MA 4W9JA 1FXAA 4AP4C 3H7PB 2IO1B 1V1OA 4GXBA 4EZJA 1RFKA 3BVMA 1EF1A 3AEEB 2WQYB 1WR1A 1E8ZA 4L2YA 3PHXB 1FEHA 4GDLB 4HCPB 2O2VA 4PS7A 1IBXB 2JYEA 1Z5SB 1V80A 2BTEA 2FCQA 2ZEQA 4NJ7A 1NYRA 4ARCA 4XYCA 3GE3C 1MI0A 3RNGC 2M4NA 4J6IA 2KFKB 2MLBA 3W1SA 2WXLA 2PLPA 2K0PA 2L00B 3PT2B 1SF0A 2KQ7A 1ESFA 3KVFB 3MHSD 3NRZA 3OLMD 3Q8EA 4WJPA 3DBLB 5AEKB 1UGJA 4OVUA 3NZUA 4HJGE 4LTUA 4URKA 1UWXA 3Q2AC 1EO6A 1D3ZA 1TY0A 1YJJA 4P1BC 2JZPA 2LZ6A 2N9EB 4GW0A 5E6PA 1TS2A 2KOXA 4GMVA 3NZ3A 4ZRPA 3U7DA 3CSTA 1LM8B 3VR8B 4M0WA 3L2EA 1MHXA 1E10A 5IKCM 1CK1A 3QJZA 2IGDA 2CR5A 3OJ3A 4RM9A 2GMIC 3AULA 2ICIA 4K7SA 1MG8A 2KYWA 3PZ7A 2LXCA 5C23A 2N9PC 3L16A 3AE7B 3Q8BA 3NVZA 1WX9A 2BPSA 4K3CA 3UGBB 1N60A 4HKZE 3TEZA 3RPFC 1CMXB 2MHJA 2JX5A 2AWTA 4B0EA 4N58A 4KGRA 4R3DA 1L7YA 1Q0WB 3N20C 2G4SA 2DX5B 4A3OA 1UNSA 2KWUB 3RNFC 1UD7A 3B2FA 4BG4B 1I4RA 1WJNA 3NUHB 5FK9C 3HVDA 3Q8FA 2MQJA 1EWYC 2JSVX 3ZJUA 1QQRA 4B0MA 3L10B 4KKIA 3C0RB 2PIAA 2RDBC 1N6ZA 3Q8CA 3DRBA 2H88B 4MDKE 3UINB 2JXTA 1I4GA 1HE8A 3IVFA 1LFDA 2CHXA 3MFGA 3AU4A 3NS1A 1QKZA 5IP4D 4YSZB 3Q6BA 1E8YA 3AE8B 4DXFA 3M63B 4FULA 3ZYYX 1TS3A 1SE3A 3HK0A 2V3SA 1UWMA 3AE3B 3FILA 3ZGZA 1T3QA 4IWPA 2KJ6A 3MC9A 2MP2A 3BINA 1BMLC 3QK0A 4C7YA 2V4IB 2V1YA 1TYGB 2Y3AA 4XE0A 1MG4A 1FNUA 2CRKA 2JVCA 3AEBB 1JWMD 3A1QA 1QILA 3RZFA 2N9LA 2DZMA 3RCZA 2YVCA 4RF1A 1C9FA 3PLUA 4PYUA 3L0WB 5DPRA 2NMQA 3ZNGC 2WDTB 3ZRCA 3OWEB 1ZDVA 2LJIA 3LJ3A 3VTUA 2NBWB 1JRPA 1TZOA 3VHTC 3R2TA 3W5VB 3Q3JA 1P9DU 3PPAA 1H4RA 2NVUI 1AWDA 1JCKB 3RULA 4RFBA 3KUZA 3QIJA 1YQBA 3L17A 2KZRA 1Y8RC 4YTNB 1T0YA 3RFZB 3WCQA 3HM6X 3KYCD 2Y5PA 2WWZA 1Q1OA 1VZ6A 4GIVA 3ZO5B 3V6CB 1FFUA 1F52A 1MFWA 3VRAB 4OW0A 2MSED 3VUWA 1STEA 2NBVB 3KWVA 4RNAA 2RSUA 3N30A 4A3PA 1YN5A 4JE3B 4KX6B 3AE2B 4IWQA 2FCMA 1TZ1A 3ML8A 3GOEA 2MCNB 4B6WA 4YSXB 4BFRA 3AE1B 3ZNID 2KX0A 1P7EA 2FIFA 2D3CA 2BBCA 3MHZA 4GVYA 1OGWA 3AXCA 2XK5B 2PMVA 2WXRA 1R4NB 2L1AA 2D3BA 1D5XC 4GDKB 4KDLB 1D4BA 2KX3A 4DHJD 2UU7A 3P4SB 1XLNA 3ZDMC 3V6EB 3VDZA 4ICVA 4A20A 2KNBA 4BVUC 3N3KB 2IDYA 2C7HA 1YN3A 1A5RA 3BIID 4EE2A 1CRKA 1SIFA 1E0ZA 4JX1C 4FHJA 3AEAB 3ZDTA 3IHPC 5BMGA 2IY1B 2JPHA 2HD5B 3L4PA 3NZTA 3P42A 1HA5A 1GPXA 4BKTA 5GMVA 2DZJA 1JWBD 2EKIA 1NVID 1GNUA 1YD8U 2RGFA 5H92C 3ZLZA 3SHQA 4II3B 3H7PA 3V3XA 1SXTA 3VUYA 1KFYB 1A70A 1TGZB 2BB5A 3DPDA 1K8RB 4ANVA 4M01A 4G3XB 4ZRKA 2VRRB 1ENFA 4GDLA 1EF5A 3RNCC 4RF6A 2L52A 1T5XD 4M0WB 3WIMA 1KLUD 2K22A 1L0XB 3L2EB 2QC8A 2JZZA 3OJ4B 4BBNF 1HZ6A 4ARIA 1F0ZA 1SB3C 2K8BA 1YOVB 2LEKA 1Q10A 1KJTA 2KFKA 2IPKD 5G5GA 3B2GA 4FLHA 1I4PA 4XDCA 2KWDA 1J7BA 2K1FA 1AYFA 3L54A 4GGQA 3QQ8B 5J2RA 2SEBD 4RF9A 1WXSA 2BWFA 5J9AA 4C00A 3O13A 2LHEA 1PDXA 3IFWB 3VVWB 3KYDD 1TJEA 3DOWA 2YLMA 2LVPA 2BKRB 5GXGB 2KMCA 5C2TB 2AQ1B 2C7MB 1FIQA 3L08A 1IUEA 3APDA 1WY8A 1GAQB 2KO3A 1NI3A 2R61A 4MJSB 1WIAA 1R4MB 2ZVOA 2J0KA 2LGDA 2NBUA 4CQNA 1L0YB 3RMKC 2WX0A 1I42A 1PYWD 1V4GA 4IW0A 4D2KA 3H8HA 3Q3NC 3FAHA 2J7QB 1QOGA 2W82A 2Z8LA 3ZKJC 2DLBA 3AECB 5AUKA 1RRBA 2BS3B 1GC7A 4DWFA 1T6BX 5LNK1 2D5GA 3R66C 1XLPA 5DPWA 4MACA 1H8CA 3EFCA 5LXHA 4BG4A 3PS6A 2KDFB 3KUCB 1YJIA 2K8HA 2KACA 2MW5A 4MT5A 3SDLC 4ITKA 2HJ8A 1WM3A 4A6QA 3A1QB 3AEFB 4BOSC 2QMTA 3VAWA 2DYOA 1V5TA 4JL9A 3VH3B 4TV3A 2WS3B 3ABVB 4YTMB 4IKGA 3UQAA 1HQRD 5BO4B 1S1QB 3SFDB 4MELA 2V9HA 4BBNC 1FMAD 4PT5A 4JWUC 3R7RA 3C19A 2INCC 3WANA 2D2QA 1XXGA 1YQ4B 2XN9C 4RGTA 4RGOS 4LNKA 1YQ3B 3IG8A 2MBOA 2FBWB 3AEDB 1WJ4A 2DBYA 2BYFA 4WWMA 3AI5A 2PVGC 3RZWC 3NVVA 3DBRB 3ZXRA 1J7AA 2NPTB 2JYTA 2YEPF 1QOBA 3TBLD 4IC7B 