4Q2RA

Structural proteomics from crude native rod outer segments
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
366
Chain Sequence
SHNLKLRFPAEDEFPDLSGHNNHMAKVLTPELYAELRAKSTPSGFTVDDVIQTGVDNPGHPYIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPTDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCNGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFPEVLKRLRLQKRGGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Proteomics From Crude Native Rod Outer Segments
rcsb
molecule tags Transferase
molecule keywords Creatine kinase B-type
total genus 128
structure length 366
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4q2rA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4q2rA02
4LNNA 4S17A 4AM1A 2WHIA 3DRBA 2CRKA 4LNKA 4LNIA 4BG4B 4Q2RA 5J9AA 1F1HA 1F52A 3JPZA 4RF7A 1CRKA 1I0EA 4Z9MA 1HTOA 3M10A 4GVYA 2WGSA 4BG4A 4ACFA 1M15A 1P50A 1QK1A 1RL9A 3L2EB 4HPPA 1G0WA 1QH4A 3JQ3A 4XYCA 4GVZA 4RF6A 3L2DA 4GW0A 2J1QA 1VRPA 3NG0A 2GLSA 4RF8A 1BG0A 2LGSA 4BHLA 5J99A 3JU6A 4S0RA 3ZXRA 1U6RA 1LGRA 1HTQA 4LNOA 1SD0A 4RF9A 3B6RA 1P52A 2BVCA 3DREA 1FPYA 3ZXVA 3L2EA 4LNFA 3JU5A 4GW2A
chains in the Genus database with same CATH superfamily
2D3AA 4BG4B 4Q2RA 1CRKA 4Z9MA 1V4GA 2D33A 3IG8A 3L2DA 2LGSA 1TT4A 1U6RA 1HTQA 4LNOA 1SD0A 3B6RA 1VA6A 4S17A 4AM1A 2CRKA 3IG5A 1F1HA 3JPZA 1HTOA 3M10A 3FKYA 2OJWA 1G0WA 2GWDA 4XYCA 4GW0A 1VRPA 4BHLA 3JU6A 1LGRA 1R8GA 4RF9A 2BVCA 2D32A 3L2EA 4LNFA 4LNNA 4LNKA 3DRBA 5J9AA 1F52A 1I0EA 2WGSA 4BG4A 2D3BA 1M15A 2D3CA 4HPPA 4RF6A 5J99A 3ZXRA 4S0RA 1P52A 2GWCA 3DREA 1FPYA 3JU5A 4GW2A 2WHIA 2UU7A 4LNIA 3LN6A 4RF7A 4GVYA 4ACFA 1P50A 2QC8A 1QK1A 1RL9A 3L2EB 3LN7A 3JQ3A 1QH4A 4GVZA 3LVVA 3NZTA 2J1QA 3NG0A 2GLSA 4RF8A 1BG0A 4BAXA 3LVWA 3ZXVA
chains in the Genus database with same CATH topology
4LNNA 4S17A 4AM1A 2WHIA 3DRBA 2CRKA 4LNKA 4LNIA 4BG4B 4Q2RA 5J9AA 1F1HA 1F52A 3JPZA 4RF7A 1CRKA 1I0EA 4Z9MA 1HTOA 3M10A 4GVYA 2WGSA 4BG4A 4ACFA 1M15A 1P50A 1QK1A 1RL9A 3L2EB 4HPPA 1G0WA 1QH4A 3JQ3A 4XYCA 4GVZA 4RF6A 3L2DA 4GW0A 2J1QA 1VRPA 3NG0A 2GLSA 4RF8A 1BG0A 2LGSA 4BHLA 5J99A 3JU6A 4S0RA 3ZXRA 1U6RA 1LGRA 1HTQA 4LNOA 1SD0A 4RF9A 3B6RA 1P52A 2BVCA 3DREA 1FPYA 3ZXVA 3L2EA 4LNFA 3JU5A 4GW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNN