3FKYA

Crystal structure of the glutamine synthetase gln1deltan18 from the yeast saccharomyces cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
346
structure length
336
Chain Sequence
RGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPLKGDWNGAGCHANVSTKEMRQPGGTKYIEQAIEKLSKRHAEHIKLYGSDNDMRSMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNADMTKEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamine synthetase
publication title Crystal structure of Saccharomyces cerevisiae glutamine synthetase Gln1 suggests a nanotube-like supramolecular assembly
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 98
structure length 336
sequence length 346
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3fkyA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 3fkyA02
2D3BA 4S0RA 2WHIA 1FPYA 1F52A 4BAXA 2QC8A 2BVCA 2UU7A 4HPPA 4LNOA 1HTQA 4S17A 4LNIA 2WGSA 3ZXRA 2GLSA 4XYCA 4ACFA 2D3AA 3NG0A 4LNFA 2LGSA 2D3CA 1HTOA 4LNNA 2OJWA 1LGRA 3ZXVA 4LNKA 1F1HA 3FKYA
chains in the Genus database with same CATH superfamily
2RDBC 3DVNU 1I7HA 2WXHA 2KLGA 2GRIA 3AEFB 1GUAB 3ENEA 3ZVVA 4MSQB 3I9V1 4M8MA 4ICUA 5G2NA 3A4RA 2PIAA 4MT5A 3QHTA 4RGOS 2W9NA 1E7VA 2WDQB 3MTNB 2M19A 3TEZA 3PHWB 3D32A 2KN4A 5G5GA 2KT7A 4JPSA 5FKAC 4KSLC 1UWMA 2K8BA 3M62B 2V3PA 3RULA 2JWZA 4HVBA 4KGTA 1SE3A 1EO6A 2KNBA 1QLBB 3RN9C 2N1VA 3PT2B 4WH4A 1QK1A 1V86A 1V1PA 3UIPB 3DHIC 2J53A 1JQ4A 1LGRA 4KV2A 2V4LA 1WH3A 4NQKE 4X57B 1TY0A 2BF8B 4G50A 1WXMA 2ZVNA 3VTWA 4HJGE 1LFDA 1MG4A 2SAKA 2CKHB 3PZDA 2JSVX 2M17A 1J7CA 2YLMA 4IC7B 3KUZA 4PK1A 2OJRA 4FJZA 3U8ZA 4AQ7A 3U30A 2VH1A 3UIOB 1FCCC 3R8BA 3ZJVA 1YX5B 4JQWC 5EE1A 3NJTA 2M56B 5CHFA 1VZ6A 1FIQA 3EFCA 3KWVA 4KGSA 1E7PB 4W9JA 4IKGA 1E7UA 2BYEA 3BVZA 2LXAA 2WXNA 3S2AA 5AUKA 3SR6A 4HPMB 2CU1A 4URKA 3BK2A 4BBNF 3IG5A 5J9AA 3AN1A 1B1ZA 3AEGB 4MJSB 3N3KB 4OHJA 1TIFA 3DDCB 4AOFA 3X23A 2L00B 5BYQA 2BGFA 5EE3A 4PT5A 1L5PA 2IJ0A 1UBQA 3EC8A 3M3JA 2QJLA 1L2NA 2AYOB 2JYEA 3PO0A 2XN9C 4GIVA 2QMTA 2QEJC 4GVYA 4HDOA 4HDQA 4A20A 1M94A 4K3CA 4M02A 1C77A 2E6XA 2K8HA 2IPKD 1NENB 3TSSA 2TSSA 1S3SG 2GBMA 2M4NA 1T5XD 3DHHC 5FK9C 4MGIE 2AEHA 2MBBB 3ETRA 2FCQA 3NZ3A 2D3GA 3NY5A 2PLPA 2FUG1 3QWZB 1RLFA 3HM6X 2D2QA 3DBRB 4FULA 2MHJA 2QILA 1E0ZA 2MEKA 3ZNHB 2QHOA 4FLHA 3ZIMA 3DBSA 2AQ1B 4DHZB 3O13A 2INNE 3BYTB 3IG8A 1SJED 4KDLB 4D2KA 1GC6A 2MA9B 5D7GA 2WX1A 2I38A 1P50A 1BUIC 1C78A 5AZFA 2KDEB 2KJHB 4LTUA 5JZEB 2N9PC 1YN3A 2LVOA 1L0YB 4OZBA 4USAA 2HE7A 4HXDA 3OG5A 4IOIE 2LRUA 3VUYA 3PS6A 4A3OA 2RGFA 4ARCA 2DZIA 3QCAA 1L0VB 2L32A 2MBEA 3ZLZA 3BWUD 1BG0A 1WGHA 2NTSA 2AWTA 3IT6B 3JW0X 1QOGA 1JW9D 4NZLB 1WYGA 1YN4A 3ZNZB 3HRDD 1V80A 2LGYA 1SE4A 4MELA 2YEPB 1OGWA 3A9JB 4FXCA 1C4PA 2JXXA 3I57A 4MGZE 2FAZA 3U7DA 1UGJA 2N1WA 3N1ZC 2KDBA 3B08A 4NQLB 3W1YA 4RGNA 2MBQA 1SJHD 3H7PB 3U52E 4MJSA 3EECA 2RDGA 4LJPB 4LNIA 3ZO5B 2LUMA 1E10A 3PRZA 1XO3A 1N61A 4JWSC 3TL5A 4MM3A 2KQSA 2KTRA 3PLUA 4PS7A 1RYJA 1P52A 1T0YA 4IWQA 1GPXA 3W9CB 4ANVA 5TSSA 5L83A 4QAYA 1JRUA 2YVCA 1K53A 1IYFA 4NJCA 4KIKB 3M63B 4ZRQA 2LI5A 1WMHA 4WWMA 2Z8LA 1P7FA 3FAHA 1MFWA 2BWES 2KFJA 3X0WA 4M8NA 1C79A 2JPHA 3RMKC 3WAMA 1UZXB 2M0XA 2GI9A 2RR9A 2ZW0A 1WXQA 1J7BA 3Q8CA 2PJHA 1IBXA 3RCZA 2HDEA 4RF0A 2XNAC 1TS5A 2FUHB 4DHJD 2IY0B 4RGMA 1EF5A 4MH0E 3RD2A 3M95A 4DWFA 4FBJB 2AL6A 1F9JA 3AEDB 3VRBB 2KFKB 1RAXA 5AZGA 2MW5A 4W9GA 4P1BC 2CJOA 1LXDA 1WXSA 3ZXRA 4FHJA 2A5UA 3DWGC 2N9EB 1WX9A 3AEEB 1WM3A 2RPVA 4BHLA 2LGSA 5J17A 2LMCA 2G4DB 1E5WA 3BZDB 2MBOA 2JRIB 3TEYA 3ZUNA 3APCA 1OQYA 3LVVA 5IKCM 4ICVA 4KVGB 4MSMB 2ZNVC 4B0EA 1EWCA 1K52A 2YEPF 1Q0WB 2QIEB 3Q2AC 2CJNA 2LGIA 2BYVE 2W54A 3P63A 1V5TA 1TT4A 1SIJA 2XK5B 5L95C 1VA6A 4ARIA 2V3SA 4ZYNA 2KHWB 1WZ0A 1KLUD 4LCDE 3QX1A 2WP9B 3L13A 1AWDA 4FJYA 4PYZA 3P42A 3DBLB 4MDKE 4RF7A 2BB5A 5AZHA 2N7DA 2IO3B 2WLBA 1QOAA 3KUCB 4YT0B 1IGDA 3U7ZA 