2CRKA

Muscle creatine kinase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
374
structure length
365
Chain Sequence
NKYKLNYKSEEEYPDLSKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDDLDPHYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rabbit muscle creatine kinase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (CREATINE KINASE)
total genus 117
structure length 365
sequence length 374
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 2crkA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2crkA02
4RF8A 4RF7A 4BG4A 2WHIA 4BHLA 1P52A 5J9AA 3B6RA 4RF6A 4AM1A 1RL9A 2BVCA 1P50A 3JU5A 4ACFA 4Q2RA 4GW0A 4BG4B 1F1HA 1FPYA 3DREA 1CRKA 1QK1A 3DRBA 3L2EA 4GVZA 1HTQA 4RF9A 2CRKA 4LNIA 4GW2A 4HPPA 3NG0A 1QH4A 1I0EA 3JU6A 4GVYA 3ZXVA 3JQ3A 1HTOA 2GLSA 2LGSA 1M15A 1SD0A 3L2EB 3M10A 1LGRA 3JPZA 3L2DA 1G0WA 4S17A 1VRPA 2WGSA 4S0RA 3ZXRA 5J99A 4LNOA 1F52A 4LNFA 2J1QA 1U6RA 1BG0A 4LNKA 4XYCA 4Z9MA 4LNNA
chains in the Genus database with same CATH superfamily
4BG4A 2GWDA 1RL9A 2D3CA 2OJWA 4GW0A 1R8GA 3DREA 2D33A 2D3BA 4LNIA 4HPPA 1V4GA 1HTOA 2D32A 1SD0A 3L2EB 2GWCA 3LVVA 4LNFA 1U6RA 4Z9MA 2UU7A 4BHLA 2QC8A 4AM1A 3JU5A 4BG4B 1QK1A 1HTQA 4RF9A 1TT4A 4GVYA 3LN6A 1M15A 3M10A 3L2DA 4S17A 4S0RA 1VRPA 2WGSA 4LNOA 1BG0A 4LNKA 4ACFA 3IG8A 2WHIA 5J9AA 3B6RA 4RF6A 2BVCA 1P50A 4Q2RA 3IG5A 1F1HA 1FPYA 1CRKA 3DRBA 4GVZA 2CRKA 4GW2A 3NG0A 3ZXVA 1I0EA 3LN7A 3JQ3A 2GLSA 3FKYA 3JPZA 3ZXRA 5J99A 3LVWA 2J1QA 4XYCA 4RF8A 4RF7A 1P52A 4BAXA 1VA6A 3NZTA 3L2EA 1QH4A 3JU6A 2LGSA 1LGRA 1G0WA 1F52A 2D3AA 4LNNA
chains in the Genus database with same CATH topology
4RF8A 4RF7A 4BG4A 2WHIA 4BHLA 1P52A 5J9AA 3B6RA 4RF6A 4AM1A 1RL9A 2BVCA 1P50A 3JU5A 4ACFA 4Q2RA 4GW0A 4BG4B 1F1HA 1FPYA 3DREA 1CRKA 1QK1A 3DRBA 3L2EA 4GVZA 1HTQA 4RF9A 2CRKA 4LNIA 4GW2A 4HPPA 3NG0A 1QH4A 1I0EA 3JU6A 4GVYA 3ZXVA 3JQ3A 1HTOA 2GLSA 2LGSA 1M15A 1SD0A 3L2EB 3M10A 1LGRA 3JPZA 3L2DA 1G0WA 4S17A 1VRPA 2WGSA 4S0RA 3ZXRA 5J99A 4LNOA 1F52A 4LNFA 2J1QA 1U6RA 1BG0A 4LNKA 4XYCA 4Z9MA 4LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF8 A;  4RF7 A;  4BG4 A;  2WHI A;  4BHL A;  1P52 A;  5J9A A;  3B6R