4BHLA

Crystal structure of litopenaeus vannamei arginine kinase in binary complex with arginine
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
348
Chain Sequence
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANEEKLEEVAGKYNLQVRGTGGIYDISNKRRMGLTEFQAVKEMEDGILELIKIEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Shrimp Arginine Kinase in Binary Complex with Arginine-A Molecular View of the Phosphagen Precursor Binding to the Enzyme.
pubmed doi rcsb
molecule tags Transferase
molecule keywords ARGININE KINASE
total genus 124
structure length 348
sequence length 356
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4bhlA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4bhlA02
1CRKA 1HTOA 4S0RA 4RF9A 4LNOA 1M15A 4LNFA 1I0EA 4BHLA 3JU6A 2CRKA 4BG4A 1G0WA 3DRBA 4ACFA 4Q2RA 4RF8A 5J99A 3L2EB 4XYCA 3JQ3A 1VRPA 2GLSA 3JPZA 3DREA 5J9AA 4Z9MA 4GVZA 4RF7A 2LGSA 3ZXVA 4BG4B 3JU5A 1BG0A 4S17A 1FPYA 1F52A 1SD0A 1LGRA 4LNIA 4GVYA 1F1HA 1HTQA 1P52A 1P50A 3ZXRA 4GW2A 2WGSA 1RL9A 4GW0A 4LNKA 3B6RA 4RF6A 3NG0A 1QH4A 4AM1A 2WHIA 2J1QA 3L2EA 1QK1A 3L2DA 4HPPA 2BVCA 3M10A 1U6RA 4LNNA
chains in the Genus database with same CATH superfamily
1CRKA 1HTOA 4RF9A 4BHLA 2UU7A 1G0WA 3DRBA 2D3BA 4XYCA 3DREA 3ZXVA 3JU5A 1F52A 1LGRA 1U6RA 1P50A 2GWDA 2D3AA 4GW2A 3LN6A 2WHIA 4RF6A 1QK1A 4HPPA 2BVCA 1I0EA 2D3CA 2CRKA 2QC8A 4BG4A 4RF8A 3JQ3A 5J9AA 1HTQA 1F1HA 3ZXRA 3IG8A 1RL9A 3B6RA 1TT4A 1M15A 4LNFA 5J99A 3L2EB 2OJWA 1VRPA 3JPZA 4GVZA 4RF7A 2LGSA 1V4GA 3LN7A 3LVVA 1P52A 2WGSA 1QH4A 2J1QA 4LNOA 3L2DA 4S17A 4LNNA 4S0RA 3JU6A 3FKYA 3NZTA 4ACFA 4Q2RA 4BAXA 2GLSA 1VA6A 4Z9MA 4BG4B 1BG0A 1R8GA 1FPYA 1SD0A 4LNIA 4GVYA 4GW0A 3LVWA 2D32A 4LNKA 4AM1A 2GWCA 3IG5A 3L2EA 3NG0A 3M10A 2D33A
chains in the Genus database with same CATH topology
1CRKA 1HTOA 4S0RA 4RF9A 4LNOA 1M15A 4LNFA 1I0EA 4BHLA 3JU6A 2CRKA 4BG4A 1G0WA 3DRBA 4ACFA 4Q2RA 4RF8A 5J99A 3L2EB 4XYCA 3JQ3A 1VRPA 2GLSA 3JPZA 3DREA 5J9AA 4Z9MA 4GVZA 4RF7A 2LGSA 3ZXVA 4BG4B 3JU5A 1BG0A 4S17A 1FPYA 1F52A 1SD0A 1LGRA 4LNIA 4GVYA 1F1HA 1HTQA 1P52A 1P50A 3ZXRA 4GW2A 2WGSA 1RL9A 4GW0A 4LNKA 3B6RA 4RF6A 3NG0A 1QH4A 4AM1A 2WHIA 2J1QA 3L2EA 1QK1A 3L2DA 4HPPA 2BVCA 3M10A 1U6RA 4LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRK