3FKYA

Crystal structure of the glutamine synthetase gln1deltan18 from the yeast saccharomyces cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
346
structure length
336
Chain Sequence
RGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPLKGDWNGAGCHANVSTKEMRQPGGTKYIEQAIEKLSKRHAEHIKLYGSDNDMRSMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNADMTKEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Saccharomyces cerevisiae glutamine synthetase Gln1 suggests a nanotube-like supramolecular assembly
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords Glutamine synthetase
total genus 98
structure length 336
sequence length 346
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 3fkyA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 3fkyA02
1LGRA 2BVCA 2LGSA 4LNKA 2UU7A 4LNOA 1F1HA 4S17A 4S0RA 3ZXRA 2D3CA 3ZXVA 4LNNA 4LNFA 1HTOA 2WHIA 3FKYA 2OJWA 4LNIA 2GLSA 2D3AA 4BAXA 4ACFA 3NG0A 1HTQA 2D3BA 4XYCA 1FPYA 4HPPA 2QC8A 2WGSA 1F52A
chains in the Genus database with same CATH superfamily
2E6XA 4W9CA 1LGRA 2JWZA 2KT7A 4ZRIA 3ZXVA 4PS8A 1XD3B 3GZNI 1HEZE 2PMVA 2EKIA 5FR3A 2INCC 4EZLA 1HTQA 1V80A 5LXHA 4CYEA 2RSUA 1JALA 1F52A 4HCNB 3KUDB 3PGEA 2O6VD 4W9IA 1LO5D 1SBBB 4IC7B 1B1ZA 2IY1B 2WNMA 3BVGA 1D5XC 4HCPB 4E71A 3N1ZC 3FKYA 2AQ3B 2N0SB 3URYA 3IG5A 2K25A 4I6NB 1FIQA 3R8BA 4KKJA 5L83A 1JWAD 2JSVX 3H7SA 3B2FA 3RULA 1E90A 2MBBB 3C0RB 4JGHB 4S17A 1WWTA 4BFRA 4TSSA 2TSSA 2LRWA 3ZDTA 2M19A 1E5WA 1TS3A 2MBQA 3NY5A 3R7QA 4BKSD 1K51A 2KDEB 1VA6A 2KFJA 2REXA 1P9DU 1WMHA 2KFKA 4FJYA 3ML8A 2PVOD 3UQBA 3RUIB 4F8CB 1NYQA 3AE2B 5D2MB 2DYMA 4KZCA 3PLUA 2WU5B 2KDFB 5L95C 3MHSD 4GDLA 3ZUNA 4KGTA 4OHJA 1XEEA 5BYSA 1T0RC 1VR9A 2LUMA 2K3UA 4ZYNA 3L2DA 2C9WB 1N62A 1QOBA 4HPMB 3U7DA 4W9EA 4YTMB 5CHFA 3RNBC 1U4AA 1WGRA 1JRUA 4EUTA 1WH3A 2LD9A 1CRKA 1LXDA 2BS2B 3SDLC 1HQRD 1F2RC 1OQYA 2BBCA 1UGJA 1ZDVA 2D3BA 3AEGB 2N1VA 3W1SC 4GOCA 3TMPB 4MGIE 2ICIA 3PVLA 3W1SA 1UZXB 4C7ZA 1GC6A 3V6EB 1SB3C 1ROEA 5KHOA 2WDQB 1I7HA 1YIWA 2GLSA 4USAA 3N9YC 3Q6BA 3WAMA 3ZIMA 3KVFB 1I4QA 3L2EB 3O13A 2BB5A 1WXQA 3C19A 4A6QA 1WGHA 4JQWC 3M62B 1J19A 2J4XA 2RDBC 2BWES 4B9KA 1IUEA 3MP9A 2LXCA 4LJOB 1IYFA 1SIFA 1V2YA 2PE6B 4ACFA 3DWGC 1RM6C 4PK1A 3MHZA 3DRBA 4TMAB 1AWDA 2WXPA 4TV3A 3ZXRA 2MA9B 3AH7A 2A4ZA 1NI2A 3DHHC 3A4SC 4MM3A 1CJEA 3AM9A 2XK5A 4B6WA 2DWQA 1QQRA 1Q1OA 4W9KA 3I3TB 4LCDE 1NVID 1EWYC 2NMQA 2D32A 3OLMD 1F9JA 5CTRC 1XCTL 4KDLB 4RM8A 2RMMA 1V86A 3U7ZA 3SD5A 3IG8A 2BB6A 2IGHA 1QOFA 4IM2A 1M15A 1JROA 2KK8A 3AE9B 3ML9A 2BS4B 2FAZA 4Q2JA 4MJSA 2L3ZA 3WALA 1E8YA 3MC9A 4HRSA 2KMMA 4N59A 2G3QB 4KDIC 1WGDA 4WAFA 1FMAD 2Z8LA 3HUIA 3PRPB 4G11A 4NQLB 2I1KA 3E9SA 1WE7A 1SIJA 3DVNV 4MH0E 1ZPSA 4JIOU 1N6ZA 2KLGA 1LQBA 5IA7A 4YSYB 4M8NA 2ZJDA 1A70A 3PT2B 1MJDA 2KFKB 4RFBA 2CU3A 2N7EA 5IP4D 3NVZA 3IXSA 1RFAA 2WXLA 4P1CC 2V4IB 3AXCA 2V3PA 4LLGM 4NY0A 2FIDA 1IBXA 2NCNA 1AN8A 4A9AA 3N30A 4KGSA 4MGKE 5HFYA 4A20A 2KTRB 4FADA 4MELA 2KVZA 3APFA 3JSVB 1L6VA 4K7UA 3D32A 3KWLA 5C1ZA 4DBGA 1QF6A 4W9FA 1Z2MA 5J2RA 3BVZA 3V6CB 4ZRPA 2J53A 3QX1A 1V6EA 1TZOA 1SSNA 4XGAB 3W5VB 3APDA 4K81A 1SE3A 4TQ0A 3T3OA 2NPTB 1YX5B 4ZHPA 1E8ZA 2N7DA 4XC2A 2WXFA 2W54A 4YSXB 4PS3A 5G5GA 3TUOA 3GOEA 1ZXIA 4FJVB 3V62A 3AEFB 4C4VB 2OHFA 1V1PA 1WJUA 4L23A 2WDVB 4YSZB 2AEHA 3NS1A 1I0EA 1PGAA 2CHZA 1YQ4B 4HKQA 1K8RB 2VRRB 3VTUA 2KWUB 4NNJB 3U30A 3TBLD 3M95A 2J0MA 2KWVB 1CZPA 1MVKA 1AYFA 3VXWA 5AUKA 2HD5B 4GVYA 3A4RA 1GNUA 4AWJA 1KLUD 1WXVA 1UBIA 3R3MA 4ZYSA 1N63A 3IHPC 2DAJA 4HROA 4LDTD 3WAPA 1T0SC 1Y8RC 2JY6A 1IGCA 1JMLA 1H4RA 4FHKA 1ET9A 2CS4A 1SJED 2EMTA 5EDSA 5DPSA 2IGDA 3R66C 2BYFA 3VTWA 4ZRJA 1C79A 2ZPNA 2KLCA 3NVWA 1M4VA 2OEDA 2KMAA 4GVZA 1VZ7A 1SGHA 4FN2A 4RF0A 5BYRA 1XT9B 2DZMA 3BZDB 2N9XA 3VFKA 1LFDA 2DLBA 1V4GA 3NZ3A 2HTME 2R2OA 4B0MA 2ACZB 1C4AA 2VH2A 1MHHE 2EELA 2QILA 2LGIA 3AE3B 