4ZRQA 1WE6A 1DOYA 1WWTA 5DPTA 5HKHA 2ZPYA 1F2RI 3MJ5A 1JWSD 4REZA 1F2RC 2ZZPB 3J9CA 3MP9A 4C4VB 2M0XA 1GOZA 1TY2A 3GZNB 1C4AA 5JZEB 1OEYJ 3KW5B 1TS4A 3RNAC 3DDCB 2D10A 2L32A 1TIFA 1LGRA 1K50A 2M17A 1E90A 2LMCA 4RCOA 4TUUA 2ZW0A 4HJKA 3U8ZA 2LHDA 2BQQA 3IAM1 1XCTL 2WXIA 2LVOA 3LVVA 3QA8A 4WJNA 2ZVNA 4JQWC 3AE9B 2PE9A 3VTWA 3WAMA 2M19A 4WH4A 2RR9A 4W9FA 3TUOA 4KZCA 5HHDG 2GRIA 1C79A 4LK0M 1XLOA 1UUPA 4I6LB 2ZCBA 1FXIA 3P1MA 4LNIA 1R7SA 2CS4A 3Q3MC 1N5WA 2JQRB 5JXVA 2IZVB 2X38A 3EC8A 4WAFA 2CJOA 2ACZB 1ISNA 1U6RA 2XK5A 4N9F4 4AM1A 4YXDB 3ALBA 1N63A 4GDKA 3W1YA 2GBMA 3BK1A 3KQ4A 4XC2A 2QEJC 4MEMA 4ANWA 3E9SA 3KWLA 2RD0A 2JF5A 4IOIE 1KF6B 2KMAA 4TQ0A 4XGAB 1I7HA 1D5ZC 4E71A 1UH6A 4ACFA 4YWGG 3LB8C 4ZYSA 4II2B 3AEGB 2N1WA 1WI0A 1NBFC 1FD6A 4LDTD 5C1ZA 2N9KA 5MPOA 2WXQA 4WWPA 3U7ZA 3NVYA 1KLGD 2MH7A 1PGAA 4USAA 2ZCCA 4B9KA 4HK2A 3AM9A 3BYYB 1WGDA 1PFDA 5E6OA 1OQQA 1FPYA 1RWSA 1X1MA 3DVNV 1CJEA 4RF7A 4K1RB 2WP9B 4IM3A 1ZXIA 4AJYB 4GW2A 2JWZA 2V4LA 5EE9A 2LRUA 2BGFA 5T8IA 1P0RA 1OQRA 1V49A 4WWOA 4OVZA 4G0NB 3ZNZB 1KOTA 1RM6C 3U30A 4ZHPA 1FNVA 4DXGA 2KK8A 2J4XA 2KT7A 2PW9A 2JUOA 1V5OA 4YL8A 1WXVA 3T9LA 2WXJA 4X57B 4W9DA 5JHBA 1B1ZA 1UZXB 4JGHB 1L4DB 1E5WA 4E74A 4J3OD 2CU3A 3CSFA 4OZCA 3PRPB 3ZIMA 1CQVA 5LXIB 1J0GA 1V6EA 1VZ7A 4GN1A 1WZ3A 3B0AA 2XBBC 3TSSA 1TS5A 1WE7A 1M94A 3IT6B 2WDVB 1ZUD2 2KFJA 5LLIA 4I6PA 4L23A 5IO9A 1ACCA 1FNWA 1ET6A 4MJSA 4IUMB 4ZRIA 3EGRA 3VFKA 2OEDA 4B95A 1QOFA 2KMMA 4KSKC 3I57A 1ROEA 4GOCA 1VA6A 4HDQA 3VUXA 2BW2A 1B9RA 4W9IA 3V05A 2FAZA 1I4QA 3URYA 3N1YC 4AQ7A 4A9AA 2HTME 3P4PB 2K6DB 1XF5L 2SAKA 2DWQA 4DHZB 2EKEC 1LO5D 4RMAA 1L2NA 5BMIA 3QC8B 4HXDA 4TMAB 3SR6A 2VH1A 2LJ5A 4BKSD 2IO0B 2KD0A 5AZFA 3IAS1 1WJUA 2CHWA 1IP9A 4EOYA 1BG0A 1P98A 1WSPA 3RYTA 2HJ1A 4RM8A 2L8JA 4FJVB 4BZAA 2NS5A 2V0GA 3NOBA 1ZP0B 2N7EA 1BUIC 4Q2RA 4DK5A 2HE7A 3ZXVA 4FN2A 1T0RC 1SIJA 2DAFA 4LJOB 3MTNB 4UDUC 3DCGA 4RF0A 1E8XA 4F8CB 1DOIA 3N9YC 4LNFA 1N62A 1SE9A 1Z2MA 2CKHB 2LGXA 4H2AA 1RAXA 3DWMA 4KV2A 3Q14C 2GOWA 2KHWB 1EU4A 4WURA 4EZLA 3UIPB 1E9MA 3DHHC 2ZW1A 3IT4B 4A90A 1SJED 2UYZB 3CMMB 3R2IA 2MWSB 4IM0A 2M56B 2NPTA 2BB6A 3X23A 1OFFA 2G45B 4MM3B 2D33A 1ET9A 1NDDA 2UWQA 4NQLB 2L83A 3HIZA 1OQYA 1UBIA 2LVQA 2O6VB 4C56C 2KC1A 1QLBB 1VLBA 2Y5CA 1V1PA 5HI1A 2VZKB 4C4VA 3DBSA 2M8SA 4F1SA 4NQKE 3APFA 2IJ0A 1E7UA 4CYEA 3N32A 4NPNA 2AL6A 4OZBA 4MH8A 3MC0B 2JXXA 3AE6B 2WXKA 3PRMB 4K7UA 4DQOC 3KH0A 1J8CA 2W3RA 3IG3A 5JH5C 3P4RB 3A4RA 1FRRA 1TKYA 3BVZA 4TQ1A 2GWCA 1E7PB 5H8YE 3TIXA 2MJ3A 2N7JA 1T0SC 2LRWA 2LUMA 5BYRA 4BKSA 2JRHA 5E6JA 5D3DA 2HTHA 1XQQA 3ZJVA 3PHWB 3OAWA 2PVOD 1C1YB 5J17A 3PREA 4NJCA 2H89B 1HZ5A 2X8XX 1WXAA 3ZJTA 2OJRA 5IN7A 3SU8X 3SEBA 5L95C 5J99A 4W9HA 2ZNVC 1WX8A 5BMHA 2K25A 1K53A 4WWNA 1D5MC 3S2AA 4MGKE 4WIPA 2MBQA 2J0JA 3DHIC 1XEEA 1VD2A 3ETRA 4W9KA 3NJTA 4BAXA 5FR6A 4GSWA 3ZTCA 1PQSA 1KH0A 2D3GA 2QILA 2KWCA 3FC4A 3SD5A 5C3JB 2QJLA 1KTKA 5EE0A 3AB5A 4WQOB 3TJPA 1PUTA 3D32A 4US9A 1P1AA 4TKNA 3PSEB 2AEHA 2NR2A 2V3NA 2WHIA 5E6NA 5EDSA 4RF8A 5L83A 3JVZX 4OZAA 4GU2A 1QK1A 3A9JB 2AQ3B 1SE2A 1WGKA 1TKGA 5AZHA 3V61A 5I4DA 2N1VA 1JROA 2KN4A 2LFIA 2QSDA 1ZOYB 3V60A 1VJKA 2KQ4X 5G2NA 5AZGA 1SEBD 4N6EB 1UBQA 3HVZA 1HTOA 4K3BA 3ZQ4A 4JLCA 2KQSA 2AL3A 2W9NA 3WAOA 4A8XC 3U52E 2WXFA 3AV8A 3UIOB 2K8CA 1R8GA 2GBJA 2LXAA 3NVWA 1GUAB 1T0QC 1E8WA 4YSYB 3BYTB 4WJOA 2N7DA 1NYQA 3NZSA 2LD9A 5G55A 4CO7A 2K39A 4DHZE 1N5XA 3NY5A 2AQ2B 2KDEB 2K6QA 2E3TA 1AN8A 1YIWA 3VXWA 1TTNA 1P50A 3DVNU 3I9V1 1YMHE 2WXPA 2GLSA 2K9XA 2WXNA 1ZE3D 