4RF9A

Crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with l-arginine and atpgs
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
712
structure length
690
Chain Sequence
b'MADPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine kinase
publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
total genus 237
structure length 690
sequence length 712
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf9A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf9A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf9A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf9A04
3L2EB 4XYCA 4GVYA 3JU6A 1G0WA 1CRKA 4BG4B 4LNNA 4S17A 1M15A 4LNIA 1FPYA 4LNOA 4AM1A 1HTOA 4GW2A 2WGSA 4HPPA 3L2EA 2BVCA 1F52A 3L2DA 3JPZA 1LGRA 5J99A 4GW0A 2WHIA 1RL9A 3ZXVA 1HTQA 3NG0A 4RF8A 3DRBA 4RF7A 4GVZA 4BG4A 1SD0A 1P52A 2J1QA 3ZXRA 2GLSA 4ACFA 3M10A 3DREA 4Z9MA 1U6RA 4RF9A 4BHLA 1F1HA 1QK1A 1VRPA 1BG0A 4RF6A 2CRKA 5J9AA 4LNFA 1P50A 3JU5A 4Q2RA 1QH4A 3JQ3A 2LGSA 4LNKA 4S0RA 1I0EA 3B6RA
chains in the Genus database with same CATH superfamily
3L2EB 1V4GA 3JU6A 2D3CA 3NZTA 1G0WA 4BG4B 1HTOA 3L2EA 1F52A 4GW0A 3FKYA 4RF7A 2OJWA 4BG4A 3DREA 2GLSA 4LNFA 2LGSA 3ZXRA 3B6RA 3LN7A 4GVYA 2D3AA 4LNNA 4S17A 1M15A 2GWCA 4GW2A 4HPPA 2BVCA 1LGRA 2WHIA 4GVZA 3IG8A 1SD0A 4ACFA 2D32A 1BG0A 4RF6A 2UU7A 1QH4A 4S0RA 4LNKA 2GWDA 3LN6A 2D33A 3LVWA 3JPZA 5J99A 3ZXVA 1HTQA 1RL9A 4BHLA 2QC8A 4RF9A 4LNOA 5J9AA 2CRKA 4BAXA 4XYCA 1CRKA 1TT4A 4LNIA 4AM1A 2WGSA 1R8GA 3L2DA 3NG0A 4RF8A 3DRBA 2D3BA 1P52A 2J1QA 3IG5A 1FPYA 3M10A 4Z9MA 1U6RA 1F1HA 3LVVA 1QK1A 1VRPA 1P50A 3JU5A 4Q2RA 3JQ3A 1VA6A 1I0EA
chains in the Genus database with same CATH topology
3L2EB 4XYCA 4GVYA 3JU6A 1G0WA 1CRKA 4BG4B 4LNNA 4S17A 1M15A 4LNIA 1FPYA 4LNOA 4AM1A 1HTOA 4GW2A 2WGSA 4HPPA 3L2EA 2BVCA 1F52A 3L2DA 3JPZA 1LGRA 5J99A 4GW0A 2WHIA 1RL9A 3ZXVA 1HTQA 3NG0A 4RF8A 3DRBA 4RF7A 4GVZA 4BG4A 1SD0A 1P52A 2J1QA 3ZXRA 2GLSA 4ACFA 3M10A 3DREA 4Z9MA 1U6RA 4RF9A 4BHLA 1F1HA 1QK1A 1VRPA 1BG0A 4RF6A 2CRKA 5J9AA 4LNFA 1P50A 3JU5A 4Q2RA 1QH4A 3JQ3A 2LGSA 4LNKA 4S0RA 1I0EA 3B6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2E B;  4XYC A;  4GVY A;  3JU6 A;  