1N61A 2PTLA 1PUTA 2Z0DB 3ZRFA 3BYYB 2IBIB 1CMXB 2D3GA 4W9JA 3RNCC 3RN9C 3ZKJC 2IDYA 3DHIC 5H8YE 1SE4A 2JXXA 3LYYA 4IWPA 3VR9B 2MWSB 3VUXA 1FNWA 1TJEA 2QDFA 4FA6A 1WXAA 3JYUA 2INNE 4IKGA 2WX0A 3LXFA 4RF8A 3U52E 3VUYA 3P63A 4HLEA 1I4GA 1WSPA 3TJPA 3O65B 3EA6A 4FULA 3QJZA 1L0VB 3PHWB 2RPQA 3BYTB 3FC4A 4ICVA 2K8BA 4KSLC 4EOYA 2JPHA 4IWOA 1PGXA 3TEYA 2LXAA 3GE3C 4FJZA 5C23A 2XK5B 4RM9A 4CQNA 1SF0A 4K3BA 2RGFA 3NZSA 1P52A 1KOTA 3NRZA 3T9LA 1YQBA 3GE8C 4HXDA 2FNJB 3DBSA 4LNFA 1PYWD 1ZOYB 3AEEB 3WIMA 2O6VB 4RMAA 3PZDA 4WWPA 2J1QA 1NENB 2IGGA 3DWMA 3OJ3A 1E7UA 4E3CA 1E7PB 3DPDA 4OZCA 4BOZB 3FAHA 1WGGA 5I4DA 4IUMB 2IO3B 3P1MA 3RMKC 3P4QB 3DBLI 4A3PA 4ZOHC 4Z9MA 1UBQA 2KDIA 2D5GA 3ENEA 4MEMA 3Q8EA 1H8CA 1D6EC 1VLBA 4M8MA 4W9HA 2K22A 2V1YA 3V60A 1FXTB 1TY0A 3FILB 1ENFA 2WXJA 1L0XB 3CSFA 1HXYD 2G4SA 1FD6A 2RDHA 4X57B 2CR5A 3IAS1 3N1YC 1IPGA 1YMHE 3VTVA 2LVQA 1D5MC 3B9JA 1VZ6A 4N9F4 3H1UA 2WGSA 1WMHB 1P98A 4I6PA 1T3QA 2LRUA 1RWSA 1NYRA 1T0YA 1F77A 2LZ6A 4OZBA 1KFYB 1HTOA 2ZVNA 1SD0A 2PKOA 1L4DB 4B0EA 4OVZA 1WGKA 3KYDD 1WX7A 2WDTB 3AE5B 2K9XA 2ZNVB 1TKEA 2XEWA 2LI5A 2YLMA 1FEHA 4YL8A 3SR6A 2JT4B 2AL3A 4LNOA 1VRPA 1WJ6A 3DVGY 3GZNB 5JHAA 4C4VA 1DYQA 4BBNF 3ZJTA 1C9FA 3Q3MC 1JWMD 1C4CA 1NBFC 5J18A 2EKEC 2N9LA 1YQ3B 2R61A 1YN4A 2MLBA 3W1YA 2W55A 2GBNA 3ZTCA 3Q14C 4IDIA 4ANWA 4MT5A 1UH6A 4RGNA 1KM7A 2QHOA 2KOXA 2MX2A 2LGDA 5LLIA 1G6JA 3KUCB 2WX1A 3A9KA 4FLHA 3NOBA 1TYGB 1OGWA 1S1QB 1ZUD2 1ESFA 4YTNB 3IFWB 1V9JA 3LVVA 2M0XA 3ZLZA 2BF8B 1WYGA 5AEKB 4BKTA 3QCAA 3H9DA 3P4RB 3PHXB 1UELA 3ZVVA 3QC8B 5JZEB 4DHZE 4GB9A 4XZ4A 3AEAB 3V61A 2D33A 1KLGD 1J0GA 5IN7A 1P0RA 2K6QA 2D2QA 4DDGD 2BKFA 4AM1A 1WI0A 4WJQA 3NVYA 4MACA 3AV8A 1EWCA 3IG3A 1BXTA 2G4DB 2W3RA 4DHZB 2GBRA 2QIEB 4ARCA 3BWUD 5G2NA 1I35A 3U2SC 1ZKHA 3Q8CA 1OFFA 2DAFA 1P1AA 3OWEB 2Z59B 1DGJA 3L0WB 2DHZA 3ZQ4A 5KHQA 4NJCA 3DDCB 2GBKA 1L6UA 3LJ3A 1KTKA 2MBOA 1TT5B 3PZ8A 1NDDA 3L54A 4C56C 2EMSA 4DXGA 3M10A 2NTTA 3T8MA 3WCQA 4JPSA 2LMCA 3LB8C 3RD2A 3L08A 1ISNA 2IO0B 2NR2A 4N58A 1R4NI 3MFGA 2KACA 2ASQA 4JE3B 4NZLB 2JF5A 2JYEA 2FCQA 3PS6A 3NS8A 4IM3A 1OQQA 5CHWA 5FKAC 4TQ1A 3NG0A 2FCMA 1GG3A 2PIAA 5AZFA 3PRMB 1EU3A 2A5UA 1XCQL 2KYWA 3AB5A 2IY0B 1L5PA 2JRIB 2W9NA 1XQQA 2M4NA 4GDLB 4ASWC 4N6EB 2BYTA 3HM6X 3Q8BA 4KKIA 2SEBD 1N5WA 2ZVOA 5E6JA 3VDZA 2DZIA 2KN5A 2L1AA 2WXOA 2W82A 1UF0A 3WA0A 1FFUA 2Y5CA 3CIRB 2LVOA 5D7GA 4EEWA 2NPTA 3P4PB 4NAWA 5CX3A 2DX5B 3HVDA 2WDRB 4PS7A 5FR6A 4II3B 3IT4B 3TEWA 1P3QU 2D11A 1ZP0B 1WZ0A 2PEAA 1Z5SB 5GMVA 1YJ1A 3IVFA 1R4MI 4WQOB 3KLSX 3N32A 3ZNHB 4LDTB 3B0AA 2KWCA 1GB4A 4WURA 1L7YA 4ZRKA 3TEXA 4AJWA 1R4NB 3GP7A 1R4MB 3R2IA 3Q8AA 4MGZE 4DXFA 3B08A 1YOVB 2IPKD 4G3XB 2K1FA 2WHIA 3RZFA 2KC2A 1E8WA 4WJOA 3RT3B 4MGYE 5TR5A 3Q3FA 4P6VF 2KXJA 4MSQB 3AEDB 4NJ7A 1I4PA 4G50A 2LASA 1HA5A 2VZKB 3GS2A 1FRDA 3A9JB 3EHVA 2HJ1A 3H7PA 4JLCA 2INDC 1E9MA 1QK1A 3KWVA 4YTPB 2H89B 1STEA 1EU4A 2KC1A 3SFEB 5E6NA 4DHJD 2HTHA 4GDKA 3B6RA 5GXGB 4YXDB 4F1SA 1D3ZA 2KHWB 3VHTC 2HDEA 3Q69A 1DOIA 2WYQA 4LK0M 3OG5A 4NJ6A 4UDUC 4W9DA 2N9PC 4WIPA 1WR1A 4EE2A 4NQKE 5T8IA 4ANUA 1HZ5A 2WXRA 1MFWA 4GMVA 4K3CA 3RNGC 3CSTA 2FCSA 2KQ4X 1T0QC 3AU5A 3EFCA 3JPZA 1GPXA 1ZE3D 2Y3AA 2K8CA 1TKGA 1XLPA 4II2B 2H88B 4OZAA 3RCZA 1WYWB 4WQMA 2E3TA 4A90A 4WAAA 1B9RA 3OAWA 4P16A 1BUIC 1FRRA 2LFIA 2AWTA 2MEKA 2YVCA 1SXTA 1JWSD 1UWXA 1RYJA 4OVVA 3UINB 2WS3B 2K39A 1TS2A 3K9PB 1PGBA 2NBVB 5LNK1 1EO6A 1T5XD 2KTFA 2V3SA 1MPEA 4AJYB 5DPTA 4GN1A 5D3IB 3I5JC 1PDXA 2NVUI 2RPVA 2WXQA 3TIXA 2O2VB 3ZO5B 1RL9A 2BGFA 1WE6A 1XXGA 2K8HA 3QWZB 1EF1A 3PO0A 4HDOA 2PLPA 4TKNA 1OEYA 2I1JA 2L32A 2KX0A 1OTRB 3P42A 5EE0A 1DOYA 2KN4A 4GXBA 5DCNA 1KF6B 4MJSB 2BW2A 4OW0A 4ANVA 1I4RA 4CHKA 4L2YA 1P7FA 1UWMA 2ZCBA 1XO3A 5G5HA 3AN1A 2GMIC 5MPOA 1TS5A 1QZEA 1SJHD 3K9OB 2XNAC 3NHEB 2WXHA 3HHMA 5AUIA 3L2EA 2FUG1 2UWQA 2CHXA 4R3DA 2JWUA 1GC7A 3ONSA 