2CRKA

Muscle creatine kinase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
374
structure length
365
Chain Sequence
b'NKYKLNYKSEEEYPDLSKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDDLDPHYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CREATINE KINASE)
publication title Crystal structure of rabbit muscle creatine kinase.
pubmed doi rcsb
molecule tags Transferase
total genus 117
structure length 365
sequence length 374
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 2crkA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2crkA02
1U6RA 2J1QA 3DRBA 4BHLA 4AM1A 1LGRA 4LNFA 4Q2RA 4BG4B 1HTQA 4Z9MA 1FPYA 2BVCA 3JU5A 4S0RA 4GW0A 3JPZA 4RF8A 1HTOA 2LGSA 4GVZA 3L2EB 1F1HA 4LNKA 1CRKA 3M10A 4LNIA 3JQ3A 5J9AA 1VRPA 1BG0A 4RF7A 1P50A 1I0EA 3ZXRA 4LNOA 4GW2A 4S17A 4BG4A 4ACFA 2GLSA 1G0WA 1RL9A 5J99A 4RF6A 1P52A 3B6RA 1M15A 1QK1A 3DREA 4HPPA 4RF9A 4LNNA 2WGSA 3L2EA 4GVYA 3NG0A 3JU6A 2WHIA 3ZXVA 1SD0A 2CRKA 1F52A 1QH4A 4XYCA 3L2DA
chains in the Genus database with same CATH superfamily
3LVWA 1LGRA 4BG4B 3IG5A 4Z9MA 1FPYA 3JU5A 4GW0A 3FKYA 3LVVA 3L2EB 3NZTA 4LNIA 5J9AA 1BG0A 4RF7A 1I0EA 4LNOA 4ACFA 2GLSA 3DREA 1M15A 4LNNA 2QC8A 3JU6A 1F52A 3LN6A 4AM1A 4LNFA 4Q2RA 4S0RA 4RF8A 3M10A 3JQ3A 2D33A 3ZXRA 3LN7A 1G0WA 1RL9A 5J99A 2D3AA 4HPPA 1TT4A 3IG8A 3ZXVA 1SD0A 3L2DA 1HTQA 1U6RA 2J1QA 3DRBA 2D3CA 1HTOA 2UU7A 2LGSA 4GVZA 4LNKA 1CRKA 1R8GA 1P50A 4GW2A 4S17A 4BG4A 2D3BA 4RF6A 3B6RA 2WGSA 3NG0A 2OJWA 2CRKA 2GWCA 1V4GA 4BHLA 2BVCA 2D32A 3JPZA 1F1HA 1VA6A 1VRPA 2GWDA 1P52A 1QK1A 4RF9A 4BAXA 3L2EA 4GVYA 2WHIA 1QH4A 4XYCA
chains in the Genus database with same CATH topology
1U6RA 2J1QA 3DRBA 4BHLA 4AM1A 1LGRA 4LNFA 4Q2RA 4BG4B 1HTQA 4Z9MA 1FPYA 2BVCA 3JU5A 4S0RA 4GW0A 3JPZA 4RF8A 1HTOA 2LGSA 4GVZA 3L2EB 1F1HA 4LNKA 1CRKA 3M10A 4LNIA 3JQ3A 5J9AA 1VRPA 1BG0A 4RF7A 1P50A 1I0EA 3ZXRA 4LNOA 4GW2A 4S17A 4BG4A 4ACFA 2GLSA 1G0WA 1RL9A 5J99A 4RF6A 1P52A 3B6RA 1M15A 1QK1A 3DREA 4HPPA 4RF9A 4LNNA 2WGSA 3L2EA 4GVYA 3NG0A 3JU6A 2WHIA 3ZXVA 1SD0A 2CRKA 1F52A 1QH4A 4XYCA 3L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U6R A;  2J1Q A;  3DRB A;  4BHL A;  4AM1 A;  1LGR