4BG4A

Crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
356
structure length
355
Chain Sequence
b'MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANSRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE KINASE
publication title Crystal Structure of Shrimp Arginine Kinase in Binary Complex with Arginine-A Molecular View of the Phosphagen Precursor Binding to the Enzyme.
pubmed doi rcsb
molecule tags Transferase
total genus 130
structure length 355
sequence length 356
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4bg4A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4bg4A02
1FPYA 4BHLA 4GW2A 1CRKA 3B6RA 4LNKA 4LNFA 4RF8A 4XYCA 2CRKA 2J1QA 1U6RA 5J99A 4HPPA 5J9AA 1HTQA 4AM1A 1M15A 1I0EA 3DREA 3JU6A 4RF7A 3JU5A 3ZXVA 3ZXRA 1P52A 4Z9MA 3L2DA 4GVZA 4LNOA 4ACFA 3JPZA 1HTOA 4RF6A 1F1HA 3DRBA 1RL9A 4S17A 2GLSA 2WGSA 2WHIA 1BG0A 1QK1A 3L2EB 2BVCA 4RF9A 4BG4B 4LNNA 1G0WA 1VRPA 3JQ3A 3M10A 3NG0A 1SD0A 4S0RA 4GW0A 1QH4A 1F52A 3L2EA 4Q2RA 1P50A 4GVYA 2LGSA 4LNIA 4BG4A 1LGRA
chains in the Genus database with same CATH superfamily
4BHLA 4LNKA 4RF8A 1U6RA 4HPPA 5J9AA 1HTQA 4AM1A 3JU6A 3JU5A 1P52A 4LNOA 2WHIA 1BG0A 1QK1A 2BVCA 4LNNA 4BG4B 1VRPA 3M10A 3IG8A 4S0RA 4GW0A 4Q2RA 1P50A 4LNFA 5J99A 2OJWA 1I0EA 4Z9MA 3L2DA 4GVZA 4ACFA 3JPZA 1F1HA 3DRBA 2WGSA 3FKYA 2UU7A 4RF9A 1G0WA 2D3BA 3JQ3A 2D3CA 1QH4A 2LGSA 4BG4A 1FPYA 3LN7A 4BAXA 3ZXVA 1HTOA 2D33A 1RL9A 4S17A 2GLSA 3LN6A 3L2EB 1VA6A 2GWDA 3LVWA 1R8GA 1LGRA 4GW2A 1CRKA 3B6RA 2D32A 4XYCA 2CRKA 2J1QA 2GWCA 3LVVA 1M15A 4RF7A 3DREA 1V4GA 2QC8A 3ZXRA 3NZTA 4RF6A 3IG5A 2D3AA 3NG0A 1SD0A 1TT4A 1F52A 4LNIA 3L2EA 4GVYA
chains in the Genus database with same CATH topology
1FPYA 4BHLA 4GW2A 1CRKA 3B6RA 4LNKA 4LNFA 4RF8A 4XYCA 2CRKA 2J1QA 1U6RA 5J99A 4HPPA 5J9AA 1HTQA 4AM1A 1M15A 1I0EA 3DREA 3JU6A 4RF7A 3JU5A 3ZXVA 3ZXRA 1P52A 4Z9MA 3L2DA 4GVZA 4LNOA 4ACFA 3JPZA 1HTOA 4RF6A 1F1HA 3DRBA 1RL9A 4S17A 2GLSA 2WGSA 2WHIA 1BG0A 1QK1A 3L2EB 2BVCA 4RF9A 4BG4B 4LNNA 1G0WA 1VRPA 3JQ3A 3M10A 3NG0A 1SD0A 4S0RA 4GW0A 1QH4A 1F52A 3L2EA 4Q2RA 1P50A 4GVYA 2LGSA 4LNIA 4BG4A 1LGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPY A;  4BHL A;  4GW2 A;  1CRK