1ACCA 1YN3A 2MBEA 3VH4B 4K7SA 1Q5WB 4US8A 1NI3A 2INPE 3MC0B 1P50A 3DVGX 4KIKB 1FM0D 2AYOB 3QK0A 4D2KA 1E10A 2GWCA 3Q8FA 2JXTA 1EUVB 2ZNVC 2LUEA 4KGRA 2KX3A 4ZDVA 1GOZA 2SAKA 4BKSA 3X0WA 2I2YA 1V1PB 3EECA 2VH1A 2L00B 2MH7A 4RF6A 3QA8A 1R7SA 4OVUA 4AOFA 4GIVA 2PPHA 4JX1C 3L17A 3A9KB 3IAM1 3RI7C 2N7JA 2CRKA 4A3OA 1G0WA 1R8GA 2IO1B 1FPYA 2QSDA 1VD2A 2WWZA 2JU6X 3DBLB 4LJPB 2MQJA 3ZYYX 2CJOA 5C3JB 5G55A 2N4FA 3EUB2 3E56A 4RH6A 2WXNA 3AEBB 2L52A 4RCOA 1TT4A 4RF7A 1XF5L 4KZ0A 4WJNA 5LXIB 1WGYA 2M56B 1RFKA 2MHJA 4Q2RA 1K50A 4M0WA 3MJWA 2M8SA 4JL9A 5C2TB 4H2AA 3L4PA 1ET6A 1QOGA 4A55A 4RGTA 2AL6A 2OOBB 3HIZA 1ZGUB 3Q2AC 2KJRA 3U8ZA 3SU8X 1E6EB 1RAXA 4GU2A 5TSSA 3P2BA 4G0NB 2D07B 2BYVE 2DBYA 3I63C 4NAWB 2DENB 4WWMA 2KANA 2L05A 2R2QA 2J0JA 4TUUA 2C60A 1LM8B 1A5RA 1Y56A 4HDQA 2HJ8A 3PTFC 2JZPA 2Z0EB 2FIFA 4LNKA 2WLBA 2PW9A 4DWFA 3SHQA 3SEBA 4RGMA 3M63B 3QAQA 2ZCCA 1P7EA 2C5LC 1N5XA 3J9CA 4HEA1 3MTNB 4DK5A 3CF6E 3FILA 1GAQB 2PVGC 3H6NA 2JZZA 2D10A 1RRBA 2Y5BB 2CHWA 2M0AA 2YEPF 1X1MA 4MM3B 1DOXA 1JQ4A 1KRHA 2KJ6A 4HVBA 5BMIA 4WWOA 3BY4B 4BG4A 3ZJUA 2J52A 2G1EA 4GLSC 5AZGA 3U4EG 4M01A 4IM0A 2MJEA 4BG4B 3DREA 1CK1A 1KLVA 2MSED 3LN6A 4DQOC 3H7PB 1J8CA 1WJ4A 4MH8A 2Y5PA 3S2AA 1IGDA 2K0PA 3QIJA 1Q0WB 1D4BA 3M3JA 4US9A 3V05A 5JH5C 3ETRA 3L13A 4W9GA 2KDBA 4REZA 1F0ZA 1WR6E 3HM3A 1SE2A 5FK9C 3DHGC 1OQRA 4WH4A 1TKYA 1PFDA 2MP2A 3LN7A 2L7RA 1V5TA 2JX5A 1T6BX 4KV2A 2XBBC 2V0GA 4LTUA 3TSSA 4HJKA 1JRPA 1M94A 4RF9A 1NEKB 4XWWA 2RR9A 2J0KA 2X38A 4M02A 1PQSA 4HJGE 1JW9D 3A33B 2B3AA 3JSVA 1QLBB 1WX8A 3KQ4A 3A1QB 2AX5A 4DXAB 4B95A 3MJ5A 3AULA 1YD8U 3BK2A 2WXMA 3DBHB 3IT6B 4NPNA 4J3OD 4HKZE 1FNUA 4BZAA 2VZKD 2KVRA 2BS3B 1MG8A 3CWIA 3T3NA 2YEPB 1VRAB 2KZRA 4K1RB 1IP9A 1QOAA 4I6LB 1QKZA 1GJZA 5EE1A 2KAJA 5JHBA 4YWGG 4F7ZA 2WQYB 4W9LA 3RNFC 3VAWA 1WFYA 3DCGA 3ECIA 2GWDA 5H92C 3ALBA 1SE9A 3L16A 2LWPA 2ZPYA 2QMTA 1WRIA 5BMHA 2UYZB 1FO4A 2FBWB 1AARA 3R7RA 4PYUA 1VZ8A 3W9CB 1WY8A 3JVZX 3JQ3A 3HK0A 3ZTDA 2ZZPB 3P4SB 3TL5A 4BHLA 2AQ1B 2V4LA 1VCBA 2L83A 1UNSA 2X8XX 2KTRA 1WM2A 3JU6A 3ZJVA 1JWUD 2WXIA 5IKCM 2LJIA 2DNFA 3QQ8B 2WP9B 3VQIA 3ABVB 2BVCA 2WXKA 2BT6A 2UU7A 3APCA 2B76B 2MW5A 3NVVA 1K53A 2ZW0A 4KVGB 3RZWC 5E6OA 4XX5A 3BVMA 1J7CA 5BO4B 1I42A 2GRIA 4XE0A 3BINA 1JCKB 2OJRA 2K6DB 4DHJB 1JWBD 2QJLA 4GW0A 5HI1A 3C8YA 4YT0B 3DBHI 1D5ZC 4M00A 2N9KA 4MSMB 1MHXA 3ZNID 2G45B 3RNEC 4C00A 5E6PA 1TY2A 3AU4A 2GI9A 2D3AA 3Q3OC 3ZDMC 1ZDXA 4C80A 4C7YA 1XLQA 2IYDB 1J7AA 2DZJA 1FFVA 5IOIA 1E0ZA 4CO7A 2BWFA 5J99A 4QAYA 4ANXA 1F1HA 4S0RA 4GDKB 2O2VA 2M17A 5HHDG 1YN5A 2O6VA 1HE8A 1WM3A 3AE7B 3ZW3A 2J42A 4ITKA 3UQAA 4ZRQA 2RD0A 1GUAB 3B1LX 1FCCC 3GB1A 4BAXA 2DYBA 4EFOA 3EGRA 3DQVA 4XYCA 3VUWA 1J7BA 1TGZB 3N20C 3VRAB 2M1MA 2DZKA 1KH0A 2LGSA 2G9HD 3MC8A 3NUHB 1S3SG 5EE9A 3LDZE 1V8CA 1I4HA 3AE1B 4PT5A 3TCAA 2PJHA 1V81A 3I57A 4KSKC 1AW7A 3Q3NC 3H8HA 5HG2A 3VRBB 3UGBB 4BOSC 2JRHA 3AE4B 4RGOS 2NTSA 5DPRA 3BIID 2MJDA 4IOIE 5IAAC 2IJ0A 4IG7B 3VVWB 3NZUA 2L0FA 2DYOA 3I9V1 4GW2A 4NAMA 2N9EB 4HWIB 4XDCA 1RLFA 2JVCA 4O1NA 4ARIA 1EM7A 3JW0X 3R2TA 1V97A 3RYTA 2BQQA 3W5UB 4AP4C 1WRDB 4AUQC 5BMGA 2MJ3A 4JWSC 5D6JB 2ZW1A 1BMLC 3QHTA 2V3NA 2C7NB 2GBJA 1FXAA 3UF8A 5D3DA 2LGXA 3ZGZA 4P1BC 1CQVA 1GB1A 4WWNA 3RPFC 1XLNA 5CHVC 1C3TA 1V1OA 2KNBA 1E7VA 1C78A 5BYQA 2OJWA 5EE3A 3N1XC 3PPAA 4XWTA 2PE9A 3NZTA 1UGMA 4EZJA 1TIFA 4JWUC 5DPWA 3B2GA 4URKA 1BT0A 1WIAA 2C7HA 2WU2B 3BK1A 3EC8A 4A8XC 1YJJA 1C1YB 2D3CA 1UUPA 1OEYJ 2KMCA 3QARA 2MBHA 3DBRB 3EFUA 2LJ5A 3AECB 2BPSA 1V5OA 2JQRB 3PLVA 4AS1A 4L1BA 2KDMA 2CKHB 4BKGA 3HRDD 1YX6B 2C7MB 2IO2B 3N3KB 2GB1A 2J7QB 2LVPA 2KQSA 4LNNA 2NS5A 5AZHA 1WJNA 4BVUC 1WZ3A 3WAOA 2FUHB 4RF1A 1C77A 2HE7A 4IW0A 2MCNB 1N60A 3AMZA 1TS4A 2I38A 4IWQA 2IZVB 4FXCA 2JUOA 2XN9C 4BBNC 5D94A 3PZ7A 3UIPB 2KJHB 4HK2A 1I4XA 1WXSA 3RFZB 1MG4A 1C76A 3A9JA 3KW5B 3ZRCA 3ZNZB 3LVWA 3NJTA 