A;  4RF6 A;  4AM1 A;  1RL9 A;  2BVC A;  1P50 A;  3JU5 A;  4ACF A;  4Q2R A;  4GW0 A;  4BG4 B;  1F1H A;  1FPY A;  3DRE A;  1CRK A;  1QK1 A;  3DRB A;  3L2E A;  4GVZ A;  1HTQ A;  4RF9 A;  2CRK A;  4LNI A;  4GW2 A;  4HPP A;  3NG0 A;  1QH4 A;  1I0E A;  3JU6 A;  4GVY A;  3ZXV A;  3JQ3 A;  1HTO A;  2GLS A;  2LGS A;  1M15 A;  1SD0 A;  3L2E B;  3M10 A;  1LGR A;  3JPZ A;  3L2D A;  1G0W A;  4S17 A;  1VRP A;  2WGS A;  4S0R A;  3ZXR A;  5J99 A;  4LNO A;  1F52 A;  4LNF A;  2J1Q A;  1U6R A;  1BG0 A;  4LNK A;  4XYC A;  4Z9M A;  4LNN A; 
#chains in the Genus database with same CATH topology
 4BG4 A;  2GWD A;  1RL9 A;  2D3C A;  2OJW A;  4GW0 A;  1R8G A;  3DRE A;  2D33 A;  2D3B A;  4LNI A;  4HPP A;  1V4G A;  1HTO A;  2D32 A;  1SD0 A;  3L2E B;  2GWC A;  3LVV A;  4LNF A;  1U6R A;  4Z9M A;  2UU7 A;  4BHL A;  2QC8 A;  4AM1 A;  3JU5 A;  4BG4 B;  1QK1 A;  1HTQ A;  4RF9 A;  1TT4 A;  4GVY A;  3LN6 A;  1M15 A;  3M10 A;  3L2D A;  4S17 A;  4S0R A;  1VRP A;  2WGS A;  4LNO A;  1BG0 A;  4LNK A;  4ACF A;  3IG8 A;  2WHI A;  5J9A A;  3B6R A;  4RF6 A;  2BVC A;  1P50 A;  4Q2R A;  3IG5 A;  1F1H A;  1FPY A;  1CRK A;  3DRB A;  4GVZ A;  2CRK A;  4GW2 A;  3NG0 A;  3ZXV A;  1I0E A;  3LN7 A;  3JQ3 A;  2GLS A;  3FKY A;  3JPZ A;  3ZXR A;  5J99 A;  3LVW A;  2J1Q A;  4XYC A;  4RF8 A;  4RF7 A;  1P52 A;  4BAX A;  1VA6 A;  3NZT A;  3L2E A;  1QH4 A;  3JU6 A;  2LGS A;  1LGR A;  1G0W A;  1F52 A;  2D3A A;  4LNN A; 
#chains in the Genus database with same CATH homology
 4RF8 A;  4RF7 A;  4BG4 A;  2WHI A;  4BHL A;  1P52 A;  5J9A A;  3B6R A;  4RF6 A;  4AM1 A;  1RL9 A;  2BVC A;  1P50 A;  3JU5 A;  4ACF A;  4Q2R A;  4GW0 A;  4BG4 B;  1F1H A;  1FPY A;  3DRE A;  1CRK A;  1QK1 A;  3DRB A;  3L2E A;  4GVZ A;  1HTQ A;  4RF9 A;  2CRK A;  4LNI A;  4GW2 A;  4HPP A;  3NG0 A;  1QH4 A;  1I0E A;  3JU6 A;  4GVY A;  3ZXV A;  3JQ3 A;  1HTO A;  2GLS A;  2LGS A;  1M15 A;  1SD0 A;  3L2E B;  3M10 A;  1LGR A;  3JPZ A;  3L2D A;  1G0W A;  4S17 A;  1VRP A;  2WGS A;  4S0R A;  3ZXR A;  5J99 A;  4LNO A;  1F52 A;  4LNF A;  2J1Q A;  1U6R A;  1BG0 A;  4LNK A;  4XYC A;  4Z9M A;  4LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...