A;  3B6R A;  4LNK A;  4LNF A;  4RF8 A;  4XYC A;  2CRK A;  2J1Q A;  1U6R A;  5J99 A;  4HPP A;  5J9A A;  1HTQ A;  4AM1 A;  1M15 A;  1I0E A;  3DRE A;  3JU6 A;  4RF7 A;  3JU5 A;  3ZXV A;  3ZXR A;  1P52 A;  4Z9M A;  3L2D A;  4GVZ A;  4LNO A;  4ACF A;  3JPZ A;  1HTO A;  4RF6 A;  1F1H A;  3DRB A;  1RL9 A;  4S17 A;  2GLS A;  2WGS A;  2WHI A;  1BG0 A;  1QK1 A;  3L2E B;  2BVC A;  4RF9 A;  4BG4 B;  4LNN A;  1G0W A;  1VRP A;  3JQ3 A;  3M10 A;  3NG0 A;  1SD0 A;  4S0R A;  4GW0 A;  1QH4 A;  1F52 A;  3L2E A;  4Q2R A;  1P50 A;  4GVY A;  2LGS A;  4LNI A;  4BG4 A;  1LGR A; 
#chains in the Genus database with same CATH topology
 4BHL A;  4LNK A;  4RF8 A;  1U6R A;  4HPP A;  5J9A A;  1HTQ A;  4AM1 A;  3JU6 A;  3JU5 A;  1P52 A;  4LNO A;  2WHI A;  1BG0 A;  1QK1 A;  2BVC A;  4LNN A;  4BG4 B;  1VRP A;  3M10 A;  3IG8 A;  4S0R A;  4GW0 A;  4Q2R A;  1P50 A;  4LNF A;  5J99 A;  2OJW A;  1I0E A;  4Z9M A;  3L2D A;  4GVZ A;  4ACF A;  3JPZ A;  1F1H A;  3DRB A;  2WGS A;  3FKY A;  2UU7 A;  4RF9 A;  1G0W A;  2D3B A;  3JQ3 A;  2D3C A;  1QH4 A;  2LGS A;  4BG4 A;  1FPY A;  3LN7 A;  4BAX A;  3ZXV A;  1HTO A;  2D33 A;  1RL9 A;  4S17 A;  2GLS A;  3LN6 A;  3L2E B;  1VA6 A;  2GWD A;  3LVW A;  1R8G A;  1LGR A;  4GW2 A;  1CRK A;  3B6R A;  2D32 A;  4XYC A;  2CRK A;  2J1Q A;  2GWC A;  3LVV A;  1M15 A;  4RF7 A;  3DRE A;  1V4G A;  2QC8 A;  3ZXR A;  3NZT A;  4RF6 A;  3IG5 A;  2D3A A;  3NG0 A;  1SD0 A;  1TT4 A;  1F52 A;  4LNI A;  3L2E A;  4GVY A; 
#chains in the Genus database with same CATH homology
 1FPY A;  4BHL A;  4GW2 A;  1CRK A;  3B6R A;  4LNK A;  4LNF A;  4RF8 A;  4XYC A;  2CRK A;  2J1Q A;  1U6R A;  5J99 A;  4HPP A;  5J9A A;  1HTQ A;  4AM1 A;  1M15 A;  1I0E A;  3DRE A;  3JU6 A;  4RF7 A;  3JU5 A;  3ZXV A;  3ZXR A;  1P52 A;  4Z9M A;  3L2D A;  4GVZ A;  4LNO A;  4ACF A;  3JPZ A;  1HTO A;  4RF6 A;  1F1H A;  3DRB A;  1RL9 A;  4S17 A;  2GLS A;  2WGS A;  2WHI A;  1BG0 A;  1QK1 A;  3L2E B;  2BVC A;  4RF9 A;  4BG4 B;  4LNN A;  1G0W A;  1VRP A;  3JQ3 A;  3M10 A;  3NG0 A;  1SD0 A;  4S0R A;  4GW0 A;  1QH4 A;  1F52 A;  3L2E A;  4Q2R A;  1P50 A;  4GVY A;  2LGS A;  4LNI A;  4BG4 A;  1LGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...