3OJ4B 3AI5A 2BKRB 2JYTA 3RNAC 2RDGA 1VJKA 3PSEB 2NBWB 4EKUA 3A1QA 2LHEA 1XLOA 3W2DA 1Q10A 2CJNA 2JZ3B 3X23A 2L0TA 4WJPA 3V3XA 3AE8B 1QH4A 5HKHA 3PREA 4M0WB 4XDDA 1QILA 3PRZA 3Q3JA 1EF5A 3IBEA 5IO9A 1SEBD 5JXVA 2KD0A 3ZNGC 1K52A 4RNAA 3PV1A 4HPLB 4LNIA 1WX9A 3UIOB 4EZKA 2QC8A 1TBEA 3JU5A 4GSWA 1FXIA 5J17A 3VH3B 5J9AA 4ICUA 4AQ7A 3TEZA 2KO3A 3AE6B 1WXMA 1ZW7A 1TTNA 3WANA 2QEJC 1HZ6A 3L10B 3DBRI 1TZ1A 2L76A 2K5PA 2ON8A 4DDID 2GOWA 2GBMA 3DOWA 1FNVA 1F2RI 2LGYA 2BYEA 2LEKA 2Q5WD 1FCLA 1U6RA 1QT9A 3SFDB 4P7IA 2KWDA 3KUZA 4K7WA 1L2NA 2L8JA 4J6IA 2KQ7A 2BTEA 1YJIA 1ZXHA 2ONQA 4MDKE 2FCNA 1MI0A 4ZHOA 2LHDA 4PYZA 2NBUA 1KJTA 4GGQA 4HPPA 1IBXB 4KX6B 2N1WA 1YNTE 2MRPA 3HVZA 2AQ2B 2QCZA 2V9HA 2KKCA 4KIKA 1V49A 3KH0A 3VR8B 1BG0A 1UD7A 2CU1A 4FBJB 2ZEQA 3CMMB 3UI3A 2MP2B 1C4PA 1L0YB 2WXGA 3KYCD 4FHJA 1WF9A 4E74A 2W3SA 3DVNU 1L4ZB 1E8XA 1VDVA 2FE8A
chains in the Genus database with same CATH topology
2D32A 1LGRA 2BVCA 2LGSA 2D33A 4LNKA 2UU7A 3LN6A 4LNOA 1F1HA 4S17A 4S0RA 2GWDA 3ZXRA 1V4GA 3LVVA 2D3CA 3ZXVA 3LVWA 4LNNA 4LNFA 1HTOA 2WHIA 3FKYA 3LN7A 2OJWA 4LNIA 2GWCA 3IG5A 2GLSA 1VA6A 3IG8A 2D3AA 4BAXA 1TT4A 3NZTA 1R8GA 4ACFA 3NG0A 1HTQA 2D3BA 4XYCA 1FPYA 4HPPA 2QC8A 2WGSA 1F52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGR A;  2BVC A;  2LGS A;  4LNK A;  2UU7 A;  4LNO A;  1F1H A;  4S17 A;  4S0R A;  3ZXR A;  2D3C A;  3ZXV A;  4LNN A;  4LNF A;  1HTO A;  2WHI A;  3FKY A;  2OJW A;  4LNI A;  2GLS A;  2D3A A;  4BAX A;  4ACF A;  3NG0 A;  1HTQ A;  2D3B A;  4XYC A;  1FPY A;  4HPP A;  2QC8 A;  2WGS A;  1F52 A; 
#chains in the Genus database with same CATH topology
 2E6X A;  4W9C A;  1LGR A;  2JWZ A;  2KT7 A;  4ZRI A;  3ZXV A;  4PS8 A;  1XD3 B;  3GZN I;  1HEZ E;  2PMV A;  2EKI A;  5FR3 A;  2INC C;  4EZL A;  1HTQ A;  1V80 A;  5LXH A;  4CYE A;  2RSU A;  1JAL A;  1F52 A;  4HCN B;  3KUD B;  3PGE A;  2O6V D;  4W9I A;  1LO5 D;  1SBB B;  4IC7 B;  1B1Z A;  2IY1 B;  2WNM A;  3BVG A;  1D5X C;  4HCP B;  4E71 A;  3N1Z C;  3FKY A;  2AQ3 B;  2N0S B;  3URY A;  3IG5 A;  2K25 A;  4I6N B;  1FIQ A;  3R8B A;  4KKJ A;  5L83 A;  1JWA D;  2JSV X;  3H7S A;  3B2F A;  3RUL A;  1E90 A;  2MBB B;  3C0R B;  4JGH B;  4S17 A;  1WWT A;  4BFR A;  4TSS A;  2TSS A;  2LRW A;  3ZDT A;  2M19 A;  1E5W A;  1TS3 A;  2MBQ A;  3NY5 A;  3R7Q A;  4BKS D;  1K51 A;  2KDE B;  1VA6 A;  2KFJ A;  2REX A;  1P9D U;  1WMH A;  2KFK A;  4FJY A;  3ML8 A;  2PVO D;  3UQB A;  3RUI B;  4F8C B;  1NYQ A;  3AE2 B;  5D2M B;  2DYM A;  4KZC A;  3PLU A;  2WU5 B;  2KDF B;  5L95 C;  3MHS D;  4GDL A;  3ZUN A;  4KGT A;  4OHJ A;  1XEE A;  5BYS A;  1T0R C;  1VR9 A;  2LUM A;  2K3U A;  4ZYN A;  3L2D A;  2C9W B;  1N62 A;  1QOB A;  4HPM B;  3U7D A;  4W9E A;  4YTM B;  5CHF A;  3RNB C;  1U4A A;  1WGR A;  1JRU A;  4EUT A;  1WH3 A;  2LD9 A;  1CRK A;  1LXD A;  2BS2 B;  3SDL C;  1HQR D;  1F2R C;  1OQY A;  2BBC A;  1UGJ A;  1ZDV A;  2D3B A;  3AEG B;  2N1V A;  3W1S C;  4GOC A;  3TMP B;  4MGI E;  2ICI A;  3PVL A;  3W1S A;  1UZX B;  4C7Z A;  1GC6 A;  3V6E B;  1SB3 C;  1ROE A;  5KHO A;  2WDQ B;  1I7H A;  1YIW A;  2GLS A;  4USA A;  3N9Y C;  3Q6B A;  3WAM A;  3ZIM A;  3KVF B;  1I4Q A;  3L2E B;  3O13 A;  2BB5 A;  1WXQ A;  3C19 A;  4A6Q A;  1WGH A;  4JQW C;  3M62 B;  1J19 A;  2J4X A;  2RDB C;  2BWE S;  4B9K A;  1IUE A;  3MP9 A;  2LXC A;  4LJO B;  1IYF A;  1SIF A;  1V2Y A;  2PE6 B;  4ACF A;  3DWG C;  1RM6 C;  4PK1 A;  3MHZ A;  3DRB A;  4TMA B;  1AWD A;  2WXP A;  4TV3 A;  3ZXR A;  2MA9 B;  3AH7 A;  2A4Z A;  1NI2 A;  3DHH C;  3A4S C;  4MM3 A;  1CJE A;  3AM9 A;  2XK5 A;  4B6W A;  2DWQ A;  1QQR A;  1Q1O A;  4W9K A;  3I3T B;  4LCD E;  1NVI D;  1EWY C;  2NMQ A;  2D32 A;  3OLM D;  1F9J A;  5CTR C;  1XCT L;  4KDL B;  4RM8 A;  2RMM A;  1V86 A;  3U7Z A;  3SD5 A;  3IG8 A;  2BB6 A;  2IGH A;  1QOF A;  4IM2 A;  1M15 A;  1JRO A;  2KK8 A;  