A;  4LNF A;  4Q2R A;  4BG4 B;  1HTQ A;  4Z9M A;  1FPY A;  2BVC A;  3JU5 A;  4S0R A;  4GW0 A;  3JPZ A;  4RF8 A;  1HTO A;  2LGS A;  4GVZ A;  3L2E B;  1F1H A;  4LNK A;  1CRK A;  3M10 A;  4LNI A;  3JQ3 A;  5J9A A;  1VRP A;  1BG0 A;  4RF7 A;  1P50 A;  1I0E A;  3ZXR A;  4LNO A;  4GW2 A;  4S17 A;  4BG4 A;  4ACF A;  2GLS A;  1G0W A;  1RL9 A;  5J99 A;  4RF6 A;  1P52 A;  3B6R A;  1M15 A;  1QK1 A;  3DRE A;  4HPP A;  4RF9 A;  4LNN A;  2WGS A;  3L2E A;  4GVY A;  3NG0 A;  3JU6 A;  2WHI A;  3ZXV A;  1SD0 A;  2CRK A;  1F52 A;  1QH4 A;  4XYC A;  3L2D A; 
#chains in the Genus database with same CATH topology
 3LVW A;  1LGR A;  4BG4 B;  3IG5 A;  4Z9M A;  1FPY A;  3JU5 A;  4GW0 A;  3FKY A;  3LVV A;  3L2E B;  3NZT A;  4LNI A;  5J9A A;  1BG0 A;  4RF7 A;  1I0E A;  4LNO A;  4ACF A;  2GLS A;  3DRE A;  1M15 A;  4LNN A;  2QC8 A;  3JU6 A;  1F52 A;  3LN6 A;  4AM1 A;  4LNF A;  4Q2R A;  4S0R A;  4RF8 A;  3M10 A;  3JQ3 A;  2D33 A;  3ZXR A;  3LN7 A;  1G0W A;  1RL9 A;  5J99 A;  2D3A A;  4HPP A;  1TT4 A;  3IG8 A;  3ZXV A;  1SD0 A;  3L2D A;  1HTQ A;  1U6R A;  2J1Q A;  3DRB A;  2D3C A;  1HTO A;  2UU7 A;  2LGS A;  4GVZ A;  4LNK A;  1CRK A;  1R8G A;  1P50 A;  4GW2 A;  4S17 A;  4BG4 A;  2D3B A;  4RF6 A;  3B6R A;  2WGS A;  3NG0 A;  2OJW A;  2CRK A;  2GWC A;  1V4G A;  4BHL A;  2BVC A;  2D32 A;  3JPZ A;  1F1H A;  1VA6 A;  1VRP A;  2GWD A;  1P52 A;  1QK1 A;  4RF9 A;  4BAX A;  3L2E A;  4GVY A;  2WHI A;  1QH4 A;  4XYC A; 
#chains in the Genus database with same CATH homology
 1U6R A;  2J1Q A;  3DRB A;  4BHL A;  4AM1 A;  1LGR A;  4LNF A;  4Q2R A;  4BG4 B;  1HTQ A;  4Z9M A;  1FPY A;  2BVC A;  3JU5 A;  4S0R A;  4GW0 A;  3JPZ A;  4RF8 A;  1HTO A;  2LGS A;  4GVZ A;  3L2E B;  1F1H A;  4LNK A;  1CRK A;  3M10 A;  4LNI A;  3JQ3 A;  5J9A A;  1VRP A;  1BG0 A;  4RF7 A;  1P50 A;  1I0E A;  3ZXR A;  4LNO A;  4GW2 A;  4S17 A;  4BG4 A;  4ACF A;  2GLS A;  1G0W A;  1RL9 A;  5J99 A;  4RF6 A;  1P52 A;  3B6R A;  1M15 A;  1QK1 A;  3DRE A;  4HPP A;  4RF9 A;  4LNN A;  2WGS A;  3L2E A;  4GVY A;  3NG0 A;  3JU6 A;  2WHI A;  3ZXV A;  1SD0 A;  2CRK A;  1F52 A;  1QH4 A;  4XYC A;  3L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...