5D2MB 4GLSC 2L0FA 4WAAA 1IYFA 3Q3OC 5CHWA 4KDIC 2BWES 4QAYA 4MSQB 4HPPA 1ZDXA 4M02A 1WGYA 1JWUD 5CX3A 3PGEA 2JY6A 1P52A 2CJNA 5HG2A 2WDRB 2MA9B 2L3ZA 1E6EB 2KDBA 5CHVC 4XWTA 2KTFA 1PGBA 1WF9A 2NTTA 1UF0A 4PS3A 2KJRA 1QF6A 1J7CA 2M1MA 1JQ4A 1LQBA 3T8MA 5EE3A 1FM0D 3HHMA 2D11A 1YX5B 2KWVB 2DZIA 1I4HA 1OEYA 4HKQA 2ASQA 2AX5A 3A4SC 2GBNA 2FUG1 2QDFA 4EKUA 5DCNA 3PRZA 2LGIA 3ZRFA 3NG0A 4C7ZA 1L0VB 1I4XA 1I0EA 2GB1A 2R2QA 1YNTE 2BVCA 1RYJA 2IBIB 5D3IB 2BKFA 3PVLA 4HWIB 2KAJA 3N1XC 2A5UA 1S3SG 2D3AA 3QAQA 4M8NA 1V1PB 4RH6A 1RFAA 1JMLA 4TSSA 2MRPA 1UELA 2QHOA 3HM3A 4PYZA 2W54A 2NCNA 2RPVA 3DBHI 3H1UA 2LASA 1WGRA 3L2DA 2NTSA 1IGCA 1WRDB 4ZOHC 4ANUA 4AUQC 3R8BA 4KGSA 1VRPA 2WDQB 4RGMA 1WGGA 3PTFC 1L5PA 1WMHB 2E6XA 1FRDA 1V86A 4IWOA 2L76A 3IXSA 2KC2A 3EFUA 3W2DA 4PK1A 1V2YA 3CWIA 1HEZE 3GE8C 3Q8AA 2WXGA 1RLFA 4MM3A 3JYUA 1XO3A 3FKYA 3P4QB 4NY0A 4L1BA 3DVGY 4S17A 2JRIB 2O6VA 3M3JA 2B3AA 3V62A 4JIOU 4ICUA 2IY0B 3PO0A 4CHKA 2KN5A 3M10A 1F9JA 3DBLI 4G11A 1V81A 2L05A 5BYQA 3ONSA 3RN9C 3DBHB 5EE1A 3UF8A 1QOAA 4FA6A 1EM7A 2BYVE 4KKJA 1QT9A 2RDGA 3CF6E 2LGSA 4NAWB 1C78A 2LI5A 2JZ3B 3H7SA 1JWAD 1PGXA 2ONQA 3PZDA 3ML9A 1WZ0A 3TEYA 4MGYE 3O65B 1V8CA 3NS8A 2KLGA 2DYBA 5D6JB 2TSSA 2FCNA 1FO4A 3LVWA 1NEKB 4N59A 3W9CB 3ZVVA 4HRSA 3RUIB 1WH3A 3DHGC 2RPQA 4AJWA 3IG5A 1EU3A 4HVBA 3AE4B 2K3UA 1FCCC 2INDC 3P63A 4ANXA 2MEKA 1XLQA 1OTRB 3LN6A 5CTRC 3RD2A 4IG7B 2JU6X 3L13A 1SE4A 1HTQA 2IGHA 1WRIA 4IDIA 1FFVA 2PEAA 3AN1A 4NAMA 4MGZE 3KLSX 3EHVA 2DENB 4MSMB 3GB1A 5AUIA 2WXHA 2ON8A 2G4DB 2BT6A 2N9XA 2KKCA 3VH4B 2I1JA 4FADA 4DDID 4LNOA 4DHJB 3VRBB 3DREA 3A9JA 2QIEB 2FNJB 1TKEA 2KJHB 2YEPB 2BYTA 2W55A 2LWPA 3NHEB 1YN4A 2JWUA 1L6UA 3C8YA 3K9OB 2INNE 3AU5A 3RNBC 1D6EC 3BVGA 3MJWA 4AS1A 5IAAC 1XD3B 3WA0A 1L6VA 4KIKA 4HPLB 4WQMA 1JALA 3BZDB 1K52A 2J53A 4EEWA 1ZPSA 1XT9B 3Q3FA 3ZW3A 3MC8A 2WXOA 1K51A 3UQBA 4NJ6A 3JU5A 3JU6A 2OJWA 3JQ3A 3TL5A 1GB1A 3EECA 2C60A 4FXCA 1ZXHA 3A33B 3PLVA 2BS4B 1HXYD 2J1QA 2JT4B 3WAPA 3B08A 4P6VF 1MPEA 1MHHE 3GP7A 4W9GA 4BKGA 3QCAA 3VQIA 2QCZA 4NNJB 4Z9MA 3IBEA 1ZGUB 4HPMB 3A9KB 3P2BA 3H6NA 3LN7A 2DAJA 1IGDA 2KDIA 1QH4A 5CHFA 2ZJDA 1XCQL 2IYDB 4ZYNA 1NENB 4BHLA 2C9WB 1KRHA 3QARA 5IA7A 1MVKA 4WJQA 1SJHD 5DPSA 4EFOA 1UGMA 2GBKA 4P1CC 3TEWA 2KVRA 2XNAC 1NI2A 3ENEA 4F7ZA 5J18A 2WGSA 4JPSA 1N61A 4K81A 1R4NI 2W3SA 4DDGD 1C4CA 3APCA 2Z59B 2CU1A 4EZKA 4C80A 2J52A 4XWWA 3LXFA 4MGIE 1WYGA 2N0SB 4NZLB 4DBGA 2GI9A 2DYMA 1LXDA 5TSSA 3DVGX 3N1ZC 1YX6B 3T3OA 2XEWA 3W1SC 3ZTDA 2KTRB 1GJZA 3M62B 3LDZE 2I2YA 1KLVA 1WX7A 3JSVB 1TT5B 3QWZB 2CHZA 1F1HA 1C4PA 2FIDA 2C5LC 4W9EA 3I5JC 1WMHA 3B9JA 3OG5A 5IOIA 4OHJA 2G3QB 2MBHA 4HLEA 1DGJA 3R3MA 2IO2B 4O1NA 4IM2A 3ZNHB 2O2VB 2WX1A 4P7IA 2WXMA 4OVVA 3B1LX 2RMMA 1WXMA
chains in the Genus database with same CATH topology
2WGSA 4ACFA 2GWCA 4LNKA 2GLSA 1F52A 1R8GA 1LGRA 1VA6A 3IG8A 3LN6A 2BVCA 3FKYA 2D3CA 3LVWA 4LNOA 1FPYA 4LNNA 4S17A 1HTQA 2OJWA 4LNFA 2GWDA 3NZTA 2D33A 3ZXRA 2D3AA 2D32A 2D3BA 1V4GA 2LGSA 4LNIA 3LVVA 4XYCA 1HTOA 3IG5A 4S0RA 4HPPA 2UU7A 1F1HA 2WHIA 3NG0A 4BAXA 3LN7A 2QC8A 3ZXVA 1TT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGS A;  4ACF A;  4LNK A;  2GLS A;  1F52 A;  1LGR A;  2BVC A;  3FKY A;  2D3C A;  4LNO A;  1FPY A;  4LNN A;  4S17 A;  1HTQ A;  2OJW A;  4LNF A;  3ZXR A;  2D3A A;  2D3B A;  2LGS A;  4LNI A;  4XYC A;  1HTO A;  4S0R A;  4HPP A;  2UU7 A;  1F1H A;  2WHI A;  3NG0 A;  4BAX A;  2QC8 A;  3ZXV A; 
#chains in the Genus database with same CATH topology