3T9LA 1OQQA 1JROA 2WXLA 2RSUA 2WDVB 4FN2A 5JHAA 4FA6A 2INCC 1I4QA 2CHWA 5JHBA 2K22A 1H8CA 1TT5B 3AM9A 2VZKB 4LNNA 1P7EA 3HIZA 1V1PB 2DBYA 2WXMA 1R4MB 4LLGM 4W9CA 3HK0A 1P3QU 1MJDA 1E6EB 3RFZB 4DK5A 1KRHA 3BVGA 3KUDB 3L54A 4ZHPA 2DYBA 2LZ6A 3MJ5A 4DBGA 1MHXA 4ASWC 4ZRPA 3HHMA 2WXGA 3DPDA 5HI1A 2VH2A 2K5PA 1K8RB 3CF6E 1V97A 4J3OD 1PUTA 2KJRA 3SHQA 3SU8X 2WXIA 5EDSA 2KXJA 4J6IA 4BVUC 3V6EB 1WJUA 3W5VB 1EM7A 5CX3A 4CQNA 2D3BA 3VVWB 3ZYYX 4WQMA 1LO5D 1FM0D 2IO0B 2CS4A 2BW2A 2UWQA 3Q69A 3PRMB 5D3DA 1BT0A 2DZJA 2G45B 3W5UB 4RFBA 2Q5WD 1R4NB 4W9DA 4FHKA 4L1BA 2KKCA 1OTRB 4HWIB 3MJWA 3EFUA 1FRDA 2BB6A 3RNBC 3JYUA 2INDC 4GVZA 1WR6E 1E90A 2CRKA 3H1UA 4JWUC 3Q14C 2XK5A 3V6CB 2EKEC 1F1HA 4YTMB 4AUQC 2C5LC 4WJPA 1M4VA 2BVCA 4OZCA 3EUB2 3TMPB 2ONQA 2PE6B 3NOBA 2O6VA 3M10A 1KLGD 2GOWA 4HKZE 2D11A 4EKUA 1U4AA 4S0RA 1D4BA 1WGYA 4BAXA 3RPFC 2QC8A 1OFFA 2LGXA 4NNJB 4YXDB 3WCQA 4G3XB 3VH3B 4IG7B 2FCNA 1FNVA 3RNAC 3RT3B 2DENB 2KD0A 1I42A 3EGRA 2MX2A 3PZ7A 2KN5A 3AECB 2K3UA 2L83A 4IM0A 1XLQA 4EZKA 2CR5A 3E9SA 3A1QA 3IFWB 3UINB 2IDYA 2GB1A 3Q3FA 1YNTE 4WJQA 2DWQA 3VRAB 2ACZB 5DCNA 3LJ3A 4P1CC 3QQ8B 1CZPA 3AV8A 3VR9B 2BKRB 3UGBB 2Y5BB 4TKNA 2DNFA 3B2GA 1WJ6A 3TEWA 4JX1C 2RD0A 4IDIA 1JRPA 3O65B 1J19A 4N59A 3NZSA 3U4EG 2L05A 1CMXB 1NYQA 3TUOA 1ZGUB 1WI0A 1GB1A 1XXGA 3H6NA 1WIAA 1XLNA 3DVNV 1JALA 1RL9A 2X38A 2AL3A 4C7ZA 3R2TA 3RYTA 4NAWB 2FCMA 1RWSA 3JSVA 4AS1A 1WX7A 1ZXHA 3BK1A 1E9MA 5DPRA 2NTTA 3OAWA 1X1MA 2ZCCA 2R2OA 4LK0M 2IGHA 2JUOA 3RNGC 3NVZA 4EEWA 4LDTB 4ANUA 4LJOB 1TKEA 1TS4A 1WRIA 1WM2A 1YN5A 1Q5WB 3GZNI 2NR2A 1RM6C 1IGCA 4A6QA 2EMTA 4MM3B 2KWUB 3DWMA 3QARA 4BG4A 1EU4A 3P4SB 1KLVA 1Y56A 2KTRB 4CYEA 2PMVA 4GW0A 1FFVA 1PQSA 1HZ5A 3QJZA 2Y5PA 1ZP0B 3T3OA 2D33A 1ENFA 1YJJA 2KTFA 4ZRKA 2K1FA 4RF9A 4XDDA 1QOBA 2MP2B 3L17A 1WE7A 1WMHB 2RMMA 4B9KA 4KSKC 2W3SA 4GDLA 4KZCA 1OEYJ 2ZCBA 4F1SA 4YSXB 5IO9A 2NVUI 1GG3A 1I4RA 1T0RC 1ZE3D 1VDVA 1WGGA 2CU3A 1IBXB 3RZFA 1S1QB 1BXTA 1JWBD 4JL9A 1VLBA 1MI0A 4ZRJA 2KQ4X 2L3ZA 4M0WA 2BYFA 1E8WA 3VQIA 4IM2A 5BMHA 3NHEB 5D6JB 1WGRA 1D5XC 1FNUA 2K6QA 4Z9MA 3NVVA 2OJWA 4YSYB 4KKJA 3RI7C 3KQ4A 4B0MA 4E74A 4FADA 3AXCA 3N32A 4C56C 4YL8A 1RFKA 4XC2A 1ZDVA 5H8YE 3DVGY 4NJ7A 3B6RA 2WQYB 4GGQA 4BKTA 2LEKA 3J9CA 1L6VA 3I5JC 3KH0A 2MSED 1RFAA 2JX5A 4BKSD 2D5GA 1ZUD2 3R66C 2V9HA 4IW0A 1N63A 4DDID 3LN7A 2K0PA 5HHDG 3AE1B 3P1MA 3PTFC 2ZPYA 3ZRFA 1SD0A 5LNK1 3Q8AA 2J7QB 3KLSX 1SEBD 2MRPA 2G1EA 3EA6A 2INPE 4PS8A 1LQBA 2BS3B 3WAPA 3P2BA 1HTOA 4HEA1 4TSSA 4NAWA 3LYYA 3Q8FA 1UBIA 1OEYA 3FKYA 3GZNB 1MVKA 3QA8A 5HKHA 1KFYB 1YJIA 1AW7A 2EELA 2KX3A 4K3BA 3GE8C 5LXHA 4US8A 1XEEA 5KHQA 2J42A 2LVQA 5C2TB 1A70A 1HXYD 1YQ4B 3GP7A 3CWIA 3AE9B 4RM9A 4US9A 5BMGA 1WJNA 2WXPA 5H92C 4AJYB 4A9AA 2HD5B 2WXOA 4M00A 1ISNA 2E3TA 2MQJA 3JQ3A 4PS3A 3ZRCA 4F7ZA 2PVGC 2B3AA 3VFKA 2MP2A 3MHSD 2JZ3B 4RH6A 2V0GA 2IY1B 1SF0A 5BYRA 1FCLA 3Q6BA 2J0MA 3SFEB 3PRPB 5EE9A 3Q3NC 1D5ZC 2KDMA 4HROA 1RRBA 3L2DA 3VH4B 1TY2A 1Q1OA 2I1KA 4ZRIA 4CHKA 1T0SC 3RNEC 4EFOA 2G9HD 1F2RC 2QCZA 1ROEA 2GBNA 1XCTL 4ANXA 2HTME 1JWSD 2EMSA 1FPYA 1V9JA 2KWDA 4GN1A 1UH6A 4EUTA 1TS3A 2WGSA 4KX6B 1AARA 2LJIA 1IP9A 1UF0A 4HJKA 4GB9A 3B2FA 1UD7A 1Z5SB 2IYDB 2Z59B 1TYGB 2LUEA 4XGAB 2PEAA 3AB5A 1QKZA 2K6DB 1QQRA 4II2B 1WXVA 1CQVA 1KJTA 4HKQA 4W9FA 5HFYA 1FFUA 2PTLA 2KMCA 4ACFA 5JXVA 3AU5A 2C7HA 4ZYSA 3WA0A 3HUIA 5BO4B 2L52A 1TGZB 4WAAA 2PPHA 5D3IB 3HM3A 3APFA 2KYWA 4C7YA 3KW5B 4JE3B 4TQ1A 5HG2A 2LRWA 4RCOA 1PYWD 4GXBA 4C80A 2DYMA 2DX5B 3SD5A 3V61A 1EU3A 4WURA 2DAJA 1ESFA 1PFDA 3TIXA 4EZJA 2O6VB 3NZTA 1QILA 2PE9A 2FCSA 2IO2B 2D32A 1EF1A 1EUVB 3TCAA 2RPQA 1JWMD 4GLSC 1H4RA 2NMQA 2KO3A 1I4PA 1SSNA 1E8YA 4WQOB 3Q3OC 1ZPSA 2V3NA 4XZ4A 2D3AA 2VZKD 3VTVA 1G0WA 1XT9B 2NS5A 5MPOA 2LFIA 5JH5C 4WWPA 3PPAA 2OOBB 3W2DA 3VDZA 1TKGA 2C7MB 2WXJA 1WSPA 4RMAA 4YSZB 4YTNB 4WWNA 3A1QB 4F8CB 3AE2B 4RM8A 3NS8A 