A;  1HTO A;  4S0R A;  4RF9 A;  4LNO A;  1M15 A;  4LNF A;  1I0E A;  4BHL A;  3JU6 A;  2CRK A;  4BG4 A;  1G0W A;  3DRB A;  4ACF A;  4Q2R A;  4RF8 A;  5J99 A;  3L2E B;  4XYC A;  3JQ3 A;  1VRP A;  2GLS A;  3JPZ A;  3DRE A;  5J9A A;  4Z9M A;  4GVZ A;  4RF7 A;  2LGS A;  3ZXV A;  4BG4 B;  3JU5 A;  1BG0 A;  4S17 A;  1FPY A;  1F52 A;  1SD0 A;  1LGR A;  4LNI A;  4GVY A;  1F1H A;  1HTQ A;  1P52 A;  1P50 A;  3ZXR A;  4GW2 A;  2WGS A;  1RL9 A;  4GW0 A;  4LNK A;  3B6R A;  4RF6 A;  3NG0 A;  1QH4 A;  4AM1 A;  2WHI A;  2J1Q A;  3L2E A;  1QK1 A;  3L2D A;  4HPP A;  2BVC A;  3M10 A;  1U6R A;  4LNN A; 
#chains in the Genus database with same CATH topology
 1CRK A;  1HTO A;  4RF9 A;  4BHL A;  2UU7 A;  1G0W A;  3DRB A;  2D3B A;  4XYC A;  3DRE A;  3ZXV A;  3JU5 A;  1F52 A;  1LGR A;  1U6R A;  1P50 A;  2GWD A;  2D3A A;  4GW2 A;  3LN6 A;  2WHI A;  4RF6 A;  1QK1 A;  4HPP A;  2BVC A;  1I0E A;  2D3C A;  2CRK A;  2QC8 A;  4BG4 A;  4RF8 A;  3JQ3 A;  5J9A A;  1HTQ A;  1F1H A;  3ZXR A;  3IG8 A;  1RL9 A;  3B6R A;  1TT4 A;  1M15 A;  4LNF A;  5J99 A;  3L2E B;  2OJW A;  1VRP A;  3JPZ A;  4GVZ A;  4RF7 A;  2LGS A;  1V4G A;  3LN7 A;  3LVV A;  1P52 A;  2WGS A;  1QH4 A;  2J1Q A;  4LNO A;  3L2D A;  4S17 A;  4LNN A;  4S0R A;  3JU6 A;  3FKY A;  3NZT A;  4ACF A;  4Q2R A;  4BAX A;  2GLS A;  1VA6 A;  4Z9M A;  4BG4 B;  1BG0 A;  1R8G A;  1FPY A;  1SD0 A;  4LNI A;  4GVY A;  4GW0 A;  3LVW A;  2D32 A;  4LNK A;  4AM1 A;  2GWC A;  3IG5 A;  3L2E A;  3NG0 A;  3M10 A;  2D33 A; 
#chains in the Genus database with same CATH homology
 1CRK A;  1HTO A;  4S0R A;  4RF9 A;  4LNO A;  1M15 A;  4LNF A;  1I0E A;  4BHL A;  3JU6 A;  2CRK A;  4BG4 A;  1G0W A;  3DRB A;  4ACF A;  4Q2R A;  4RF8 A;  5J99 A;  3L2E B;  4XYC A;  3JQ3 A;  1VRP A;  2GLS A;  3JPZ A;  3DRE A;  5J9A A;  4Z9M A;  4GVZ A;  4RF7 A;  2LGS A;  3ZXV A;  4BG4 B;  3JU5 A;  1BG0 A;  4S17 A;  1FPY A;  1F52 A;  1SD0 A;  1LGR A;  4LNI A;  4GVY A;  1F1H A;  1HTQ A;  1P52 A;  1P50 A;  3ZXR A;  4GW2 A;  2WGS A;  1RL9 A;  4GW0 A;  4LNK A;  3B6R A;  4RF6 A;  3NG0 A;  1QH4 A;  4AM1 A;  2WHI A;  2J1Q A;  3L2E A;  1QK1 A;  3L2D A;  4HPP A;  2BVC A;  3M10 A;  1U6R A;  4LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...