 1EWC A;  1J19 A;  1L4Z B;  4LCD E;  5TR5 A;  1RL9 A;  3QHT A;  1TBE A;  2KAN A;  3M95 A;  4ZRJ A;  5D7G A;  1I35 A;  2FUH B;  2IGG A;  4FHK A;  3TMP B;  4KVG B;  3BY4 B;  4G50 A;  4FJZ A;  4W9C A;  2LGY A;  1MJD A;  3KUD B;  3E56 A;  3TCA A;  3AMZ A;  2WNM A;  4NAW A;  2L0T A;  1F77 A;  3WAL A;  4XZ4 A;  1EUV B;  4MH0 E;  3AH7 A;  1QZE A;  4LLG M;  3TEX A;  2J42 A;  3EUB 2;  1V9J A;  1FXT B;  1IBX A;  3ZUN A;  1R4M I;  1JRU A;  1C3T A;  2GBR A;  5KHQ A;  2INP E;  4GB9 A;  2ZNV B;  2MBE A;  4ASW C;  4KGT A;  4BOZ B;  4HRO A;  1G0W A;  4US8 A;  2WLB A;  2Z0D B;  4HDO A;  1P3Q U;  2PE6 B;  1VDV A;  3I3T B;  1TT4 A;  1DYQ A;  1WM2 A;  4KIK B;  1GC6 A;  4I6N B;  1VR9 A;  5D94 A;  3EA6 A;  5JHA A;  1DOX A;  1VRA B;  3HRD D;  2WYQ A;  3T3N A;  2EEL A;  1SD0 A;  3BWU D;  2FE8 A;  2R2O A;  4AOF A;  3U2S C;  3VTV A;  3PV1 A;  3GS2 A;  4E3C A;  1C77 A;  4DXA B;  3B6R A;  1U4A A;  1M4V A;  2MBB B;  4HEA 1;  2G9H D;  4ZDV A;  4S0R A;  2EMS A;  1ZKH A;  5HFY A;  1BT0 A;  2RDH A;  2J0M A;  3QX1 A;  3FIL B;  5FR3 A;  1Y56 A;  2HDE A;  2MP2 B;  3DBR I;  2N4F A;  4JWS C;  4LDT B;  2O6V D;  4Q2J A;  2VH2 A;  1SGH A;  1YJ1 A;  1E7V A;  2BS2 B;  2VZK D;  4A55 A;  2BF8 B;  2DHZ A;  2WU5 B;  4RGN A;  3W5U B;  4KSL C;  3U4E G;  3ECI A;  4LJP B;  3LYY A;  1CZP A;  2Z0E B;  4LNN A;  4GVZ A;  3GZN I;  1WJ6 A;  2LUE A;  2D32 A;  2G1E A;  4M00 A;  1ZW7 A;  2OOB B;  4ZHO A;  4K7W A;  4AWJ A;  1JW9 D;  1SBB B;  1WGH A;  1AAR A;  2Y5B B;  3UI3 A;  2PTL A;  3AE5 B;  1P7F A;  3K9P B;  1AW7 A;  1BXT A;  3VR9 B;  3A9K A;  3H9D A;  1WYW B;  4HCN B;  2PKO A;  1VZ8 A;  3RI7 C;  2A4Z A;  2B76 B;  2WU2 B;  4YTP B;  2KVZ A;  3JW0 X;  2EMT A;  2KDM A;  1SSN A;  1WFY A;  2PJH A;  3BK2 A;  2Q5W D;  1VCB A;  2OHF A;  3DWG C;  3R7Q A;  2FCS A;  4EUT A;  3I63 C;  1GG3 A;  3RT3 B;  2KLC A;  2MJD A;  4XX5 A;  1M15 A;  2I38 A;  2GWD A;  3PZ8 A;  2MJE A;  2REX A;  4FBJ B;  2PPH A;  5KHO A;  2L7R A;  3SFE B;  2D07 B;  3HUI A;  1WR6 E;  4YT0 B;  4P16 A;  2BYE A;  2V3P A;  1Q5W B;  2DZK A;  3JPZ A;  2M0A A;  3X0W A;  3RNE C;  2AYO B;  2KXJ A;  2ZPN A;  2C7N B;  3DQV A;  4XDD A;  3CIR B;  4W9L A;  2IO3 B;  1V97 A;  5G5H A;  1IPG A;  4KZ0 A;  1G6J A;  4PS8 A;  2KTR A;  2K5P A;  5BYS A;  1KM7 A;  1C76 A;  2DNF A;  3JSV A;  1FCL A;  5FKA C;  3Q69 A;  2I1K A;  1WXQ A;  2MX2 A;  4FJY A;  1GB4 A;  4M8M A;  4W9J A;  1FXA A;  4AP4 C;  3H7P B;  2IO1 B;  1V1O A;  4GXB A;  4EZJ A;  1RFK A;  3BVM A;  1EF1 A;  3AEE B;  2WQY B;  1WR1 A;  1E8Z A;  4L2Y A;  3PHX B;  1FEH A;  4GDL B;  4HCP B;  2O2V A;  4PS7 A;  1IBX B;  2JYE A;  1Z5S B;  1V80 A;  2BTE A;  2FCQ A;  2ZEQ A;  4NJ7 A;  1NYR A;  4ARC A;  4XYC A;  3GE3 C;  1MI0 A;  3RNG C;  2M4N A;  4J6I A;  2KFK B;  2MLB A;  3W1S A;  2WXL A;  2PLP A;  2K0P A;  2L00 B;  3PT2 B;  1SF0 A;  2KQ7 A;  1ESF A;  3KVF B;  3MHS D;  3NRZ A;  3OLM D;  3Q8E A;  4WJP A;  3DBL B;  5AEK B;  1UGJ A;  4OVU A;  3NZU A;  4HJG E;  4LTU A;  4URK A;  1UWX A;  3Q2A C;  1EO6 A;  1D3Z A;  1TY0 A;  1YJJ A;  4P1B C;  2JZP A;  2LZ6 A;  2N9E B;  4GW0 A;  5E6P A;  1TS2 A;  2KOX A;  4GMV A;  3NZ3 A;  4ZRP A;  3U7D A;  3CST A;  1LM8 B;  3VR8 B;  4M0W A;  3L2E A;  1MHX A;  1E10 A;  5IKC M;  1CK1 A;  3QJZ A;  2IGD A;  2CR5 A;  3OJ3 A;  4RM9 A;  2GMI C;  3AUL A;  2ICI A;  4K7S A;  1MG8 A;  2KYW A;  3PZ7 A;  2LXC A;  5C23 A;  2N9P C;  3L16 A;  3AE7 B;  3Q8B A;  3NVZ A;  1WX9 A;  2BPS A;  4K3C A;  3UGB B;  1N60 A;  4HKZ E;  3TEZ A;  3RPF C;  1CMX B;  2MHJ A;  2JX5 A;  2AWT A;  4B0E