2L7RA 2N7EA 2ZZPB 3TEXA 4BBNC 5GMVA 3Q3MC 4P6VF 2L1AA 2ZNVB 1FO4A 4W9HA 3AULA 1I4XA 3JU5A 1E8ZA 1ZKHA 3KYDD 2LHEA 2BQQA 2KVRA 4MACA 2FIDA 3AE5B 3ZJUA 1BMLC 1SE9A 4IUMB 1SE2A 1IPGA 2O2VB 3AE4B 2MBHA 1F0ZA 1L6UA 2GBKA 5E6JA 4HCNB 4N58A 5DPTA 4C00A 1N5XA 3AE3B 2KJ6A 3OJ3A 3LVWA 2N9KA 4KZ0A 1NI3A 2R2QA 1V5OA 1YD8U 2WS3B 3JSVB 2Z0DB 1VD2A 3WIMA 2BYTA 2XEWA 2M0AA 4WJOA 4L23A 1DGJA 4ITKA 3L2EA 4A8XC 1WGKA 3PSEB 2Z0EB 4JLCA 3LXFA 5EE0A 3LB8C 4EZLA 3ECIA 4S17A 2X8XX 4K7SA 2JZPA 4BG4B 1E8XA 2VRRB 5FR6A 4KDIC 3WALA 3VTUA 2OEDA 4BOSC 4TUUA 1C3TA 1VR9A 1KF6B 1YX6B 3KYCD 4DDGD 2BT6A 4O1NA 3V60A 3CSTA 1V1OA 1V2YA 3B9JA 2WX0A 2LD9A 2DAFA 2J1QA 3URYA 2MJDA 4WJNA 4MH8A 1R7SA 1PDXA 1DOIA 3KVFB 2MJEA 1P98A 4GDLB 4YWGG 3ZQ4A 3A9KA 5DPWA 1WX8A 4RNAA 2KWVB 5D2MB 2H89B 2HJ8A 2V4IB 2FIFA 2DYOA 2NBVB 2M1MA 1VCBA 3L16A 2BKFA 3ZNID 1GB4A 3QK0A 1A5RA 5CHVC 2C60A 1M15A 1SBBB 3MC8A 1C76A 4M0WB 3AE8B 3JPZA 4W9KA 2MWSB 1N60A 1V6EA 2LVPA 1J7AA 1WR1A 3PLVA 2WHIA 3QAQA 4TMAB 2WXQA 4GMVA 2MH7A 5KHOA 1TBEA 2DZMA 2GWDA 4XWTA 2C9WB 1QZEA 1T3QA 3K9OB 1XD3B 3PREA 1L7YA 3VUXA 1PGAA 1TKYA 3ZTCA 3ZW3A 3IAM1 4NAMA 2IO1B 4A55A 3DBRI 2L8JA 2K9XA 3LN6A 4OW0A 1L4ZB 2JXTA 2WU2B 3ZKJC 2O2VA 3IHPC 1VRPA 4ZDVA 3QC8B 2FE8A 1YOVB 1WY8A 5IA7A 4P16A 2JF5A 3ALBA 1YJ1A 4K81A 2D10A 4CO7A 3VR8B 1Q10A 2B76B 4L2YA 3T3NA 5E6NA 3P4RB 3OWEB 2LJ5A 2PKOA 3Q8BA 4FJVB 4XWWA 1FRRA 5GXGB 4TQ0A 4C4VA 4HPLB 4LDTD 3V05A 3FILB 3K9PB 3R2IA 2IBIB 1B9RA 1J0GA 1JCKB 2CHXA 3PVLA 3WANA 2ICIA 1C1YB 1T0QC 4HK2A 3WAOA 2KMAA 1WXAA 4REZA 1GC7A 3NS1A 1WYWB 3IXSA 3BYYB 4P7IA 2JYTA 1FXAA 2WU5B 3P4QB 3ML9A 2LWPA 2N7JA 1UGMA 3UQBA 1UUPA 4RGTA 1ZW7A 3SDLC 3DVGX 1WRDB 2NBUA 1N6ZA 1TZ1A 3AU4A 2HJ1A 5CHWA 1LM8B 2AQ2B 5DPSA 3N30A 5BMIA 3W1SC 1NDDA 4H2AA 2JQRB 2L0TA 1XQQA 4ANWA 2J0KA 1VZ7A 2KC1A 2W3RA 4GDKA 3L4PA 1ZXIA 2OHFA 1VZ8A 2ZVOA 3MHZA 5J18A 3IVFA 5I4DA 3VUWA 2KC2A 4I6LB 1HZ6A 2BBCA 1VRAB 4Q2RA 2G3QB 4K7UA 4MEMA 2RDHA 2UU7A 1UELA 4OVZA 1HTQA 1SIFA 2CHZA 1CK1A 1FXIA 2I1JA 2FBWB 4TV3A 1HE8A 3DREA 1NEKB 2V1YA 2L76A 4ZOHC 5C23A 5T8IA 1QH4A 2BWFA 4JGHB 1MPEA 2ZJDA 1HEZE 3Q8EA 2WWZA 1V49A 1YQBA 4EE2A 3BY4B 2ZPNA 2BS4B 1ZDXA 3UI3A 1WWTA 3ZDTA 3R3MA 2KDIA 1XF5L 1C4CA 4A3PA 4GOCA 1R8GA 3NRZA 3CSFA 4DQOC 3C19A 3DBHI 3VAWA 2IGDA 2N4FA 3PHXB 3CIRB 3PZ8A 2J0JA 1F52A 5C3JB 1VJKA 3FC4A 1XLOA 3IBEA 4DXFA 2ZW1A 5CTRC 1YQ3B 1UNSA 1GOZA 4XDCA 1P1AA 3SEBA 3H7SA 4E71A 1OQRA 2KAJA 5J2RA 4AP4C 2C7NB 4BKGA 2JZZA 2KQ7A 3L08A 2KDFB 5D94A 2DLBA 4MGKE 3AI5A 4BFRA 5IP4D 4R3DA 2QSDA 3FILA 1P0RA 2N0SB 1ACCA 4NY0A 1JWUD 1DOYA 4IM3A 4DXAB 2SEBD 3SFDB 4A90A 1D3ZA 1G6JA 3CMMB 2D3CA 1HA5A 5IOIA 3LDZE 3N20C 3ZNGC 1WZ3A 1TS2A 3L0WB 2K25A 1CJEA 3ABVB 1F2RI 2WNMA 3VHTC 3DHGC 3HVDA 3DBLI 2AX5A 3NZUA 3T8MA 1FEHA 4GU2A 1MHHE 3DQVA 4NPNA 4WIPA 3PGEA 1I4GA 1ZOYB 4LNKA 3RZWC 4B95A 4PYUA 1DYQA 4UDUC 2PVOD 1D5MC 4GSWA 3IAS1 2NCNA 2KACA 1AYFA 4WAFA 2REXA 2LASA 2WXRA 4B6WA 4RF1A 3GS2A 2BPSA 1K51A 1FMAD 3H8HA 3ZXVA 2ON8A 3ZDMC 3DCGA 1MG8A 3NUHB 3RUIB 1R4MI 3ZTDA 4RF8A 2K8CA 3C8YA 4K7WA 1I0EA 3AH7A 2HTHA 3MC0B 2PW9A 3AEBB 3I63C 2IGGA 1WFYA 4W9EA 1AN8A 2DZKA 3KWLA 2KWCA 1KH0A 2GBJA 1GJZA 4N6EB 2LGDA 1QOFA 3UQAA 2W82A 2GWCA 3L10B 1QT9A 3UF8A 4HRSA 4BZAA 2UYZB 4MGYE 1SB3C 5G55A 1FXTB 1V8CA 2ASQA 3DBHB 4DHJB 2MJ3A 2WXFA 3L2EB 5IAAC 1STEA 2BTEA 3GB1A 1NYRA 3C0RB 4HPPA 2J4XA 1T6BX 3B0AA 2G4SA 3A33B 4YTPB 1HQRD 1IUEA 4EOYA 2NPTB 3PV1A 3NG0A 5G5HA 1XLPA 3AEAB 4II3B 3RNFC 3HVZA 3BVMA 3RNCC 4E3CA 1TJEA 2K39A 1EWYC 1NI2A 3OLMD 2Y5CA 1C9FA 1WF9A 4I6NB 1XCQL 3R7RA 4W9LA 2KX0A 1PGXA 3ML8A 1YIWA 1I35A 4GW2A 2LHDA 4JIOU 2QDFA 2O6VD 4DXGA 1ET9A 3W1SA 4XE0A 3I3TB 4G11A 1DOXA 4XX5A 2WYQA 3DRBA 1GAQB 1R4NI 3V62A 2KVZA 3ONSA 4OVVA 4M01A 4HCPB 3A9KB 4BKSA 1JWAD 4IWPA 3MFGA 4KKIA 1ET6A 1TTNA 4AJWA 2JWUA 3A9JA 3AE7B 3H9DA 1C4AA 3R7QA 2A4ZA 1L0XB 1WE6A 2WDRB 2M8SA 3ZJTA 2JY6A 