4AM1A

Crystal structure of the marine crustacean decapod shrimp (litopenaeus vannamei) arginine kinase in the absence of substrate or ligands.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
356
structure length
345
Chain Sequence
b'GADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPMLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANAMRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIILPKLAANRAKLEEVAGKYNLQVAGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE KINASE
publication title Crystallization and X-Ray Diffraction Studies of Arginine Kinase from the White Pacific Shrimp Litopenaeus Vannamei.
pubmed doi rcsb
molecule tags Transferase
total genus 129
structure length 345
sequence length 356
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4am1A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4am1A02
1QK1A 1G0WA 3JQ3A 3DRBA 4BG4B 1FPYA 4LNNA 3ZXRA 3DREA 1M15A 3JPZA 4LNIA 2CRKA 4Q2RA 4RF7A 4RF9A 3L2DA 1F52A 2GLSA 4S17A 1HTQA 1P50A 4RF6A 1F1HA 3L2EA 4XYCA 2WHIA 3B6RA 4GW2A 4S0RA 1VRPA 1U6RA 4GW0A 1SD0A 2WGSA 4ACFA 3ZXVA 4AM1A 3NG0A 5J9AA 2BVCA 1I0EA 3M10A 2LGSA 4LNKA 1RL9A 1QH4A 4BG4A 3L2EB 1CRKA 1LGRA 4GVYA 4LNOA 4LNFA 1P52A 2J1QA 3JU5A 1BG0A 4BHLA 4HPPA 5J99A 3JU6A 4Z9MA 4RF8A 1HTOA 4GVZA
chains in the Genus database with same CATH superfamily
1FPYA 3ZXRA 4LNNA 1M15A 4LNIA 2CRKA 4Q2RA 3FKYA 3L2DA 1P50A 3L2EA 4XYCA 2WHIA 4GW2A 4AM1A 2BVCA 2UU7A 3M10A 3IG8A 2QC8A 1CRKA 1LGRA 4GVYA 4LNOA 3IG5A 2D33A 4BG4B 2D3AA 3DREA 3LN6A 1VA6A 4S17A 1F1HA 1U6RA 3NZTA 2LGSA 3L2EB 1P52A 2GWCA 3JU5A 4Z9MA 1QK1A 3JQ3A 3DRBA 3JPZA 1F52A 2GLSA 1HTQA 2D3CA 4S0RA 1VRPA 1SD0A 2WGSA 3ZXVA 2D3BA 2D32A 2OJWA 4LNKA 4LNFA 3LVWA 2J1QA 4BHLA 3LVVA 4RF8A 3NG0A 4GVZA 1G0WA 4RF7A 3LN7A 4RF9A 4RF6A 1V4GA 3B6RA 4GW0A 4ACFA 1R8GA 1TT4A 5J9AA 2GWDA 1I0EA 1RL9A 1QH4A 4BG4A 4BAXA 1BG0A 4HPPA 5J99A 3JU6A 1HTOA
chains in the Genus database with same CATH topology
1QK1A 1G0WA 3JQ3A 3DRBA 4BG4B 1FPYA 4LNNA 3ZXRA 3DREA 1M15A 3JPZA 4LNIA 2CRKA 4Q2RA 4RF7A 4RF9A 3L2DA 1F52A 2GLSA 4S17A 1HTQA 1P50A 4RF6A 1F1HA 3L2EA 4XYCA 2WHIA 3B6RA 4GW2A 4S0RA 1VRPA 1U6RA 4GW0A 1SD0A 2WGSA 4ACFA 3ZXVA 4AM1A 3NG0A 5J9AA 2BVCA 1I0EA 3M10A 2LGSA 4LNKA 1RL9A 1QH4A 4BG4A 3L2EB 1CRKA 1LGRA 4GVYA 4LNOA 4LNFA 1P52A 2J1QA 3JU5A 1BG0A 4BHLA 