A;  4N58 A;  4KGR A;  4R3D A;  1L7Y A;  1Q0W B;  3N20 C;  2G4S A;  2DX5 B;  4A3O A;  1UNS A;  2KWU B;  3RNF C;  1UD7 A;  3B2F A;  4BG4 B;  1I4R A;  1WJN A;  3NUH B;  5FK9 C;  3HVD A;  3Q8F A;  2MQJ A;  1EWY C;  2JSV X;  3ZJU A;  1QQR A;  4B0M A;  3L10 B;  4KKI A;  3C0R B;  2PIA A;  2RDB C;  1N6Z A;  3Q8C A;  3DRB A;  2H88 B;  4MDK E;  3UIN B;  2JXT A;  1I4G A;  1HE8 A;  3IVF A;  1LFD A;  2CHX A;  3MFG A;  3AU4 A;  3NS1 A;  1QKZ A;  5IP4 D;  4YSZ B;  3Q6B A;  1E8Y A;  3AE8 B;  4DXF A;  3M63 B;  4FUL A;  3ZYY X;  1TS3 A;  1SE3 A;  3HK0 A;  2V3S A;  1UWM A;  3AE3 B;  3FIL A;  3ZGZ A;  1T3Q A;  4IWP A;  2KJ6 A;  3MC9 A;  2MP2 A;  3BIN A;  1BML C;  3QK0 A;  4C7Y A;  2V4I B;  2V1Y A;  1TYG B;  2Y3A A;  4XE0 A;  1MG4 A;  1FNU A;  2CRK A;  2JVC A;  3AEB B;  1JWM D;  3A1Q A;  1QIL A;  3RZF A;  2N9L A;  2DZM A;  3RCZ A;  2YVC A;  4RF1 A;  1C9F A;  3PLU A;  4PYU A;  3L0W B;  5DPR A;  2NMQ A;  3ZNG C;  2WDT B;  3ZRC A;  3OWE B;  1ZDV A;  2LJI A;  3LJ3 A;  3VTU A;  2NBW B;  1JRP A;  1TZO A;  3VHT C;  3R2T A;  3W5V B;  3Q3J A;  1P9D U;  3PPA A;  1H4R A;  2NVU I;  1AWD A;  1JCK B;  3RUL A;  4RFB A;  3KUZ A;  3QIJ A;  1YQB A;  3L17 A;  2KZR A;  1Y8R C;  4YTN B;  1T0Y A;  3RFZ B;  3WCQ A;  3HM6 X;  3KYC D;  2Y5P A;  2WWZ A;  1Q1O A;  1VZ6 A;  4GIV A;  3ZO5 B;  3V6C B;  1FFU A;  1F52 A;  1MFW A;  3VRA B;  4OW0 A;  2MSE D;  3VUW A;  1STE A;  2NBV B;  3KWV A;  4RNA A;  2RSU A;  3N30 A;  4A3P A;  1YN5 A;  4JE3 B;  4KX6 B;  3AE2 B;  4IWQ A;  2FCM A;  1TZ1 A;  3ML8 A;  3GOE A;  2MCN B;  4B6W A;  4YSX B;  4BFR A;  3AE1 B;  3ZNI D;  2KX0 A;  1P7E A;  2FIF A;  2D3C A;  2BBC A;  3MHZ A;  4GVY A;  1OGW A;  3AXC A;  2XK5 B;  2PMV A;  2WXR A;  1R4N B;  2L1A A;  2D3B A;  1D5X C;  4GDK B;  4KDL B;  1D4B A;  2KX3 A;  4DHJ D;  2UU7 A;  3P4S B;  1XLN A;  3ZDM C;  3V6E B;  3VDZ A;  4ICV A;  4A20 A;  2KNB A;  4BVU C;  3N3K B;  2IDY A;  2C7H A;  1YN3 A;  1A5R A;  3BII D;  4EE2 A;  1CRK A;  1SIF A;  1E0Z A;  4JX1 C;  4FHJ A;  3AEA B;  3ZDT A;  3IHP C;  5BMG A;  2IY1 B;  2JPH A;  2HD5 B;  3L4P A;  3NZT A;  3P42 A;  1HA5 A;  1GPX A;  4BKT A;  5GMV A;  2DZJ A;  1JWB D;  2EKI A;  1NVI D;  1GNU A;  1YD8 U;  2RGF A;  5H92 C;  3ZLZ A;  3SHQ A;  4II3 B;  3H7P A;  3V3X A;  1SXT A;  3VUY A;  1KFY B;  1A70 A;  1TGZ B;  2BB5 A;  3DPD A;  1K8R B;  4ANV A;  4M01 A;  4G3X B;  4ZRK A;  2VRR B;  1ENF A;  4GDL A;  1EF5 A;  3RNC C;  4RF6 A;  2L52 A;  1T5X D;  4M0W B;  3WIM A;  1KLU D;  2K22 A;  1L0X B;  3L2E B;  2QC8 A;  2JZZ A;  3OJ4 B;  4BBN F;  1HZ6 A;  4ARI A;  1F0Z A;  1SB3 C;  2K8B A;  1YOV B;  2LEK A;  1Q10 A;  1KJT A;  2KFK A;  2IPK D;  5G5G A;  3B2G A;  4FLH A;  1I4P A;  4XDC A;  2KWD A;  1J7B A;  2K1F A;  1AYF A;  3L54 A;  4GGQ A;  3QQ8 B;  5J2R A;  2SEB D;  4RF9 A;  1WXS A;  2BWF A;  5J9A A;  4C00 A;  3O13 A;  2LHE A;  1PDX A;  3IFW B;  3VVW B;  3KYD D;  1TJE A;  3DOW A;  2YLM A;  2LVP A;  2BKR B;  5GXG B;  2KMC A;  5C2T B;  2AQ1 B;  2C7M B;  1FIQ A;  3L08 A;  1IUE A;  3APD A;  1WY8 A;  1GAQ B;  2KO3 A;  1NI3 A;  2R61 A;  4MJS B;  1WIA A;  1R4M B;  2ZVO A;  2J0K A;  2LGD A;  2NBU A;  4CQN A;  1L0Y B;  3RMK C;  2WX0 A;  1I42 A;  1PYW D;  1V4G A;  4IW0 A;  4D2K A;  3H8H A;  3Q3N C;  3FAH A;  2J7Q B;  1QOG A;  2W82 A;  2Z8L A;  3ZKJ C;  2DLB A;  3AEC B;  5AUK A;  1RRB A;  2BS3 B;  1GC7 A;  4DWF A;  1T6B X;  5LNK 1;  2D5G A;  3R66 C;  1XLP A;  5DPW A;  4MAC A;  1H8C A;  3EFC A;  5LXH A;  4BG4 A;  3PS6 A;  2KDF B;  3KUC B;  1YJI A;  2K8H A;  2KAC A;  