3AE9 B;  3ML9 A;  2BS4 B;  2FAZ A;  4Q2J A;  4MJS A;  2L3Z A;  3WAL A;  1E8Y A;  3MC9 A;  4HRS A;  2KMM A;  4N59 A;  2G3Q B;  4KDI C;  1WGD A;  4WAF A;  1FMA D;  2Z8L A;  3HUI A;  3PRP B;  4G11 A;  4NQL B;  2I1K A;  3E9S A;  1WE7 A;  1SIJ A;  3DVN V;  4MH0 E;  1ZPS A;  4JIO U;  1N6Z A;  2KLG A;  1LQB A;  5IA7 A;  4YSY B;  4M8N A;  2ZJD A;  1A70 A;  3PT2 B;  1MJD A;  2KFK B;  4RFB A;  2CU3 A;  2N7E A;  5IP4 D;  3NVZ A;  3IXS A;  1RFA A;  2WXL A;  4P1C C;  2V4I B;  3AXC A;  2V3P A;  4LLG M;  4NY0 A;  2FID A;  1IBX A;  2NCN A;  1AN8 A;  4A9A A;  3N30 A;  4KGS A;  4MGK E;  5HFY A;  4A20 A;  2KTR B;  4FAD A;  4MEL A;  2KVZ A;  3APF A;  3JSV B;  1L6V A;  4K7U A;  3D32 A;  3KWL A;  5C1Z A;  4DBG A;  1QF6 A;  4W9F A;  1Z2M A;  5J2R A;  3BVZ A;  3V6C B;  4ZRP A;  2J53 A;  3QX1 A;  1V6E A;  1TZO A;  1SSN A;  4XGA B;  3W5V B;  3APD A;  4K81 A;  1SE3 A;  4TQ0 A;  3T3O A;  2NPT B;  1YX5 B;  4ZHP A;  1E8Z A;  2N7D A;  4XC2 A;  2WXF A;  2W54 A;  4YSX B;  4PS3 A;  5G5G A;  3TUO A;  3GOE A;  1ZXI A;  4FJV B;  3V62 A;  3AEF B;  4C4V B;  2OHF A;  1V1P A;  1WJU A;  4L23 A;  2WDV B;  4YSZ B;  2AEH A;  3NS1 A;  1I0E A;  1PGA A;  2CHZ A;  1YQ4 B;  4HKQ A;  1K8R B;  2VRR B;  3VTU A;  2KWU B;  4NNJ B;  3U30 A;  3TBL D;  3M95 A;  2J0M A;  2KWV B;  1CZP A;  1MVK A;  1AYF A;  3VXW A;  5AUK A;  2HD5 B;  4GVY A;  3A4R A;  1GNU A;  4AWJ A;  1KLU D;  1WXV A;  1UBI A;  3R3M A;  4ZYS A;  1N63 A;  3IHP C;  2DAJ A;  4HRO A;  4LDT D;  3WAP A;  1T0S C;  1Y8R C;  2JY6 A;  1IGC A;  1JML A;  1H4R A;  4FHK A;  1ET9 A;  2CS4 A;  1SJE D;  2EMT A;  5EDS A;  5DPS A;  2IGD A;  3R66 C;  2BYF A;  3VTW A;  4ZRJ A;  1C79 A;  2ZPN A;  2KLC A;  3NVW A;  1M4V A;  2OED A;  2KMA A;  4GVZ A;  1VZ7 A;  1SGH A;  4FN2 A;  4RF0 A;  5BYR A;  1XT9 B;  2DZM A;  3BZD B;  2N9X A;  3VFK A;  1LFD A;  2DLB A;  1V4G A;  3NZ3 A;  2HTM E;  2R2O A;  4B0M A;  2ACZ B;  1C4A A;  2VH2 A;  1MHH E;  2EEL A;  2QIL A;  2LGI A;  3AE3 B;  1N61 A;  2PTL A;  1PUT A;  2Z0D B;  3ZRF A;  3BYY B;  2IBI B;  1CMX B;  2D3G A;  4W9J A;  3RNC C;  3RN9 C;  3ZKJ C;  2IDY A;  3DHI C;  5H8Y E;  1SE4 A;  2JXX A;  3LYY A;  4IWP A;  3VR9 B;  2MWS B;  3VUX A;  1FNW A;  1TJE A;  2QDF A;  4FA6 A;  1WXA A;  3JYU A;  2INN E;  4IKG A;  2WX0 A;  3LXF A;  4RF8 A;  3U52 E;  3VUY A;  3P63 A;  4HLE A;  1I4G A;  1WSP A;  3TJP A;  3O65 B;  3EA6 A;  4FUL A;  3QJZ A;  1L0V B;  3PHW B;  2RPQ A;  3BYT B;  3FC4 A;  4ICV A;  2K8B A;  4KSL C;  4EOY A;  2JPH A;  4IWO A;  1PGX A;  3TEY A;  2LXA A;  3GE3 C;  4FJZ A;  5C23 A;  2XK5 B;  4RM9 A;  4CQN A;  1SF0 A;  4K3B A;  2RGF A;  3NZS A;  1P52 A;  1KOT A;  3NRZ A;  3T9L A;  1YQB A;  3GE8 C;  4HXD A;  2FNJ B;  3DBS A;  4LNF A;  1PYW D;  1ZOY B;  3AEE B;  3WIM A;  2O6V B;  4RMA A;  3PZD A;  4WWP A;  2J1Q A;  1NEN B;  2IGG A;  3DWM A;  3OJ3 A;  1E7U A;  4E3C A;  1E7P B;  3DPD A;  4OZC A;  4BOZ B;  3FAH A;  1WGG A;  5I4D A;  4IUM B;  2IO3 B;  3P1M A;  3RMK C;  3P4Q B;  3DBL I;  4A3P A;  4ZOH C;  4Z9M A;  1UBQ A;  2KDI A;  2D5G A;  3ENE A;  4MEM A;  3Q8E A;  1H8C A;  1D6E C;  1VLB A;  4M8M A;  4W9H A;  2K22 A;  2V1Y A;  3V60 A;  1FXT B;  1TY0 A;  3FIL B;  1ENF A;  2WXJ A;  1L0X B;  3CSF A;  1HXY D;  2G4S A;  1FD6 A;  2RDH A;  4X57 B;  2CR5 A;  3IAS 1;  3N1Y C;  1IPG A;  1YMH E;  3VTV A;  2LVQ A;  1D5M C;  3B9J A;  1VZ6 A;  4N9F 4;  3H1U A;  2WGS A;  1WMH B;  1P98 A;  4I6P A;  1T3Q A;  2LRU A;  1RWS A;  1NYR A;  1T0Y A;  1F77 A;  2LZ6 A;  4OZB A;  1KFY B;  1HTO A;  2ZVN A;  1SD0 A;  2PKO A;  1L4D B;  4B0E A;  4OVZ A;  1WGK A;  3KYD D;  1WX7 A;  2WDT B;  3AE5 B;  2K9X A;  2ZNV B;  1TKE A;  2XEW A;  2LI5 A;  2YLM A;  1FEH A;  4YL8 A;  3SR6 A;  2JT4 B;  2AL3 A;  4LNO A;  1VRP A;  1WJ6 A;  3DVG Y;  3GZN B;  5JHA A;  4C4V A;  1DYQ A;  4BBN F;  3ZJT A;  1C9F A;  3Q3M C;  1JWM D;  1C4C A;  1NBF C;  