3BIID 3H7PA 1J8CA 2L0FA 3N1XC 5LXIB 2KOXA 1K50A 1V4GA 4G0NB 1N5WA 2GMIC 2KMMA 3E56A 5C1ZA 3NVWA 2J52A 1PGBA 3DOWA 2D07B 1I4HA 2WXKA 4I6PA 1WJ4A 2KLCA 1KOTA 2R61A 2W55A 2IZVB 2GBRA 3BINA 1CRKA 5J99A 2JT4B 3N1YC 2MCNB 1F77A 2GLSA 1UWXA 2JRHA 3EHVA 4KIKA 2AQ3B 1TZOA 1YMHE 1NBFC 4AM1A 3JU6A 2NBWB 5TR5A 3APDA 1U6RA 2KANA 3JVZX 3TBLD 4RF6A 1GNUA 4NJ6A 3QIJA 2JU6X 1SXTA 2EKIA 5LLIA 4LNOA 4N9F4 5E6PA 3N9YC 5FR3A 3MC9A 3OJ4B 1P9DU 3AMZA 3V3XA 4C4VB 1N62A 3VXWA 1FNWA 3MP9A 2KFKA 3U2SC 2LXCA 5AUIA 4ZHOA 1JMLA 1QF6A 1L4DB 2ZEQA 3IG3A 2H88B 3ZGZA 4DHZE 2NPTA 2KZRA 3AE6B 2WDTB 1V81A 1Z2MA 1D6EC 2Y3AA 4BOZB 5IN7A 4WWOA 4KGRA 1KM7A 3B1LX 4IWOA 4AWJA 1SGHA 2FNJB 3GOEA 4OVUA 2BS2B 4HLEA 1WGDA 2N9LA 1NVID 4W9IA 4Q2JA 3A4SC 2N9XA 2JVCA 4OZAA 2DHZA 4XYCA 3P4PB 3TJPA 4LNFA 1Y8RC 1KTKA 3NVYA 2I2YA 1FD6A 5E6OA 3GE3C 2KK8A 4GDKB 5AEKB 2XBBC 2MLBA 3IT4B 4K1RB 3Q3JA 5BYSA
chains in the Genus database with same CATH topology
2D3BA 1VA6A 4S0RA 2WHIA 1FPYA 1F52A 3LN7A 1V4GA 3LVWA 3LN6A 3LVVA 4BAXA 2QC8A 2BVCA 2UU7A 3IG5A 4HPPA 4LNOA 1HTQA 4S17A 4LNIA 2GWDA 2WGSA 3ZXRA 2GLSA 4XYCA 4ACFA 2D3AA 3NG0A 4LNFA 2GWCA 2LGSA 2D33A 2D3CA 1HTOA 1R8GA 4LNNA 3NZTA 2OJWA 3IG8A 1LGRA 3ZXVA 1TT4A 2D32A 4LNKA 1F1HA 3FKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3B A;  4S0R A;  2WHI A;  1FPY A;  1F52 A;  4BAX A;  2QC8 A;  2BVC A;  2UU7 A;  4HPP A;  4LNO A;  1HTQ A;  4S17 A;  4LNI A;  2WGS A;  3ZXR A;  2GLS A;  4XYC A;  4ACF A;  2D3A A;  3NG0 A;  4LNF A;  2LGS A;  2D3C A;  1HTO A;  4LNN A;  2OJW A;  1LGR A;  3ZXV A;  4LNK A;  1F1H A;  3FKY A; 
#chains in the Genus database with same CATH topology
 2RDB C;  3DVN U;  1I7H A;  2WXH A;  2KLG A;  2GRI A;  3AEF B;  1GUA B;  3ENE A;  3ZVV A;  4MSQ B;  3I9V 1;  4M8M A;  4ICU A;  5G2N A;  3A4R A;  2PIA A;  4MT5 A;  3QHT A;  4RGO S;  2W9N A;  1E7V A;  2WDQ B;  3MTN B;  2M19 A;  3TEZ A;  3PHW B;  3D32 A;  2KN4 A;  5G5G A;  2KT7 A;  4JPS A;  5FKA C;  4KSL C;  1UWM A;  2K8B A;  3M62 B;  2V3P A;  3RUL A;  2JWZ A;  4HVB A;  4KGT A;  1SE3 A;  1EO6 A;  2KNB A;  1QLB B;  3RN9 C;  2N1V A;  3PT2 B;  4WH4 A;  1QK1 A;  1V86 A;  1V1P A;  3UIP B;  3DHI C;  2J53 A;  1JQ4 A;  1LGR A;  4KV2 A;  2V4L A;  1WH3 A;  4NQK E;  4X57 B;  1TY0 A;  2BF8 B;  4G50 A;  1WXM A;  2ZVN A;  3VTW A;  4HJG E;  1LFD A;  1MG4 A;  2SAK A;  2CKH B;  3PZD A;  2JSV X;  2M17 A;  1J7C A;  2YLM A;  4IC7 B;  3KUZ A;  4PK1 A;  2OJR A;  4FJZ A;  3U8Z A;  4AQ7 A;  3U30 A;  2VH1 A;  3UIO B;  1FCC C;  3R8B A;  3ZJV A;  1YX5 B;  4JQW C;  5EE1 A;  3NJT A;  2M56 B;  5CHF A;  1VZ6 A;  1FIQ A;  3EFC A;  3KWV A;  4KGS A;  1E7P B;  4W9J A;  4IKG A;  1E7U A;  2BYE A;  3BVZ A;  2LXA A;  2WXN A;  3S2A A;  5AUK A;  3SR6 A;  4HPM B;  2CU1 A;  4URK A;  3BK2 A;  4BBN F;  3IG5 A;  5J9A A;  3AN1 A;  1B1Z A;  3AEG B;  4MJS B;  3N3K B;  4OHJ A;  1TIF A;  3DDC B;  4AOF A;  3X23 A;  2L00 B;  5BYQ A;  2BGF A;  5EE3 A;  4PT5 A;  1L5P A;  2IJ0 A;  1UBQ A;  3EC8 A;  3M3J A;  2QJL A;  1L2N A;  2AYO B;  2JYE A;  3PO0 A;  2XN9 C;  4GIV A;  2QMT A;  2QEJ C;  4GVY A;  4HDO A;  4HDQ A;  4A20 A;  1M94 A;  4K3C A;  4M02 A;  1C77 A;  2E6X A;  2K8H A;  2IPK D;  1NEN B;  3TSS A;  2TSS A;  1S3S G;  2GBM A;  2M4N A;  1T5X D;  3DHH C;  5FK9 C;  4MGI E;  2AEH A;  2MBB B;  3ETR A;  2FCQ A;  3NZ3 A;  2D3G A;  3NY5 A;  2PLP A;  2FUG 1;  3QWZ B;  1RLF A;  3HM6 X;  2D2Q A;  3DBR B;  4FUL A;  2MHJ A;  2QIL A;  1E0Z A;  2MEK A;  3ZNH B;  2QHO A;  4FLH A;  3ZIM A;  3DBS A;  2AQ1 B;  4DHZ B;  3O13 A;  2INN E;  3BYT B;  3IG8 A;  1SJE D;  4KDL B;  4D2K A;  1GC6 A;  2MA9 B;  5D7G A;  2WX1 A;  2I38 A;  1P50 A;  1BUI C;  1C78 A;  5AZF A;  2KDE B;  2KJH B;  4LTU A;  5JZE B;  2N9P C;  1YN3 A;  2LVO A;  1L0Y B;  4OZB A;  4USA A;  2HE7 A;  4HXD A;  3OG5 A;  4IOI E;  2LRU A;  3VUY A;  3PS6 A;  4A3O A;  2RGF A;  4ARC A;  