2MW5 A;  4MT5 A;  3SDL C;  4ITK A;  2HJ8 A;  1WM3 A;  4A6Q A;  3A1Q B;  3AEF B;  4BOS C;  2QMT A;  3VAW A;  2DYO A;  1V5T A;  4JL9 A;  3VH3 B;  4TV3 A;  2WS3 B;  3ABV B;  4YTM B;  4IKG A;  3UQA A;  1HQR D;  5BO4 B;  1S1Q B;  3SFD B;  4MEL A;  2V9H A;  4BBN C;  1FMA D;  4PT5 A;  4JWU C;  3R7R A;  3C19 A;  2INC C;  3WAN A;  2D2Q A;  1XXG A;  1YQ4 B;  2XN9 C;  4RGT A;  4RGO S;  4LNK A;  1YQ3 B;  3IG8 A;  2MBO A;  2FBW B;  3AED B;  1WJ4 A;  2DBY A;  2BYF A;  4WWM A;  3AI5 A;  2PVG C;  3RZW C;  3NVV A;  3DBR B;  3ZXR A;  1J7A A;  2NPT B;  2JYT A;  2YEP F;  1QOB A;  3TBL D;  4IC7 B;  4ZRQ A;  1WE6 A;  1DOY A;  1WWT A;  5DPT A;  5HKH A;  2ZPY A;  1F2R I;  3MJ5 A;  1JWS D;  4REZ A;  1F2R C;  2ZZP B;  3J9C A;  3MP9 A;  4C4V B;  2M0X A;  1GOZ A;  1TY2 A;  3GZN B;  1C4A A;  5JZE B;  1OEY J;  3KW5 B;  1TS4 A;  3RNA C;  3DDC B;  2D10 A;  2L32 A;  1TIF A;  1LGR A;  1K50 A;  2M17 A;  1E90 A;  2LMC A;  4RCO A;  4TUU A;  2ZW0 A;  4HJK A;  3U8Z A;  2LHD A;  2BQQ A;  3IAM 1;  1XCT L;  2WXI A;  2LVO A;  3LVV A;  3QA8 A;  4WJN A;  2ZVN A;  4JQW C;  3AE9 B;  2PE9 A;  3VTW A;  3WAM A;  2M19 A;  4WH4 A;  2RR9 A;  4W9F A;  3TUO A;  4KZC A;  5HHD G;  2GRI A;  1C79 A;  4LK0 M;  1XLO A;  1UUP A;  4I6L B;  2ZCB A;  1FXI A;  3P1M A;  4LNI A;  1R7S A;  2CS4 A;  3Q3M C;  1N5W A;  2JQR B;  5JXV A;  2IZV B;  2X38 A;  3EC8 A;  4WAF A;  2CJO A;  2ACZ B;  1ISN A;  1U6R A;  2XK5 A;  4N9F 4;  4AM1 A;  4YXD B;  3ALB A;  1N63 A;  4GDK A;  3W1Y A;  2GBM A;  3BK1 A;  3KQ4 A;  4XC2 A;  2QEJ C;  4MEM A;  4ANW A;  3E9S A;  3KWL A;  2RD0 A;  2JF5 A;  4IOI E;  1KF6 B;  2KMA A;  4TQ0 A;  4XGA B;  1I7H A;  1D5Z C;  4E71 A;  1UH6 A;  4ACF A;  4YWG G;  3LB8 C;  4ZYS A;  4II2 B;  3AEG B;  2N1W A;  1WI0 A;  1NBF C;  1FD6 A;  4LDT D;  5C1Z A;  2N9K A;  5MPO A;  2WXQ A;  4WWP A;  3U7Z A;  3NVY A;  1KLG D;  2MH7 A;  1PGA A;  4USA A;  2ZCC A;  4B9K A;  4HK2 A;  3AM9 A;  3BYY B;  1WGD A;  1PFD A;  5E6O A;  1OQQ A;  1FPY A;  1RWS A;  1X1M A;  3DVN V;  1CJE A;  4RF7 A;  4K1R B;  2WP9 B;  4IM3 A;  1ZXI A;  4AJY B;  4GW2 A;  2JWZ A;  2V4L A;  5EE9 A;  2LRU A;  2BGF A;  5T8I A;  1P0R A;  1OQR A;  1V49 A;  4WWO A;  4OVZ A;  4G0N B;  3ZNZ B;  1KOT A;  1RM6 C;  3U30 A;  4ZHP A;  1FNV A;  4DXG A;  2KK8 A;  2J4X A;  2KT7 A;  2PW9 A;  2JUO A;  1V5O A;  4YL8 A;  1WXV A;  3T9L A;  2WXJ A;  4X57 B;  4W9D A;  5JHB A;  1B1Z A;  1UZX B;  4JGH B;  1L4D B;  1E5W A;  4E74 A;  4J3O D;  2CU3 A;  3CSF A;  4OZC A;  3PRP B;  3ZIM A;  1CQV A;  5LXI B;  1J0G A;  1V6E A;  1VZ7 A;  4GN1 A;  1WZ3 A;  3B0A A;  2XBB C;  3TSS A;  1TS5 A;  1WE7 A;  1M94 A;  3IT6 B;  2WDV B;  1ZUD 2;  2KFJ A;  5LLI A;  4I6P A;  4L23 A;  5IO9 A;  1ACC A;  1FNW A;  1ET6 A;  4MJS A;  4IUM B;  4ZRI A;  3EGR A;  3VFK A;  2OED A;  4B95 A;  1QOF A;  2KMM A;  4KSK C;  3I57 A;  1ROE A;  4GOC A;  1VA6 A;  4HDQ A;  3VUX A;  2BW2 A;  1B9R A;  4W9I A;  3V05 A;  2FAZ A;  1I4Q A;  3URY A;  3N1Y C;  4AQ7 A;  4A9A A;  2HTM E;  3P4P B;  2K6D B;  1XF5 L;  2SAK A;  2DWQ A;  4DHZ B;  2EKE C;  1LO5 D;  4RMA A;  1L2N A;  5BMI A;  3QC8 B;  4HXD A;  4TMA B;  3SR6 A;  2VH1 A;  2LJ5 A;  4BKS D;  2IO0 B;  2KD0 A;  5AZF A;  3IAS 1;  1WJU A;  2CHW A;  1IP9 A;  4EOY A;  1BG0 A;  1P98 A;  1WSP A;  3RYT A;  2HJ1 A;  4RM8 A;  2L8J A;  4FJV B;  4BZA A;  2NS5 A;  2V0G A;  3NOB A;  1ZP0 B;  2N7E A;  1BUI C;  4Q2R A;  4DK5 A;  2HE7 A;  3ZXV A;  4FN2 A;  1T0R C;  1SIJ A;  2DAF A;  4LJO B;  3MTN B;  4UDU C;  3DCG A;  4RF0 A;  1E8X A;  4F8C B;  1DOI