A;  4S17 A;  4AM1 A;  2WHI A;  3DRB A;  2CRK A;  4LNK A;  4LNI A;  4BG4 B;  4Q2R A;  5J9A A;  1F1H A;  1F52 A;  3JPZ A;  4RF7 A;  1CRK A;  1I0E A;  4Z9M A;  1HTO A;  3M10 A;  4GVY A;  2WGS A;  4BG4 A;  4ACF A;  1M15 A;  1P50 A;  1QK1 A;  1RL9 A;  3L2E B;  4HPP A;  1G0W A;  1QH4 A;  3JQ3 A;  4XYC A;  4GVZ A;  4RF6 A;  3L2D A;  4GW0 A;  2J1Q A;  1VRP A;  3NG0 A;  2GLS A;  4RF8 A;  1BG0 A;  2LGS A;  4BHL A;  5J99 A;  3JU6 A;  4S0R A;  3ZXR A;  1U6R A;  1LGR A;  1HTQ A;  4LNO A;  1SD0 A;  4RF9 A;  3B6R A;  1P52 A;  2BVC A;  3DRE A;  1FPY A;  3ZXV A;  3L2E A;  4LNF A;  3JU5 A;  4GW2 A; 
#chains in the Genus database with same CATH topology
 2D3A A;  4BG4 B;  4Q2R A;  1CRK A;  4Z9M A;  1V4G A;  2D33 A;  3IG8 A;  3L2D A;  2LGS A;  1TT4 A;  1U6R A;  1HTQ A;  4LNO A;  1SD0 A;  3B6R A;  1VA6 A;  4S17 A;  4AM1 A;  2CRK A;  3IG5 A;  1F1H A;  3JPZ A;  1HTO A;  3M10 A;  3FKY A;  2OJW A;  1G0W A;  2GWD A;  4XYC A;  4GW0 A;  1VRP A;  4BHL A;  3JU6 A;  1LGR A;  1R8G A;  4RF9 A;  2BVC A;  2D32 A;  3L2E A;  4LNF A;  4LNN A;  4LNK A;  3DRB A;  5J9A A;  1F52 A;  1I0E A;  2WGS A;  4BG4 A;  2D3B A;  1M15 A;  2D3C A;  4HPP A;  4RF6 A;  5J99 A;  3ZXR A;  4S0R A;  1P52 A;  2GWC A;  3DRE A;  1FPY A;  3JU5 A;  4GW2 A;  2WHI A;  2UU7 A;  4LNI A;  3LN6 A;  4RF7 A;  4GVY A;  4ACF A;  1P50 A;  2QC8 A;  1QK1 A;  1RL9 A;  3L2E B;  3LN7 A;  3JQ3 A;  1QH4 A;  4GVZ A;  3LVV A;  3NZT A;  2J1Q A;  3NG0 A;  2GLS A;  4RF8 A;  1BG0 A;  4BAX A;  3LVW A;  3ZXV A; 
#chains in the Genus database with same CATH homology
 4LNN A;  4S17 A;  4AM1 A;  2WHI A;  3DRB A;  2CRK A;  4LNK A;  4LNI A;  4BG4 B;  4Q2R A;  5J9A A;  1F1H A;  1F52 A;  3JPZ A;  4RF7 A;  1CRK A;  1I0E A;  4Z9M A;  1HTO A;  3M10 A;  4GVY A;  2WGS A;  4BG4 A;  4ACF A;  1M15 A;  1P50 A;  1QK1 A;  1RL9 A;  3L2E B;  4HPP A;  1G0W A;  1QH4 A;  3JQ3 A;  4XYC A;  4GVZ A;  4RF6 A;  3L2D A;  4GW0 A;  2J1Q A;  1VRP A;  3NG0 A;  2GLS A;  4RF8 A;  1BG0 A;  2LGS A;  4BHL A;  5J99 A;  3JU6 A;  4S0R A;  3ZXR A;  1U6R A;  1LGR A;  1HTQ A;  4LNO A;  1SD0 A;  4RF9 A;  3B6R A;  1P52 A;  2BVC A;  3DRE A;  1FPY A;  3ZXV A;  3L2E A;  4LNF A;  3JU5 A;  4GW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...