2DZI A;  3QCA A;  1L0V B;  2L32 A;  2MBE A;  3ZLZ A;  3BWU D;  1BG0 A;  1WGH A;  2NTS A;  2AWT A;  3IT6 B;  3JW0 X;  1QOG A;  1JW9 D;  4NZL B;  1WYG A;  1YN4 A;  3ZNZ B;  3HRD D;  1V80 A;  2LGY A;  1SE4 A;  4MEL A;  2YEP B;  1OGW A;  3A9J B;  4FXC A;  1C4P A;  2JXX A;  3I57 A;  4MGZ E;  2FAZ A;  3U7D A;  1UGJ A;  2N1W A;  3N1Z C;  2KDB A;  3B08 A;  4NQL B;  3W1Y A;  4RGN A;  2MBQ A;  1SJH D;  3H7P B;  3U52 E;  4MJS A;  3EEC A;  2RDG A;  4LJP B;  4LNI A;  3ZO5 B;  2LUM A;  1E10 A;  3PRZ A;  1XO3 A;  1N61 A;  4JWS C;  3TL5 A;  4MM3 A;  2KQS A;  2KTR A;  3PLU A;  4PS7 A;  1RYJ A;  1P52 A;  1T0Y A;  4IWQ A;  1GPX A;  3W9C B;  4ANV A;  5TSS A;  5L83 A;  4QAY A;  1JRU A;  2YVC A;  1K53 A;  1IYF A;  4NJC A;  4KIK B;  3M63 B;  4ZRQ A;  2LI5 A;  1WMH A;  4WWM A;  2Z8L A;  1P7F A;  3FAH A;  1MFW A;  2BWE S;  2KFJ A;  3X0W A;  4M8N A;  1C79 A;  2JPH A;  3RMK C;  3WAM A;  1UZX B;  2M0X A;  2GI9 A;  2RR9 A;  2ZW0 A;  1WXQ A;  1J7B A;  3Q8C A;  2PJH A;  1IBX A;  3RCZ A;  2HDE A;  4RF0 A;  2XNA C;  1TS5 A;  2FUH B;  4DHJ D;  2IY0 B;  4RGM A;  1EF5 A;  4MH0 E;  3RD2 A;  3M95 A;  4DWF A;  4FBJ B;  2AL6 A;  1F9J A;  3AED B;  3VRB B;  2KFK B;  1RAX A;  5AZG A;  2MW5 A;  4W9G A;  4P1B C;  2CJO A;  1LXD A;  1WXS A;  3ZXR A;  4FHJ A;  2A5U A;  3DWG C;  2N9E B;  1WX9 A;  3AEE B;  1WM3 A;  2RPV A;  4BHL A;  2LGS A;  5J17 A;  2LMC A;  2G4D B;  1E5W A;  3BZD B;  2MBO A;  2JRI B;  3TEY A;  3ZUN A;  3APC A;  1OQY A;  3LVV A;  5IKC M;  4ICV A;  4KVG B;  4MSM B;  2ZNV C;  4B0E A;  1EWC A;  1K52 A;  2YEP F;  1Q0W B;  2QIE B;  3Q2A C;  2CJN A;  2LGI A;  2BYV E;  2W54 A;  3P63 A;  1V5T A;  1TT4 A;  1SIJ A;  2XK5 B;  5L95 C;  1VA6 A;  4ARI A;  2V3S A;  4ZYN A;  2KHW B;  1WZ0 A;  1KLU D;  4LCD E;  3QX1 A;  2WP9 B;  3L13 A;  1AWD A;  4FJY A;  4PYZ A;  3P42 A;  3DBL B;  4MDK E;  4RF7 A;  2BB5 A;  5AZH A;  2N7D A;  2IO3 B;  2WLB A;  1QOA A;  3KUC B;  4YT0 B;  1IGD A;  3U7Z A;  3T9L A;  1OQQ A;  1JRO A;  2WXL A;  2RSU A;  2WDV B;  4FN2 A;  5JHA A;  4FA6 A;  2INC C;  1I4Q A;  2CHW A;  5JHB A;  2K22 A;  1H8C A;  1TT5 B;  3AM9 A;  2VZK B;  4LNN A;  1P7E A;  3HIZ A;  1V1P B;  2DBY A;  2WXM A;  1R4M B;  4LLG M;  4W9C A;  3HK0 A;  1P3Q U;  1MJD A;  1E6E B;  3RFZ B;  4DK5 A;  1KRH A;  3BVG A;  3KUD B;  3L54 A;  4ZHP A;  2DYB A;  2LZ6 A;  3MJ5 A;  4DBG A;  1MHX A;  4ASW C;  4ZRP A;  3HHM A;  2WXG A;  3DPD A;  5HI1 A;  2VH2 A;  2K5P A;  1K8R B;  3CF6 E;  1V97 A;  4J3O D;  1PUT A;  2KJR A;  3SHQ A;  3SU8 X;  2WXI A;  5EDS A;  2KXJ A;  4J6I A;  4BVU C;  3V6E B;  1WJU A;  3W5V B;  1EM7 A;  5CX3 A;  4CQN A;  2D3B A;  3VVW B;  3ZYY X;  4WQM A;  1LO5 D;  1FM0 D;  2IO0 B;  2CS4 A;  2BW2 A;  2UWQ A;  3Q69 A;  3PRM B;  5D3D A;  1BT0 A;  2DZJ A;  2G45 B;  3W5U B;  4RFB A;  2Q5W D;  1R4N B;  4W9D A;  4FHK A;  4L1B A;  2KKC A;  1OTR B;  4HWI B;  3MJW A;  3EFU A;  1FRD A;  2BB6 A;  3RNB C;  3JYU A;  2IND C;  4GVZ A;  1WR6 E;  1E90 A;  2CRK A;  3H1U A;  4JWU C;  3Q14 C;  2XK5 A;  3V6C B;  2EKE C;  1F1H A;  4YTM B;  4AUQ C;  2C5L C;  4WJP A;  1M4V A;  2BVC A;  4OZC A;  3EUB 2;  3TMP B;  2ONQ A;  2PE6 B;  3NOB A;  2O6V A;  3M10 A;  1KLG D;  2GOW A;  4HKZ E;  2D11 A;  4EKU A;  1U4A A;  4S0R A;  1D4B A;  1WGY A;  4BAX A;  3RPF C;  2QC8 A;  1OFF A;  2LGX A;  4NNJ B;  4YXD B;  3WCQ A;  4G3X B;  3VH3 B;  4IG7 B;  2FCN A;  1FNV A;  3RNA C;  3RT3 B;  2DEN B;  2KD0 A;  1I42 A;  3EGR A;  2MX2 A;  3PZ7 A;  2KN5 A;  3AEC B;  2K3U A;  2L83 A;  4IM0 A;  1XLQ A;  4EZK A;  2CR5 A;  3E9S A;  3A1Q A;  3IFW B;  3UIN B;  2IDY A;  2GB1 A;  3Q3F A;  1YNT E;  4WJQ A;  2DWQ A;  3VRA B;  2ACZ B;  5DCN A;  3LJ3 A;  4P1C C;  3QQ8 B;  1CZP A;  3AV8 A;  3VR9 B;  2BKR B;  3UGB B;  2Y5B B;  4TKN A;  2DNF A;  3B2G A;  1WJ6 A;  3TEW A;  4JX1 C;  2RD0 A;  4IDI A;  1JRP A;  3O65 B;  1J19 A;  4N59 A;  3NZS A;  3U4E