A;  3N9Y C;  4LNF A;  1N62 A;  1SE9 A;  1Z2M A;  2CKH B;  2LGX A;  4H2A A;  1RAX A;  3DWM A;  4KV2 A;  3Q14 C;  2GOW A;  2KHW B;  1EU4 A;  4WUR A;  4EZL A;  3UIP B;  1E9M A;  3DHH C;  2ZW1 A;  3IT4 B;  4A90 A;  1SJE D;  2UYZ B;  3CMM B;  3R2I A;  2MWS B;  4IM0 A;  2M56 B;  2NPT A;  2BB6 A;  3X23 A;  1OFF A;  2G45 B;  4MM3 B;  2D33 A;  1ET9 A;  1NDD A;  2UWQ A;  4NQL B;  2L83 A;  3HIZ A;  1OQY A;  1UBI A;  2LVQ A;  2O6V B;  4C56 C;  2KC1 A;  1QLB B;  1VLB A;  2Y5C A;  1V1P A;  5HI1 A;  2VZK B;  4C4V A;  3DBS A;  2M8S A;  4F1S A;  4NQK E;  3APF A;  2IJ0 A;  1E7U A;  4CYE A;  3N32 A;  4NPN A;  2AL6 A;  4OZB A;  4MH8 A;  3MC0 B;  2JXX A;  3AE6 B;  2WXK A;  3PRM B;  4K7U A;  4DQO C;  3KH0 A;  1J8C A;  2W3R A;  3IG3 A;  5JH5 C;  3P4R B;  3A4R A;  1FRR A;  1TKY A;  3BVZ A;  4TQ1 A;  2GWC A;  1E7P B;  5H8Y E;  3TIX A;  2MJ3 A;  2N7J A;  1T0S C;  2LRW A;  2LUM A;  5BYR A;  4BKS A;  2JRH A;  5E6J A;  5D3D A;  2HTH A;  1XQQ A;  3ZJV A;  3PHW B;  3OAW A;  2PVO D;  1C1Y B;  5J17 A;  3PRE A;  4NJC A;  2H89 B;  1HZ5 A;  2X8X X;  1WXA A;  3ZJT A;  2OJR A;  5IN7 A;  3SU8 X;  3SEB A;  5L95 C;  5J99 A;  4W9H A;  2ZNV C;  1WX8 A;  5BMH A;  2K25 A;  1K53 A;  4WWN A;  1D5M C;  3S2A A;  4MGK E;  4WIP A;  2MBQ A;  2J0J A;  3DHI C;  1XEE A;  1VD2 A;  3ETR A;  4W9K A;  3NJT A;  4BAX A;  5FR6 A;  4GSW A;  3ZTC A;  1PQS A;  1KH0 A;  2D3G A;  2QIL A;  2KWC A;  3FC4 A;  3SD5 A;  5C3J B;  2QJL A;  1KTK A;  5EE0 A;  3AB5 A;  4WQO B;  3TJP A;  1PUT A;  3D32 A;  4US9 A;  1P1A A;  4TKN A;  3PSE B;  2AEH A;  2NR2 A;  2V3N A;  2WHI A;  5E6N A;  5EDS A;  4RF8 A;  5L83 A;  3JVZ X;  4OZA A;  4GU2 A;  1QK1 A;  3A9J B;  2AQ3 B;  1SE2 A;  1WGK A;  1TKG A;  5AZH A;  3V61 A;  5I4D A;  2N1V A;  1JRO A;  2KN4 A;  2LFI A;  2QSD A;  1ZOY B;  3V60 A;  1VJK A;  2KQ4 X;  5G2N A;  5AZG A;  1SEB D;  4N6E B;  1UBQ A;  3HVZ A;  1HTO A;  4K3B A;  3ZQ4 A;  4JLC A;  2KQS A;  2AL3 A;  2W9N A;  3WAO A;  4A8X C;  3U52 E;  2WXF A;  3AV8 A;  3UIO B;  2K8C A;  1R8G A;  2GBJ A;  2LXA A;  3NVW A;  1GUA B;  1T0Q C;  1E8W A;  4YSY B;  3BYT B;  4WJO A;  2N7D A;  1NYQ A;  3NZS A;  2LD9 A;  5G55 A;  4CO7 A;  2K39 A;  4DHZ E;  1N5X A;  3NY5 A;  2AQ2 B;  2KDE B;  2K6Q A;  2E3T A;  1AN8 A;  1YIW A;  3VXW A;  1TTN A;  1P50 A;  3DVN U;  3I9V 1;  1YMH E;  2WXP A;  2GLS A;  2K9X A;  2WXN A;  1ZE3 D;  5D2M B;  4GLS C;  2L0F A;  4WAA A;  1IYF A;  3Q3O C;  5CHW A;  4KDI C;  2BWE S;  4QAY A;  4MSQ B;  4HPP A;  1ZDX A;  4M02 A;  1WGY A;  1JWU D;  5CX3 A;  3PGE A;  2JY6 A;  1P52 A;  2CJN A;  5HG2 A;  2WDR B;  2MA9 B;  2L3Z A;  1E6E B;  2KDB A;  5CHV C;  4XWT A;  2KTF A;  1PGB A;  1WF9 A;  2NTT A;  1UF0 A;  4PS3 A;  2KJR A;  1QF6 A;  1J7C A;  2M1M A;  1JQ4 A;  1LQB A;  3T8M A;  5EE3 A;  1FM0 D;  3HHM A;  2D11 A;  1YX5 B;  2KWV B;  2DZI A;  1I4H A;  1OEY A;  4HKQ A;  2ASQ A;  2AX5 A;  3A4S C;  2GBN A;  2FUG 1;  2QDF A;  4EKU A;  5DCN A;  3PRZ A;  2LGI A;  3ZRF A;  3NG0 A;  4C7Z A;  1L0V B;  1I4X A;  1I0E A;  2GB1 A;  2R2Q A;  1YNT E;  2BVC A;  1RYJ A;  2IBI B;  5D3I B;  2BKF A;  3PVL A;  4HWI B;  2KAJ A;  3N1X C;  2A5U A;  1S3S G;  2D3A A;  3QAQ A;  4M8N A;  1V1P B;  4RH6 A;  1RFA A;  1JML A;  4TSS A;  2MRP A;  1UEL A;  2QHO A;  3HM3 A;  4PYZ A;  2W54 A;  2NCN A;  2RPV A;  3DBH I;  3H1U A;  2LAS A;  1WGR A;  3L2D A;  2NTS A;  1IGC A;  1WRD B;  4ZOH C;  4ANU A;  4AUQ C;  3R8B A;  4KGS A;  1VRP A;  2WDQ B;  4RGM A;  1WGG A;  3PTF C;  1L5P A;  1WMH B;  2E6X A;  1FRD A;  1V86 A;  4IWO A;  