4HPPA 5J99A 3JU6A 4Z9MA 4RF8A 1HTOA 4GVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK1 A;  1G0W A;  3JQ3 A;  3DRB A;  4BG4 B;  1FPY A;  4LNN A;  3ZXR A;  3DRE A;  1M15 A;  3JPZ A;  4LNI A;  2CRK A;  4Q2R A;  4RF7 A;  4RF9 A;  3L2D A;  1F52 A;  2GLS A;  4S17 A;  1HTQ A;  1P50 A;  4RF6 A;  1F1H A;  3L2E A;  4XYC A;  2WHI A;  3B6R A;  4GW2 A;  4S0R A;  1VRP A;  1U6R A;  4GW0 A;  1SD0 A;  2WGS A;  4ACF A;  3ZXV A;  4AM1 A;  3NG0 A;  5J9A A;  2BVC A;  1I0E A;  3M10 A;  2LGS A;  4LNK A;  1RL9 A;  1QH4 A;  4BG4 A;  3L2E B;  1CRK A;  1LGR A;  4GVY A;  4LNO A;  4LNF A;  1P52 A;  2J1Q A;  3JU5 A;  1BG0 A;  4BHL A;  4HPP A;  5J99 A;  3JU6 A;  4Z9M A;  4RF8 A;  1HTO A;  4GVZ A; 
#chains in the Genus database with same CATH topology
 1FPY A;  3ZXR A;  4LNN A;  1M15 A;  4LNI A;  2CRK A;  4Q2R A;  3FKY A;  3L2D A;  1P50 A;  3L2E A;  4XYC A;  2WHI A;  4GW2 A;  4AM1 A;  2BVC A;  2UU7 A;  3M10 A;  3IG8 A;  2QC8 A;  1CRK A;  1LGR A;  4GVY A;  4LNO A;  3IG5 A;  2D33 A;  4BG4 B;  2D3A A;  3DRE A;  3LN6 A;  1VA6 A;  4S17 A;  1F1H A;  1U6R A;  3NZT A;  2LGS A;  3L2E B;  1P52 A;  2GWC A;  3JU5 A;  4Z9M A;  1QK1 A;  3JQ3 A;  3DRB A;  3JPZ A;  1F52 A;  2GLS A;  1HTQ A;  2D3C A;  4S0R A;  1VRP A;  1SD0 A;  2WGS A;  3ZXV A;  2D3B A;  2D32 A;  2OJW A;  4LNK A;  4LNF A;  3LVW A;  2J1Q A;  4BHL A;  3LVV A;  4RF8 A;  3NG0 A;  4GVZ A;  1G0W A;  4RF7 A;  3LN7 A;  4RF9 A;  4RF6 A;  1V4G A;  3B6R A;  4GW0 A;  4ACF A;  1R8G A;  1TT4 A;  5J9A A;  2GWD A;  1I0E A;  1RL9 A;  1QH4 A;  4BG4 A;  4BAX A;  1BG0 A;  4HPP A;  5J99 A;  3JU6 A;  1HTO A; 
#chains in the Genus database with same CATH homology
 1QK1 A;  1G0W A;  3JQ3 A;  3DRB A;  4BG4 B;  1FPY A;  4LNN A;  3ZXR A;  3DRE A;  1M15 A;  3JPZ A;  4LNI A;  2CRK A;  4Q2R A;  4RF7 A;  4RF9 A;  3L2D A;  1F52 A;  2GLS A;  4S17 A;  1HTQ A;  1P50 A;  4RF6 A;  1F1H A;  3L2E A;  4XYC A;  2WHI A;  3B6R A;  4GW2 A;  4S0R A;  1VRP A;  1U6R A;  4GW0 A;  1SD0 A;  2WGS A;  4ACF A;  3ZXV A;  4AM1 A;  3NG0 A;  5J9A A;  2BVC A;  1I0E A;  3M10 A;  2LGS A;  4LNK A;  1RL9 A;  1QH4 A;  4BG4 A;  3L2E B;  1CRK A;  1LGR A;  4GVY A;  4LNO A;  4LNF A;  1P52 A;  2J1Q A;  3JU5 A;  1BG0 A;  4BHL A;  4HPP A;  5J99 A;  3JU6 A;  4Z9M A;  4RF8 A;  1HTO A;  4GVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...