G;  2L05 A;  1CMX B;  1NYQ A;  3TUO A;  1ZGU B;  1WI0 A;  1GB1 A;  1XXG A;  3H6N A;  1WIA A;  1XLN A;  3DVN V;  1JAL A;  1RL9 A;  2X38 A;  2AL3 A;  4C7Z A;  3R2T A;  3RYT A;  4NAW B;  2FCM A;  1RWS A;  3JSV A;  4AS1 A;  1WX7 A;  1ZXH A;  3BK1 A;  1E9M A;  5DPR A;  2NTT A;  3OAW A;  1X1M A;  2ZCC A;  2R2O A;  4LK0 M;  2IGH A;  2JUO A;  3RNG C;  3NVZ A;  4EEW A;  4LDT B;  4ANU A;  4LJO B;  1TKE A;  1TS4 A;  1WRI A;  1WM2 A;  1YN5 A;  1Q5W B;  3GZN I;  2NR2 A;  1RM6 C;  1IGC A;  4A6Q A;  2EMT A;  4MM3 B;  2KWU B;  3DWM A;  3QAR A;  4BG4 A;  1EU4 A;  3P4S B;  1KLV A;  1Y56 A;  2KTR B;  4CYE A;  2PMV A;  4GW0 A;  1FFV A;  1PQS A;  1HZ5 A;  3QJZ A;  2Y5P A;  1ZP0 B;  3T3O A;  2D33 A;  1ENF A;  1YJJ A;  2KTF A;  4ZRK A;  2K1F A;  4RF9 A;  4XDD A;  1QOB A;  2MP2 B;  3L17 A;  1WE7 A;  1WMH B;  2RMM A;  4B9K A;  4KSK C;  2W3S A;  4GDL A;  4KZC A;  1OEY J;  2ZCB A;  4F1S A;  4YSX B;  5IO9 A;  2NVU I;  1GG3 A;  1I4R A;  1T0R C;  1ZE3 D;  1VDV A;  1WGG A;  2CU3 A;  1IBX B;  3RZF A;  1S1Q B;  1BXT A;  1JWB D;  4JL9 A;  1VLB A;  1MI0 A;  4ZRJ A;  2KQ4 X;  2L3Z A;  4M0W A;  2BYF A;  1E8W A;  3VQI A;  4IM2 A;  5BMH A;  3NHE B;  5D6J B;  1WGR A;  1D5X C;  1FNU A;  2K6Q A;  4Z9M A;  3NVV A;  2OJW A;  4YSY B;  4KKJ A;  3RI7 C;  3KQ4 A;  4B0M A;  4E74 A;  4FAD A;  3AXC A;  3N32 A;  4C56 C;  4YL8 A;  1RFK A;  4XC2 A;  1ZDV A;  5H8Y E;  3DVG Y;  4NJ7 A;  3B6R A;  2WQY B;  4GGQ A;  4BKT A;  2LEK A;  3J9C A;  1L6V A;  3I5J C;  3KH0 A;  2MSE D;  1RFA A;  2JX5 A;  4BKS D;  2D5G A;  1ZUD 2;  3R66 C;  2V9H A;  4IW0 A;  1N63 A;  4DDI D;  3LN7 A;  2K0P A;  5HHD G;  3AE1 B;  3P1M A;  3PTF C;  2ZPY A;  3ZRF A;  1SD0 A;  5LNK 1;  3Q8A A;  2J7Q B;  3KLS X;  1SEB D;  2MRP A;  2G1E A;  3EA6 A;  2INP E;  4PS8 A;  1LQB A;  2BS3 B;  3WAP A;  3P2B A;  1HTO A;  4HEA 1;  4TSS A;  4NAW A;  3LYY A;  3Q8F A;  1UBI A;  1OEY A;  3FKY A;  3GZN B;  1MVK A;  3QA8 A;  5HKH A;  1KFY B;  1YJI A;  1AW7 A;  2EEL A;  2KX3 A;  4K3B A;  3GE8 C;  5LXH A;  4US8 A;  1XEE A;  5KHQ A;  2J42 A;  2LVQ A;  5C2T B;  1A70 A;  1HXY D;  1YQ4 B;  3GP7 A;  3CWI A;  3AE9 B;  4RM9 A;  4US9 A;  5BMG A;  1WJN A;  2WXP A;  5H92 C;  4AJY B;  4A9A A;  2HD5 B;  2WXO A;  4M00 A;  1ISN A;  2E3T A;  2MQJ A;  3JQ3 A;  4PS3 A;  3ZRC A;  4F7Z A;  2PVG C;  2B3A A;  3VFK A;  2MP2 A;  3MHS D;  2JZ3 B;  4RH6 A;  2V0G A;  2IY1 B;  1SF0 A;  5BYR A;  1FCL A;  3Q6B A;  2J0M A;  3SFE B;  3PRP B;  5EE9 A;  3Q3N C;  1D5Z C;  2KDM A;  4HRO A;  1RRB A;  3L2D A;  3VH4 B;  1TY2 A;  1Q1O A;  2I1K A;  4ZRI A;  4CHK A;  1T0S C;  3RNE C;  4EFO A;  2G9H D;  1F2R C;  2QCZ A;  1ROE A;  2GBN A;  1XCT L;  4ANX A;  2HTM E;  1JWS D;  2EMS A;  1FPY A;  1V9J A;  2KWD A;  4GN1 A;  1UH6 A;  4EUT A;  1TS3 A;  2WGS A;  4KX6 B;  1AAR A;  2LJI A;  1IP9 A;  1UF0 A;  4HJK A;  4GB9 A;  3B2F A;  1UD7 A;  1Z5S B;  2IYD B;  2Z59 B;  1TYG B;  2LUE A;  4XGA B;  2PEA A;  3AB5 A;  1QKZ A;  2K6D B;  1QQR A;  4II2 B;  1WXV A;  1CQV A;  1KJT A;  4HKQ A;  4W9F A;  5HFY A;  1FFU A;  2PTL A;  2KMC A;  4ACF A;  5JXV A;  3AU5 A;  2C7H A;  4ZYS A;  3WA0 A;  3HUI A;  5BO4 B;  2L52 A;  1TGZ B;  4WAA A;  2PPH A;  5D3I B;  3HM3 A;  3APF A;  2KYW A;  4C7Y A;  3KW5 B;  4JE3 B;  4TQ1 A;  5HG2 A;  2LRW A;  4RCO A;  1PYW D;  4GXB A;  4C80 A;  2DYM A;  2DX5 B;  3SD5 A;  3V61 A;  1EU3 A;  4WUR A;  2DAJ A;  1ESF A;  1PFD A;  3TIX A;  4EZJ A;  2O6V B;  3NZT A;  1QIL A;  2PE9 A;  2FCS A;  2IO2 B;  2D32 A;  1EF1 A;  1EUV B;  3TCA A;  2RPQ A;  1JWM D;  4GLS C;  1H4R A;  2NMQ A;  2KO3 A;  1I4P A;  1SSN A;  1E8Y A;  4WQO B;  3Q3O C;  1ZPS A;  2V3N A;  4XZ4 A;  2D3A A;  2VZK D;  3VTV A;  1G0W A;  1XT9 B;  2NS5 A;  5MPO A;  2LFI A;  5JH5 C;  4WWP A;  3PPA A;  2OOB B;  3W2D A;  3VDZ A;  1TKG A;  2C7M B;  2WXJ A;  1WSP A;  4RMA A;  4YSZ B;  4YTN B;  4WWN A;  3A1Q B;  4F8C