2L76 A;  3IXS A;  2KC2 A;  3EFU A;  3W2D A;  4PK1 A;  1V2Y A;  3CWI A;  1HEZ E;  3GE8 C;  3Q8A A;  2WXG A;  1RLF A;  4MM3 A;  3JYU A;  1XO3 A;  3FKY A;  3P4Q B;  4NY0 A;  4L1B A;  3DVG Y;  4S17 A;  2JRI B;  2O6V A;  3M3J A;  2B3A A;  3V62 A;  4JIO U;  4ICU A;  2IY0 B;  3PO0 A;  4CHK A;  2KN5 A;  3M10 A;  1F9J A;  3DBL I;  4G11 A;  1V81 A;  2L05 A;  5BYQ A;  3ONS A;  3RN9 C;  3DBH B;  5EE1 A;  3UF8 A;  1QOA A;  4FA6 A;  1EM7 A;  2BYV E;  4KKJ A;  1QT9 A;  2RDG A;  3CF6 E;  2LGS A;  4NAW B;  1C78 A;  2LI5 A;  2JZ3 B;  3H7S A;  1JWA D;  1PGX A;  2ONQ A;  3PZD A;  3ML9 A;  1WZ0 A;  3TEY A;  4MGY E;  3O65 B;  1V8C A;  3NS8 A;  2KLG A;  2DYB A;  5D6J B;  2TSS A;  2FCN A;  1FO4 A;  3LVW A;  1NEK B;  4N59 A;  3W9C B;  3ZVV A;  4HRS A;  3RUI B;  1WH3 A;  3DHG C;  2RPQ A;  4AJW A;  3IG5 A;  1EU3 A;  4HVB A;  3AE4 B;  2K3U A;  1FCC C;  2IND C;  3P63 A;  4ANX A;  2MEK A;  1XLQ A;  1OTR B;  3LN6 A;  5CTR C;  3RD2 A;  4IG7 B;  2JU6 X;  3L13 A;  1SE4 A;  1HTQ A;  2IGH A;  1WRI A;  4IDI A;  1FFV A;  2PEA A;  3AN1 A;  4NAM A;  4MGZ E;  3KLS X;  3EHV A;  2DEN B;  4MSM B;  3GB1 A;  5AUI A;  2WXH A;  2ON8 A;  2G4D B;  2BT6 A;  2N9X A;  2KKC A;  3VH4 B;  2I1J A;  4FAD A;  4DDI D;  4LNO A;  4DHJ B;  3VRB B;  3DRE A;  3A9J A;  2QIE B;  2FNJ B;  1TKE A;  2KJH B;  2YEP B;  2BYT A;  2W55 A;  2LWP A;  3NHE B;  1YN4 A;  2JWU A;  1L6U A;  3C8Y A;  3K9O B;  2INN E;  3AU5 A;  3RNB C;  1D6E C;  3BVG A;  3MJW A;  4AS1 A;  5IAA C;  1XD3 B;  3WA0 A;  1L6V A;  4KIK A;  4HPL B;  4WQM A;  1JAL A;  3BZD B;  1K52 A;  2J53 A;  4EEW A;  1ZPS A;  1XT9 B;  3Q3F A;  3ZW3 A;  3MC8 A;  2WXO A;  1K51 A;  3UQB A;  4NJ6 A;  3JU5 A;  3JU6 A;  2OJW A;  3JQ3 A;  3TL5 A;  1GB1 A;  3EEC A;  2C60 A;  4FXC A;  1ZXH A;  3A33 B;  3PLV A;  2BS4 B;  1HXY D;  2J1Q A;  2JT4 B;  3WAP A;  3B08 A;  4P6V F;  1MPE A;  1MHH E;  3GP7 A;  4W9G A;  4BKG A;  3QCA A;  3VQI A;  2QCZ A;  4NNJ B;  4Z9M A;  3IBE A;  1ZGU B;  4HPM B;  3A9K B;  3P2B A;  3H6N A;  3LN7 A;  2DAJ A;  1IGD A;  2KDI A;  1QH4 A;  5CHF A;  2ZJD A;  1XCQ L;  2IYD B;  4ZYN A;  1NEN B;  4BHL A;  2C9W B;  1KRH A;  3QAR A;  5IA7 A;  1MVK A;  4WJQ A;  1SJH D;  5DPS A;  4EFO A;  1UGM A;  2GBK A;  4P1C C;  3TEW A;  2KVR A;  2XNA C;  1NI2 A;  3ENE A;  4F7Z A;  5J18 A;  2WGS A;  4JPS A;  1N61 A;  4K81 A;  1R4N I;  2W3S A;  4DDG D;  1C4C A;  3APC A;  2Z59 B;  2CU1 A;  4EZK A;  4C80 A;  2J52 A;  4XWW A;  3LXF A;  4MGI E;  1WYG A;  2N0S B;  4NZL B;  4DBG A;  2GI9 A;  2DYM A;  1LXD A;  5TSS A;  3DVG X;  3N1Z C;  1YX6 B;  3T3O A;  2XEW A;  3W1S C;  3ZTD A;  2KTR B;  1GJZ A;  3M62 B;  3LDZ E;  2I2Y A;  1KLV A;  1WX7 A;  3JSV B;  1TT5 B;  3QWZ B;  2CHZ A;  1F1H A;  1C4P A;  2FID A;  2C5L C;  4W9E A;  3I5J C;  1WMH A;  3B9J A;  3OG5 A;  5IOI A;  4OHJ A;  2G3Q B;  2MBH A;  4HLE A;  1DGJ A;  3R3M A;  2IO2 B;  4O1N A;  4IM2 A;  3ZNH B;  2O2V B;  2WX1 A;  4P7I A;  2WXM A;  4OVV A;  3B1L X;  2RMM A;  1WXM A; 
#chains in the Genus database with same CATH homology
 2WGS A;  4ACF A;  2GWC A;  4LNK A;  2GLS A;  1F52 A;  1R8G A;  1LGR A;  1VA6 A;  3IG8 A;  3LN6 A;  2BVC A;  3FKY A;  2D3C A;  3LVW A;  4LNO A;  1FPY A;  4LNN A;  4S17 A;  1HTQ A;  2OJW A;  4LNF A;  2GWD A;  3NZT A;  2D33 A;  3ZXR A;  2D3A A;  2D32 A;  2D3B A;  1V4G A;  2LGS A;  4LNI A;  3LVV A;  4XYC A;  1HTO A;  3IG5 A;  4S0R A;  4HPP A;  2UU7 A;  1F1H A;  2WHI A;  3NG0 A;  4BAX A;  3LN7 A;  2QC8 A;  3ZXV A;  1TT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...