5J18 A;  2EKE C;  2N9L A;  1YQ3 B;  2R61 A;  1YN4 A;  2MLB A;  3W1Y A;  2W55 A;  2GBN A;  3ZTC A;  3Q14 C;  4IDI A;  4ANW A;  4MT5 A;  1UH6 A;  4RGN A;  1KM7 A;  2QHO A;  2KOX A;  2MX2 A;  2LGD A;  5LLI A;  1G6J A;  3KUC B;  2WX1 A;  3A9K A;  4FLH A;  3NOB A;  1TYG B;  1OGW A;  1S1Q B;  1ZUD 2;  1ESF A;  4YTN B;  3IFW B;  1V9J A;  3LVV A;  2M0X A;  3ZLZ A;  2BF8 B;  1WYG A;  5AEK B;  4BKT A;  3QCA A;  3H9D A;  3P4R B;  3PHX B;  1UEL A;  3ZVV A;  3QC8 B;  5JZE B;  4DHZ E;  4GB9 A;  4XZ4 A;  3AEA B;  3V61 A;  2D33 A;  1KLG D;  1J0G A;  5IN7 A;  1P0R A;  2K6Q A;  2D2Q A;  4DDG D;  2BKF A;  4AM1 A;  1WI0 A;  4WJQ A;  3NVY A;  4MAC A;  3AV8 A;  1EWC A;  3IG3 A;  1BXT A;  2G4D B;  2W3R A;  4DHZ B;  2GBR A;  2QIE B;  4ARC A;  3BWU D;  5G2N A;  1I35 A;  3U2S C;  1ZKH A;  3Q8C A;  1OFF A;  2DAF A;  1P1A A;  3OWE B;  2Z59 B;  1DGJ A;  3L0W B;  2DHZ A;  3ZQ4 A;  5KHQ A;  4NJC A;  3DDC B;  2GBK A;  1L6U A;  3LJ3 A;  1KTK A;  2MBO A;  1TT5 B;  3PZ8 A;  1NDD A;  3L54 A;  4C56 C;  2EMS A;  4DXG A;  3M10 A;  2NTT A;  3T8M A;  3WCQ A;  4JPS A;  2LMC A;  3LB8 C;  3RD2 A;  3L08 A;  1ISN A;  2IO0 B;  2NR2 A;  4N58 A;  1R4N I;  3MFG A;  2KAC A;  2ASQ A;  4JE3 B;  4NZL B;  2JF5 A;  2JYE A;  2FCQ A;  3PS6 A;  3NS8 A;  4IM3 A;  1OQQ A;  5CHW A;  5FKA C;  4TQ1 A;  3NG0 A;  2FCM A;  1GG3 A;  2PIA A;  5AZF A;  3PRM B;  1EU3 A;  2A5U A;  1XCQ L;  2KYW A;  3AB5 A;  2IY0 B;  1L5P A;  2JRI B;  2W9N A;  1XQQ A;  2M4N A;  4GDL B;  4ASW C;  4N6E B;  2BYT A;  3HM6 X;  3Q8B A;  4KKI A;  2SEB D;  1N5W A;  2ZVO A;  5E6J A;  3VDZ A;  2DZI A;  2KN5 A;  2L1A A;  2WXO A;  2W82 A;  1UF0 A;  3WA0 A;  1FFU A;  2Y5C A;  3CIR B;  2LVO A;  5D7G A;  4EEW A;  2NPT A;  3P4P B;  4NAW A;  5CX3 A;  2DX5 B;  3HVD A;  2WDR B;  4PS7 A;  5FR6 A;  4II3 B;  3IT4 B;  3TEW A;  1P3Q U;  2D11 A;  1ZP0 B;  1WZ0 A;  2PEA A;  1Z5S B;  5GMV A;  1YJ1 A;  3IVF A;  1R4M I;  4WQO B;  3KLS X;  3N32 A;  3ZNH B;  4LDT B;  3B0A A;  2KWC A;  1GB4 A;  4WUR A;  1L7Y A;  4ZRK A;  3TEX A;  4AJW A;  1R4N B;  3GP7 A;  1R4M B;  3R2I A;  3Q8A A;  4MGZ E;  4DXF A;  3B08 A;  1YOV B;  2IPK D;  4G3X B;  2K1F A;  2WHI A;  3RZF A;  2KC2 A;  1E8W A;  4WJO A;  3RT3 B;  4MGY E;  5TR5 A;  3Q3F A;  4P6V F;  2KXJ A;  4MSQ B;  3AED B;  4NJ7 A;  1I4P A;  4G50 A;  2LAS A;  1HA5 A;  2VZK B;  3GS2 A;  1FRD A;  3A9J B;  3EHV A;  2HJ1 A;  3H7P A;  4JLC A;  2IND C;  1E9M A;  1QK1 A;  3KWV A;  4YTP B;  2H89 B;  1STE A;  1EU4 A;  2KC1 A;  3SFE B;  5E6N A;  4DHJ D;  2HTH A;  4GDK A;  3B6R A;  5GXG B;  4YXD B;  4F1S A;  1D3Z A;  2KHW B;  3VHT C;  2HDE A;  3Q69 A;  1DOI A;  2WYQ A;  4LK0 M;  3OG5 A;  4NJ6 A;  4UDU C;  4W9D A;  2N9P C;  4WIP A;  1WR1 A;  4EE2 A;  4NQK E;  5T8I A;  4ANU A;  1HZ5 A;  2WXR A;  1MFW A;  4GMV A;  4K3C A;  3RNG C;  3CST A;  2FCS A;  2KQ4 X;  1T0Q C;  3AU5 A;  3EFC A;  3JPZ A;  1GPX A;  1ZE3 D;  2Y3A A;  2K8C A;  1TKG A;  1XLP A;  4II2 B;  2H88 B;  4OZA A;  3RCZ A;  1WYW B;  4WQM A;  2E3T A;  4A90 A;  4WAA A;  1B9R A;  3OAW A;  4P16 A;  1BUI C;  1FRR A;  2LFI A;  2AWT A;  2MEK A;  2YVC A;  1SXT A;  1JWS D;  1UWX A;  1RYJ A;  4OVV A;  3UIN B;  2WS3 B;  2K39 A;  1TS2 A;  3K9P B;  1PGB A;  2NBV B;  5LNK 1;  1EO6 A;  1T5X D;  2KTF A;  2V3S A;  1MPE A;  4AJY B;  5DPT A;  4GN1 A;  5D3I B;  3I5J C;  1PDX A;  2NVU I;  2RPV A;  2WXQ A;  3TIX A;  2O2V B;  3ZO5 B;  1RL9 A;  2BGF A;  1WE6 A;  1XXG A;  2K8H A;  3QWZ B;  1EF1 A;  3PO0 A;  4HDO A;  2PLP A;  4TKN A;  1OEY A;  2I1J A;  2L32 A;  2KX0 A;  1OTR B;  3P42 A;  5EE0 A;  1DOY A;  2KN4 A;  4GXB A;  5DCN A;  1KF6 B;  4MJS B;  2BW2 A;  4OW0 A;  4ANV A;  1I4R A;  4CHK A;  4L2Y A;  1P7F A;  1UWM A;  2ZCB A;  1XO3 A;  5G5H A;  3AN1 A;  2GMI C;  5MPO A;  1TS5 A;  1QZE A;  1SJH D;  3K9O B;  2XNA C;  3NHE B;  2WXH A;  3HHM A;  5AUI A;  3L2E A;  2FUG 1;  2UWQ A;  