B;  3AE2 B;  4RM8 A;  3NS8 A;  2L7R A;  2N7E A;  2ZZP B;  3TEX A;  4BBN C;  5GMV A;  3Q3M C;  4P6V F;  2L1A A;  2ZNV B;  1FO4 A;  4W9H A;  3AUL A;  1I4X A;  3JU5 A;  1E8Z A;  1ZKH A;  3KYD D;  2LHE A;  2BQQ A;  2KVR A;  4MAC A;  2FID A;  3AE5 B;  3ZJU A;  1BML C;  1SE9 A;  4IUM B;  1SE2 A;  1IPG A;  2O2V B;  3AE4 B;  2MBH A;  1F0Z A;  1L6U A;  2GBK A;  5E6J A;  4HCN B;  4N58 A;  5DPT A;  4C00 A;  1N5X A;  3AE3 B;  2KJ6 A;  3OJ3 A;  3LVW A;  2N9K A;  4KZ0 A;  1NI3 A;  2R2Q A;  1V5O A;  1YD8 U;  2WS3 B;  3JSV B;  2Z0D B;  1VD2 A;  3WIM A;  2BYT A;  2XEW A;  2M0A A;  4WJO A;  4L23 A;  1DGJ A;  4ITK A;  3L2E A;  4A8X C;  1WGK A;  3PSE B;  2Z0E B;  4JLC A;  3LXF A;  5EE0 A;  3LB8 C;  4EZL A;  3ECI A;  4S17 A;  2X8X X;  4K7S A;  2JZP A;  4BG4 B;  1E8X A;  2VRR B;  5FR6 A;  4KDI C;  3WAL A;  3VTU A;  2OED A;  4BOS C;  4TUU A;  1C3T A;  1VR9 A;  1KF6 B;  1YX6 B;  3KYC D;  4DDG D;  2BT6 A;  4O1N A;  3V60 A;  3CST A;  1V1O A;  1V2Y A;  3B9J A;  2WX0 A;  2LD9 A;  2DAF A;  2J1Q A;  3URY A;  2MJD A;  4WJN A;  4MH8 A;  1R7S A;  1PDX A;  1DOI A;  3KVF B;  2MJE A;  1P98 A;  4GDL B;  4YWG G;  3ZQ4 A;  3A9K A;  5DPW A;  1WX8 A;  4RNA A;  2KWV B;  5D2M B;  2H89 B;  2HJ8 A;  2V4I B;  2FIF A;  2DYO A;  2NBV B;  2M1M A;  1VCB A;  3L16 A;  2BKF A;  3ZNI D;  1GB4 A;  3QK0 A;  1A5R A;  5CHV C;  2C60 A;  1M15 A;  1SBB B;  3MC8 A;  1C76 A;  4M0W B;  3AE8 B;  3JPZ A;  4W9K A;  2MWS B;  1N60 A;  1V6E A;  2LVP A;  1J7A A;  1WR1 A;  3PLV A;  2WHI A;  3QAQ A;  4TMA B;  2WXQ A;  4GMV A;  2MH7 A;  5KHO A;  1TBE A;  2DZM A;  2GWD A;  4XWT A;  2C9W B;  1QZE A;  1T3Q A;  3K9O B;  1XD3 B;  3PRE A;  1L7Y A;  3VUX A;  1PGA A;  1TKY A;  3ZTC A;  3ZW3 A;  3IAM 1;  4NAM A;  2IO1 B;  4A55 A;  3DBR I;  2L8J A;  2K9X A;  3LN6 A;  4OW0 A;  1L4Z B;  2JXT A;  2WU2 B;  3ZKJ C;  2O2V A;  3IHP C;  1VRP A;  4ZDV A;  3QC8 B;  2FE8 A;  1YOV B;  1WY8 A;  5IA7 A;  4P16 A;  2JF5 A;  3ALB A;  1YJ1 A;  4K81 A;  2D10 A;  4CO7 A;  3VR8 B;  1Q10 A;  2B76 B;  4L2Y A;  3T3N A;  5E6N A;  3P4R B;  3OWE B;  2LJ5 A;  2PKO A;  3Q8B A;  4FJV B;  4XWW A;  1FRR A;  5GXG B;  4TQ0 A;  4C4V A;  4HPL B;  4LDT D;  3V05 A;  3FIL B;  3K9P B;  3R2I A;  2IBI B;  1B9R A;  1J0G A;  1JCK B;  2CHX A;  3PVL A;  3WAN A;  2ICI A;  1C1Y B;  1T0Q C;  4HK2 A;  3WAO A;  2KMA A;  1WXA A;  4REZ A;  1GC7 A;  3NS1 A;  1WYW B;  3IXS A;  3BYY B;  4P7I A;  2JYT A;  1FXA A;  2WU5 B;  3P4Q B;  3ML9 A;  2LWP A;  2N7J A;  1UGM A;  3UQB A;  1UUP A;  4RGT A;  1ZW7 A;  3SDL C;  3DVG X;  1WRD B;  2NBU A;  1N6Z A;  1TZ1 A;  3AU4 A;  2HJ1 A;  5CHW A;  1LM8 B;  2AQ2 B;  5DPS A;  3N30 A;  5BMI A;  3W1S C;  1NDD A;  4H2A A;  2JQR B;  2L0T A;  1XQQ A;  4ANW A;  2J0K A;  1VZ7 A;  2KC1 A;  2W3R A;  4GDK A;  3L4P A;  1ZXI A;  2OHF A;  1VZ8 A;  2ZVO A;  3MHZ A;  5J18 A;  3IVF A;  5I4D A;  3VUW A;  2KC2 A;  4I6L B;  1HZ6 A;  2BBC A;  1VRA B;  4Q2R A;  2G3Q B;  4K7U A;  4MEM A;  2RDH A;  2UU7 A;  1UEL A;  4OVZ A;  1HTQ A;  1SIF A;  2CHZ A;  1CK1 A;  1FXI A;  2I1J A;  2FBW B;  4TV3 A;  1HE8 A;  3DRE A;  1NEK B;  2V1Y A;  2L76 A;  4ZOH C;  5C23 A;  5T8I A;  1QH4 A;  2BWF A;  4JGH B;  1MPE A;  2ZJD A;  1HEZ E;  3Q8E A;  2WWZ A;  1V49 A;  1YQB A;  4EE2 A;  3BY4 B;  2ZPN A;  2BS4 B;  1ZDX A;  3UI3 A;  1WWT A;  3ZDT A;  3R3M A;  2KDI A;  1XF5 L;  1C4C A;  4A3P A;  4GOC A;  1R8G A;  3NRZ A;  3CSF A;  4DQO C;  3C19 A;  3DBH I;  3VAW A;  2IGD A;  2N4F A;  3PHX B;  3CIR B;  3PZ8 A;  2J0J A;  1F52 A;  5C3J B;  1VJK A;  3FC4 A;  1XLO A;  3IBE A;  4DXF A;  2ZW1 A;  5CTR C;  1YQ3 B;  1UNS A;  1GOZ A;  4XDC A;  1P1A A;  3SEB A;  3H7S A;  4E71 A;  1OQR A;  2KAJ A;  5J2R A;  4AP4 C;  2C7N B;  4BKG A;  2JZZ A;  2KQ7 A;  3L08 A;  2KDF B;  5D94 A;  2DLB A;  4MGK E;  3AI5 A;  4BFR A;  5IP4 D;  4R3D A;  2QSD A;  3FIL A;  1P0R A;  2N0S B;  1ACC A;  4NY0 