1G0W A;  1CRK A;  4BG4 B;  4LNN A;  4S17 A;  1M15 A;  4LNI A;  1FPY A;  4LNO A;  4AM1 A;  1HTO A;  4GW2 A;  2WGS A;  4HPP A;  3L2E A;  2BVC A;  1F52 A;  3L2D A;  3JPZ A;  1LGR A;  5J99 A;  4GW0 A;  2WHI A;  1RL9 A;  3ZXV A;  1HTQ A;  3NG0 A;  4RF8 A;  3DRB A;  4RF7 A;  4GVZ A;  4BG4 A;  1SD0 A;  1P52 A;  2J1Q A;  3ZXR A;  2GLS A;  4ACF A;  3M10 A;  3DRE A;  4Z9M A;  1U6R A;  4RF9 A;  4BHL A;  1F1H A;  1QK1 A;  1VRP A;  1BG0 A;  4RF6 A;  2CRK A;  5J9A A;  4LNF A;  1P50 A;  3JU5 A;  4Q2R A;  1QH4 A;  3JQ3 A;  2LGS A;  4LNK A;  4S0R A;  1I0E A;  3B6R A; 
#chains in the Genus database with same CATH topology
 3L2E B;  1V4G A;  3JU6 A;  2D3C A;  3NZT A;  1G0W A;  4BG4 B;  1HTO A;  3L2E A;  1F52 A;  4GW0 A;  3FKY A;  4RF7 A;  2OJW A;  4BG4 A;  3DRE A;  2GLS A;  4LNF A;  2LGS A;  3ZXR A;  3B6R A;  3LN7 A;  4GVY A;  2D3A A;  4LNN A;  4S17 A;  1M15 A;  2GWC A;  4GW2 A;  4HPP A;  2BVC A;  1LGR A;  2WHI A;  4GVZ A;  3IG8 A;  1SD0 A;  4ACF A;  2D32 A;  1BG0 A;  4RF6 A;  2UU7 A;  1QH4 A;  4S0R A;  4LNK A;  2GWD A;  3LN6 A;  2D33 A;  3LVW A;  3JPZ A;  5J99 A;  3ZXV A;  1HTQ A;  1RL9 A;  4BHL A;  2QC8 A;  4RF9 A;  4LNO A;  5J9A A;  2CRK A;  4BAX A;  4XYC A;  1CRK A;  1TT4 A;  4LNI A;  4AM1 A;  2WGS A;  1R8G A;  3L2D A;  3NG0 A;  4RF8 A;  3DRB A;  2D3B A;  1P52 A;  2J1Q A;  3IG5 A;  1FPY A;  3M10 A;  4Z9M A;  1U6R A;  1F1H A;  3LVV A;  1QK1 A;  1VRP A;  1P50 A;  3JU5 A;  4Q2R A;  3JQ3 A;  1VA6 A;  1I0E A; 
#chains in the Genus database with same CATH homology
 3L2E B;  4XYC A;  4GVY A;  3JU6 A;  1G0W A;  1CRK A;  4BG4 B;  4LNN A;  4S17 A;  1M15 A;  4LNI A;  1FPY A;  4LNO A;  4AM1 A;  1HTO A;  4GW2 A;  2WGS A;  4HPP A;  3L2E A;  2BVC A;  1F52 A;  3L2D A;  3JPZ A;  1LGR A;  5J99 A;  4GW0 A;  2WHI A;  1RL9 A;  3ZXV A;  1HTQ A;  3NG0 A;  4RF8 A;  3DRB A;  4RF7 A;  4GVZ A;  4BG4 A;  1SD0 A;  1P52 A;  2J1Q A;  3ZXR A;  2GLS A;  4ACF A;  3M10 A;  3DRE A;  4Z9M A;  1U6R A;  4RF9 A;  4BHL A;  1F1H A;  1QK1 A;  1VRP A;  1BG0 A;  4RF6 A;  2CRK A;  5J9A A;  4LNF A;  1P50 A;  3JU5 A;  4Q2R A;  1QH4 A;  3JQ3 A;  2LGS A;  4LNK A;  4S0R A;  1I0E A;  3B6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...