2CHX A;  4R3D A;  2JWU A;  1GC7 A;  3ONS A;  1ACC A;  1YN3 A;  2MBE A;  3VH4 B;  4K7S A;  1Q5W B;  4US8 A;  1NI3 A;  2INP E;  3MC0 B;  1P50 A;  3DVG X;  4KIK B;  1FM0 D;  2AYO B;  3QK0 A;  4D2K A;  1E10 A;  2GWC A;  3Q8F A;  2JXT A;  1EUV B;  2ZNV C;  2LUE A;  4KGR A;  2KX3 A;  4ZDV A;  1GOZ A;  2SAK A;  4BKS A;  3X0W A;  2I2Y A;  1V1P B;  3EEC A;  2VH1 A;  2L00 B;  2MH7 A;  4RF6 A;  3QA8 A;  1R7S A;  4OVU A;  4AOF A;  4GIV A;  2PPH A;  4JX1 C;  3L17 A;  3A9K B;  3IAM 1;  3RI7 C;  2N7J A;  2CRK A;  4A3O A;  1G0W A;  1R8G A;  2IO1 B;  1FPY A;  2QSD A;  1VD2 A;  2WWZ A;  2JU6 X;  3DBL B;  4LJP B;  2MQJ A;  3ZYY X;  2CJO A;  5C3J B;  5G55 A;  2N4F A;  3EUB 2;  3E56 A;  4RH6 A;  2WXN A;  3AEB B;  2L52 A;  4RCO A;  1TT4 A;  4RF7 A;  1XF5 L;  4KZ0 A;  4WJN A;  5LXI B;  1WGY A;  2M56 B;  1RFK A;  2MHJ A;  4Q2R A;  1K50 A;  4M0W A;  3MJW A;  2M8S A;  4JL9 A;  5C2T B;  4H2A A;  3L4P A;  1ET6 A;  1QOG A;  4A55 A;  4RGT A;  2AL6 A;  2OOB B;  3HIZ A;  1ZGU B;  3Q2A C;  2KJR A;  3U8Z A;  3SU8 X;  1E6E B;  1RAX A;  4GU2 A;  5TSS A;  3P2B A;  4G0N B;  2D07 B;  2BYV E;  2DBY A;  3I63 C;  4NAW B;  2DEN B;  4WWM A;  2KAN A;  2L05 A;  2R2Q A;  2J0J A;  4TUU A;  2C60 A;  1LM8 B;  1A5R A;  1Y56 A;  4HDQ A;  2HJ8 A;  3PTF C;  2JZP A;  2Z0E B;  2FIF A;  4LNK A;  2WLB A;  2PW9 A;  4DWF A;  3SHQ A;  3SEB A;  4RGM A;  3M63 B;  3QAQ A;  2ZCC A;  1P7E A;  2C5L C;  1N5X A;  3J9C A;  4HEA 1;  3MTN B;  4DK5 A;  3CF6 E;  3FIL A;  1GAQ B;  2PVG C;  3H6N A;  2JZZ A;  2D10 A;  1RRB A;  2Y5B B;  2CHW A;  2M0A A;  2YEP F;  1X1M A;  4MM3 B;  1DOX A;  1JQ4 A;  1KRH A;  2KJ6 A;  4HVB A;  5BMI A;  4WWO A;  3BY4 B;  4BG4 A;  3ZJU A;  2J52 A;  2G1E A;  4GLS C;  5AZG A;  3U4E G;  4M01 A;  4IM0 A;  2MJE A;  4BG4 B;  3DRE A;  1CK1 A;  1KLV A;  2MSE D;  3LN6 A;  4DQO C;  3H7P B;  1J8C A;  1WJ4 A;  4MH8 A;  2Y5P A;  3S2A A;  1IGD A;  2K0P A;  3QIJ A;  1Q0W B;  1D4B A;  3M3J A;  4US9 A;  3V05 A;  5JH5 C;  3ETR A;  3L13 A;  4W9G A;  2KDB A;  4REZ A;  1F0Z A;  1WR6 E;  3HM3 A;  1SE2 A;  5FK9 C;  3DHG C;  1OQR A;  4WH4 A;  1TKY A;  1PFD A;  2MP2 A;  3LN7 A;  2L7R A;  1V5T A;  2JX5 A;  1T6B X;  4KV2 A;  2XBB C;  2V0G A;  4LTU A;  3TSS A;  4HJK A;  1JRP A;  1M94 A;  4RF9 A;  1NEK B;  4XWW A;  2RR9 A;  2J0K A;  2X38 A;  4M02 A;  1PQS A;  4HJG E;  1JW9 D;  3A33 B;  2B3A A;  3JSV A;  1QLB B;  1WX8 A;  3KQ4 A;  3A1Q B;  2AX5 A;  4DXA B;  4B95 A;  3MJ5 A;  3AUL A;  1YD8 U;  3BK2 A;  2WXM A;  3DBH B;  3IT6 B;  4NPN A;  4J3O D;  4HKZ E;  1FNU A;  4BZA A;  2VZK D;  2KVR A;  2BS3 B;  1MG8 A;  3CWI A;  3T3N A;  2YEP B;  1VRA B;  2KZR A;  4K1R B;  1IP9 A;  1QOA A;  4I6L B;  1QKZ A;  1GJZ A;  5EE1 A;  2KAJ A;  5JHB A;  4YWG G;  4F7Z A;  2WQY B;  4W9L A;  3RNF C;  3VAW A;  1WFY A;  3DCG A;  3ECI A;  2GWD A;  5H92 C;  3ALB A;  1SE9 A;  3L16 A;  2LWP A;  2ZPY A;  2QMT A;  1WRI A;  5BMH A;  2UYZ B;  1FO4 A;  2FBW B;  1AAR A;  3R7R A;  4PYU A;  1VZ8 A;  3W9C B;  1WY8 A;  3JVZ X;  3JQ3 A;  3HK0 A;  3ZTD A;  2ZZP B;  3P4S B;  3TL5 A;  4BHL A;  2AQ1 B;  2V4L A;  1VCB A;  2L83 A;  1UNS A;  2X8X X;  2KTR A;  1WM2 A;  3JU6 A;  3ZJV A;  1JWU D;  2WXI A;  5IKC M;  2LJI A;  2DNF A;  3QQ8 B;  2WP9 B;  3VQI A;  3ABV B;  2BVC A;  2WXK A;  2BT6 A;  2UU7 A;  3APC A;  2B76 B;  2MW5 A;  3NVV A;  1K53 A;  2ZW0 A;  4KVG B;  3RZW C;  5E6O A;  4XX5 A;  3BVM A;  1J7C A;  5BO4 B;  1I42 A;  2GRI A;  4XE0 A;  3BIN A;  1JCK B;  2OJR A;  2K6D B;  4DHJ B;  1JWB D;  2QJL A;  4GW0 A;  5HI1 A;  3C8Y A;  4YT0 B;  3DBH I;  1D5Z C;  4M00 A;  2N9K A;  4MSM B;  1MHX A;  3ZNI D;  2G45 B;  3RNE C;  4C00 A;  5E6P A;  1TY2 A;  3AU4 A;  2GI9 A;  2D3A A;  3Q3O C;  3ZDM C;  1ZDX A;  4C80 A;  4C7Y A;  1XLQ A;  2IYD B;  1J7A A;  2DZJ A;  1FFV A;  5IOI A;  1E0Z A;  4CO7 A;  2BWF A;  5J99 A;  4QAY A;  4ANX A;  1F1H A;  4S0R A;  