A;  1JWU D;  1DOY A;  4IM3 A;  4DXA B;  2SEB D;  3SFD B;  4A90 A;  1D3Z A;  1G6J A;  3CMM B;  2D3C A;  1HA5 A;  5IOI A;  3LDZ E;  3N20 C;  3ZNG C;  1WZ3 A;  1TS2 A;  3L0W B;  2K25 A;  1CJE A;  3ABV B;  1F2R I;  2WNM A;  3VHT C;  3DHG C;  3HVD A;  3DBL I;  2AX5 A;  3NZU A;  3T8M A;  1FEH A;  4GU2 A;  1MHH E;  3DQV A;  4NPN A;  4WIP A;  3PGE A;  1I4G A;  1ZOY B;  4LNK A;  3RZW C;  4B95 A;  4PYU A;  1DYQ A;  4UDU C;  2PVO D;  1D5M C;  4GSW A;  3IAS 1;  2NCN A;  2KAC A;  1AYF A;  4WAF A;  2REX A;  2LAS A;  2WXR A;  4B6W A;  4RF1 A;  3GS2 A;  2BPS A;  1K51 A;  1FMA D;  3H8H A;  3ZXV A;  2ON8 A;  3ZDM C;  3DCG A;  1MG8 A;  3NUH B;  3RUI B;  1R4M I;  3ZTD A;  4RF8 A;  2K8C A;  3C8Y A;  4K7W A;  1I0E A;  3AH7 A;  2HTH A;  3MC0 B;  2PW9 A;  3AEB B;  3I63 C;  2IGG A;  1WFY A;  4W9E A;  1AN8 A;  2DZK A;  3KWL A;  2KWC A;  1KH0 A;  2GBJ A;  1GJZ A;  4N6E B;  2LGD A;  1QOF A;  3UQA A;  2W82 A;  2GWC A;  3L10 B;  1QT9 A;  3UF8 A;  4HRS A;  4BZA A;  2UYZ B;  4MGY E;  1SB3 C;  5G55 A;  1FXT B;  1V8C A;  2ASQ A;  3DBH B;  4DHJ B;  2MJ3 A;  2WXF A;  3L2E B;  5IAA C;  1STE A;  2BTE A;  3GB1 A;  1NYR A;  3C0R B;  4HPP A;  2J4X A;  1T6B X;  3B0A A;  2G4S A;  3A33 B;  4YTP B;  1HQR D;  1IUE A;  4EOY A;  2NPT B;  3PV1 A;  3NG0 A;  5G5H A;  1XLP A;  3AEA B;  4II3 B;  3RNF C;  3HVZ A;  3BVM A;  3RNC C;  4E3C A;  1TJE A;  2K39 A;  1EWY C;  1NI2 A;  3OLM D;  2Y5C A;  1C9F A;  1WF9 A;  4I6N B;  1XCQ L;  3R7R A;  4W9L A;  2KX0 A;  1PGX A;  3ML8 A;  1YIW A;  1I35 A;  4GW2 A;  2LHD A;  4JIO U;  2QDF A;  2O6V D;  4DXG A;  1ET9 A;  3W1S A;  4XE0 A;  3I3T B;  4G11 A;  1DOX A;  4XX5 A;  2WYQ A;  3DRB A;  1GAQ B;  1R4N I;  3V62 A;  2KVZ A;  3ONS A;  4OVV A;  4M01 A;  4HCP B;  3A9K B;  4BKS A;  1JWA D;  4IWP A;  3MFG A;  4KKI A;  1ET6 A;  1TTN A;  4AJW A;  2JWU A;  3A9J A;  3AE7 B;  3H9D A;  1C4A A;  3R7Q A;  2A4Z A;  1L0X B;  1WE6 A;  2WDR B;  2M8S A;  3ZJT A;  2JY6 A;  3BII D;  3H7P A;  1J8C A;  2L0F A;  3N1X C;  5LXI B;  2KOX A;  1K50 A;  1V4G A;  4G0N B;  1N5W A;  2GMI C;  2KMM A;  3E56 A;  5C1Z A;  3NVW A;  2J52 A;  1PGB A;  3DOW A;  2D07 B;  1I4H A;  2WXK A;  4I6P A;  1WJ4 A;  2KLC A;  1KOT A;  2R61 A;  2W55 A;  2IZV B;  2GBR A;  3BIN A;  1CRK A;  5J99 A;  2JT4 B;  3N1Y C;  2MCN B;  1F77 A;  2GLS A;  1UWX A;  2JRH A;  3EHV A;  4KIK A;  2AQ3 B;  1TZO A;  1YMH E;  1NBF C;  4AM1 A;  3JU6 A;  2NBW B;  5TR5 A;  3APD A;  1U6R A;  2KAN A;  3JVZ X;  3TBL D;  4RF6 A;  1GNU A;  4NJ6 A;  3QIJ A;  2JU6 X;  1SXT A;  2EKI A;  5LLI A;  4LNO A;  4N9F 4;  5E6P A;  3N9Y C;  5FR3 A;  3MC9 A;  3OJ4 B;  1P9D U;  3AMZ A;  3V3X A;  4C4V B;  1N62 A;  3VXW A;  1FNW A;  3MP9 A;  2KFK A;  3U2S C;  2LXC A;  5AUI A;  4ZHO A;  1JML A;  1QF6 A;  1L4D B;  2ZEQ A;  3IG3 A;  2H88 B;  3ZGZ A;  4DHZ E;  2NPT A;  2KZR A;  3AE6 B;  2WDT B;  1V81 A;  1Z2M A;  1D6E C;  2Y3A A;  4BOZ B;  5IN7 A;  4WWO A;  4KGR A;  1KM7 A;  3B1L X;  4IWO A;  4AWJ A;  1SGH A;  2FNJ B;  3GOE A;  4OVU A;  2BS2 B;  4HLE A;  1WGD A;  2N9L A;  1NVI D;  4W9I A;  4Q2J A;  3A4S C;  2N9X A;  2JVC A;  4OZA A;  2DHZ A;  4XYC A;  3P4P B;  3TJP A;  4LNF A;  1Y8R C;  1KTK A;  3NVY A;  2I2Y A;  1FD6 A;  5E6O A;  3GE3 C;  2KK8 A;  4GDK B;  5AEK B;  2XBB C;  2MLB A;  3IT4 B;  4K1R B;  3Q3J A;  5BYS A; 
#chains in the Genus database with same CATH homology
 2D3B A;  1VA6 A;  4S0R A;  2WHI A;  1FPY A;  1F52 A;  3LN7 A;  1V4G A;  3LVW A;  3LN6 A;  3LVV A;  4BAX A;  2QC8 A;  2BVC A;  2UU7 A;  3IG5 A;  4HPP A;  4LNO A;  1HTQ A;  4S17 A;  4LNI A;  2GWD A;  2WGS A;  3ZXR A;  2GLS A;  4XYC A;  4ACF A;  2D3A A;  3NG0 A;  4LNF A;  2GWC A;  2LGS A;  2D33 A;  2D3C A;  1HTO A;  1R8G A;  4LNN A;  3NZT A;  2OJW A;  3IG8 A;  1LGR A;  3ZXV A;  1TT4 A;  2D32 A;  4LNK A;  1F1H A;  3FKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...