4GDK B;  2O2V A;  2M17 A;  5HHD G;  1YN5 A;  2O6V A;  1HE8 A;  1WM3 A;  3AE7 B;  3ZW3 A;  2J42 A;  4ITK A;  3UQA A;  4ZRQ A;  2RD0 A;  1GUA B;  3B1L X;  1FCC C;  3GB1 A;  4BAX A;  2DYB A;  4EFO A;  3EGR A;  3DQV A;  4XYC A;  3VUW A;  1J7B A;  1TGZ B;  3N20 C;  3VRA B;  2M1M A;  2DZK A;  1KH0 A;  2LGS A;  2G9H D;  3MC8 A;  3NUH B;  1S3S G;  5EE9 A;  3LDZ E;  1V8C A;  1I4H A;  3AE1 B;  4PT5 A;  3TCA A;  2PJH A;  1V81 A;  3I57 A;  4KSK C;  1AW7 A;  3Q3N C;  3H8H A;  5HG2 A;  3VRB B;  3UGB B;  4BOS C;  2JRH A;  3AE4 B;  4RGO S;  2NTS A;  5DPR A;  3BII D;  2MJD A;  4IOI E;  5IAA C;  2IJ0 A;  4IG7 B;  3VVW B;  3NZU A;  2L0F A;  2DYO A;  3I9V 1;  4GW2 A;  4NAM A;  2N9E B;  4HWI B;  4XDC A;  1RLF A;  2JVC A;  4O1N A;  4ARI A;  1EM7 A;  3JW0 X;  3R2T A;  1V97 A;  3RYT A;  2BQQ A;  3W5U B;  4AP4 C;  1WRD B;  4AUQ C;  5BMG A;  2MJ3 A;  4JWS C;  5D6J B;  2ZW1 A;  1BML C;  3QHT A;  2V3N A;  2C7N B;  2GBJ A;  1FXA A;  3UF8 A;  5D3D A;  2LGX A;  3ZGZ A;  4P1B C;  1CQV A;  1GB1 A;  4WWN A;  3RPF C;  1XLN A;  5CHV C;  1C3T A;  1V1O A;  2KNB A;  1E7V A;  1C78 A;  5BYQ A;  2OJW A;  5EE3 A;  3N1X C;  3PPA A;  4XWT A;  2PE9 A;  3NZT A;  1UGM A;  4EZJ A;  1TIF A;  4JWU C;  5DPW A;  3B2G A;  4URK A;  1BT0 A;  1WIA A;  2C7H A;  2WU2 B;  3BK1 A;  3EC8 A;  4A8X C;  1YJJ A;  1C1Y B;  2D3C A;  1UUP A;  1OEY J;  2KMC A;  3QAR A;  2MBH A;  3DBR B;  3EFU A;  2LJ5 A;  3AEC B;  2BPS A;  1V5O A;  2JQR B;  3PLV A;  4AS1 A;  4L1B A;  2KDM A;  2CKH B;  4BKG A;  3HRD D;  1YX6 B;  2C7M B;  2IO2 B;  3N3K B;  2GB1 A;  2J7Q B;  2LVP A;  2KQS A;  4LNN A;  2NS5 A;  5AZH A;  1WJN A;  4BVU C;  1WZ3 A;  3WAO A;  2FUH B;  4RF1 A;  1C77 A;  2HE7 A;  4IW0 A;  2MCN B;  1N60 A;  3AMZ A;  1TS4 A;  2I38 A;  4IWQ A;  2IZV B;  4FXC A;  2JUO A;  2XN9 C;  4BBN C;  5D94 A;  3PZ7 A;  3UIP B;  2KJH B;  4HK2 A;  1I4X A;  1WXS A;  3RFZ B;  1MG4 A;  1C76 A;  3A9J A;  3KW5 B;  3ZRC A;  3ZNZ B;  3LVW A;  3NJT A;  3OJ4 B;  3AI5 A;  2BKR B;  2JYT A;  3RNA C;  2RDG A;  1VJK A;  3PSE B;  2NBW B;  4EKU A;  3A1Q A;  2LHE A;  1XLO A;  3W2D A;  1Q10 A;  2CJN A;  2JZ3 B;  3X23 A;  2L0T A;  4WJP A;  3V3X A;  3AE8 B;  1QH4 A;  5HKH A;  3PRE A;  4M0W B;  4XDD A;  1QIL A;  3PRZ A;  3Q3J A;  1EF5 A;  3IBE A;  5IO9 A;  1SEB D;  5JXV A;  2KD0 A;  3ZNG C;  1K52 A;  4RNA A;  3PV1 A;  4HPL B;  4LNI A;  1WX9 A;  3UIO B;  4EZK A;  2QC8 A;  1TBE A;  3JU5 A;  4GSW A;  1FXI A;  5J17 A;  3VH3 B;  5J9A A;  4ICU A;  4AQ7 A;  3TEZ A;  2KO3 A;  3AE6 B;  1WXM A;  1ZW7 A;  1TTN A;  3WAN A;  2QEJ C;  1HZ6 A;  3L10 B;  3DBR I;  1TZ1 A;  2L76 A;  2K5P A;  2ON8 A;  4DDI D;  2GOW A;  2GBM A;  3DOW A;  1FNV A;  1F2R I;  2LGY A;  2BYE A;  2LEK A;  2Q5W D;  1FCL A;  1U6R A;  1QT9 A;  3SFD B;  4P7I A;  2KWD A;  3KUZ A;  4K7W A;  1L2N A;  2L8J A;  4J6I A;  2KQ7 A;  2BTE A;  1YJI A;  1ZXH A;  2ONQ A;  4MDK E;  2FCN A;  1MI0 A;  4ZHO A;  2LHD A;  4PYZ A;  2NBU A;  1KJT A;  4GGQ A;  4HPP A;  1IBX B;  4KX6 B;  2N1W A;  1YNT E;  2MRP A;  3HVZ A;  2AQ2 B;  2QCZ A;  2V9H A;  2KKC A;  4KIK A;  1V49 A;  3KH0 A;  3VR8 B;  1BG0 A;  1UD7 A;  2CU1 A;  4FBJ B;  2ZEQ A;  3CMM B;  3UI3 A;  2MP2 B;  1C4P A;  1L0Y B;  2WXG A;  3KYC D;  4FHJ A;  1WF9 A;  4E74 A;  2W3S A;  3DVN U;  1L4Z B;  1E8X A;  1VDV A;  2FE8 A; 
#chains in the Genus database with same CATH homology
 2D32 A;  1LGR A;  2BVC A;  2LGS A;  2D33 A;  4LNK A;  2UU7 A;  3LN6 A;  4LNO A;  1F1H A;  4S17 A;  4S0R A;  2GWD A;  3ZXR A;  1V4G A;  3LVV A;  2D3C A;  3ZXV A;  3LVW A;  4LNN A;  4LNF A;  1HTO A;  2WHI A;  3FKY A;  3LN7 A;  2OJW A;  4LNI A;  2GWC A;  3IG5 A;  2GLS A;  1VA6 A;  3IG8 A;  2D3A A;  4BAX A;  1TT4 A;  3NZT A;  1R8G A;  4ACF A;  3NG0 A;  1HTQ A;  2D3B A;  4XYC A;  1FPY A;  4HPP A;  2QC8 A;  2WGS A;  1F52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...