4BG4A

Crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
356
structure length
355
Chain Sequence
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANSRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Shrimp Arginine Kinase in Binary Complex with Arginine-A Molecular View of the Phosphagen Precursor Binding to the Enzyme.
pubmed doi rcsb
molecule tags Transferase
molecule keywords ARGININE KINASE
total genus 130
structure length 355
sequence length 356
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4bg4A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4bg4A02
2GLSA 4RF6A 1G0WA 4BG4B 1VRPA 4HPPA 4S0RA 4LNIA 1P52A 4LNNA 2LGSA 2WGSA 4RF9A 4LNKA 1FPYA 3NG0A 1RL9A 1SD0A 1HTQA 3JQ3A 2J1QA 3L2DA 4GW2A 4Z9MA 3L2EA 1F52A 1LGRA 3JU6A 4GW0A 3ZXRA 3ZXVA 3L2EB 1M15A 1HTOA 4S17A 4BHLA 3DRBA 4GVZA 4ACFA 3DREA 1QH4A 3JU5A 4Q2RA 5J9AA 4XYCA 1CRKA 1P50A 3B6RA 4GVYA 1BG0A 1U6RA 3M10A 4BG4A 1QK1A 4RF8A 2BVCA 5J99A 3JPZA 1I0EA 2CRKA 4LNFA 4AM1A 4RF7A 2WHIA 4LNOA 1F1HA
chains in the Genus database with same CATH superfamily
3IG8A 4RF6A 3LVVA 1V4GA 2D3CA 1P52A 4LNIA 4LNKA 1SD0A 3L2DA 1F52A 3LN7A 3ZXVA 3L2EB 4BHLA 4Q2RA 2OJWA 2UU7A 4GVYA 1BG0A 1QK1A 2BVCA 4AM1A 2WHIA 1R8GA 2GLSA 3LVWA 1VRPA 2WGSA 1FPYA 2GWCA 3L2EA 2QC8A 3ZXRA 3JU6A 1M15A 4GVZA 2D32A 4ACFA 3DREA 1QH4A 3JU5A 5J9AA 1P50A 3B6RA 1U6RA 1TT4A 3JPZA 4S17A 2D3BA 4LNOA 2D3AA 4HPPA 4S0RA 3NG0A 4RF7A 4GW2A 4Z9MA 1LGRA 3DRBA 2GWDA 4XYCA 3M10A 4RF8A 4LNFA 1F1HA 1G0WA 4BG4B 2D33A 4LNNA 2LGSA 3LN6A 4RF9A 1RL9A 1HTQA 3JQ3A 2J1QA 4GW0A 3IG5A 1HTOA 1VA6A 3FKYA 1CRKA 4BG4A 4BAXA 5J99A 1I0EA 2CRKA 3NZTA
chains in the Genus database with same CATH topology
2GLSA 4RF6A 1G0WA 4BG4B 1VRPA 4HPPA 4S0RA 4LNIA 1P52A 4LNNA 2LGSA 2WGSA 4RF9A 4LNKA 1FPYA 3NG0A 1RL9A 1SD0A 1HTQA 3JQ3A 2J1QA 3L2DA 4GW2A 4Z9MA 3L2EA 1F52A 1LGRA 3JU6A 4GW0A 3ZXRA 3ZXVA 3L2EB 1M15A 1HTOA 4S17A 4BHLA 3DRBA 4GVZA 4ACFA 3DREA 1QH4A 3JU5A 4Q2RA 5J9AA 4XYCA 1CRKA 1P50A 3B6RA 4GVYA 1BG0A 1U6RA 3M10A 4BG4A 1QK1A 4RF8A 2BVCA 5J99A 3JPZA 1I0EA 2CRKA 4LNFA 4AM1A 4RF7A 2WHIA 4LNOA 1F1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLS A;  4RF6 A;  1G0W A;  4BG4 B;  1VRP A;  4HPP A;  4S0R A;  4LNI A;  1P52 A;  4LNN A;  2LGS A;  2WGS A;  4RF9 A;  4LNK A;  1FPY A;  3NG0 A;  1RL9 A;  1SD0 A;  1HTQ A;  3JQ3 A;  2J1Q A;  3L2D A;  4GW2 A;  4Z9M A;  3L2E A;  1F52 A;  1LGR A;  3JU6 A;  4GW0 A;  3ZXR A;  3ZXV A;  3L2E B;  1M15 A;  1HTO A;  4S17 A;  4BHL A;  3DRB A;  4GVZ A;  4ACF A;  3DRE A;  1QH4 A;  3JU5 A;  4Q2R A;  5J9A A;  4XYC A;  1CRK A;  1P50 A;  3B6R A;  4GVY A;  1BG0 A;  1U6R A;  3M10 A;  4BG4 A;  1QK1 A;  4RF8 A;  2BVC A;  5J99 A;  3JPZ A;  1I0E A;  2CRK A;  4LNF A;  4AM1 A;  4RF7 A;  2WHI A;  4LNO A;  1F1H A; 
#chains in the Genus database with same CATH topology
 3IG8 A;  4RF6 A;  3LVV A;  1V4G A;  2D3C A;  1P52 A;  4LNI A;  4LNK A;  1SD0 A;  3L2D A;  1F52 A;  3LN7 A;  3ZXV A;  3L2E B;  4BHL A;  4Q2R A;  2OJW A;  2UU7 A;  4GVY A;  1BG0 A;  1QK1 A;  2BVC A;  4AM1 A;  2WHI A;  1R8G A;  2GLS A;  3LVW A;  1VRP A;  2WGS A;  1FPY A;  2GWC A;  3L2E A;  2QC8 A;  3ZXR A;  3JU6 A;  1M15 A;  4GVZ A;  2D32 A;  4ACF A;  3DRE A;  1QH4 A;  3JU5 A;  5J9A A;  1P50 A;  3B6R A;  1U6R A;  1TT4 A;  3JPZ A;  4S17 A;  2D3B A;  4LNO A;  2D3A A;  4HPP A;  4S0R A;  3NG0 A;  4RF7 A;  4GW2 A;  4Z9M A;  1LGR A;  3DRB A;  2GWD A;  4XYC A;  3M10 A;  4RF8 A;  4LNF A;  1F1H A;  1G0W A;  4BG4 B;  2D33 A;  4LNN A;  2LGS A;  3LN6 A;  4RF9 A;  1RL9 A;  1HTQ A;  3JQ3 A;  2J1Q A;  4GW0 A;  3IG5 A;  1HTO A;  1VA6 A;  3FKY A;  1CRK A;  4BG4 A;  4BAX A;  5J99 A;  1I0E A;  2CRK A;  3NZT A; 
#chains in the Genus database with same CATH homology
 2GLS A;  4RF6 A;  1G0W A;  4BG4 B;  1VRP A;  4HPP A;  4S0R A;  4LNI A;  1P52 A;  4LNN A;  2LGS A;  2WGS A;  4RF9 A;  4LNK A;  1FPY A;  3NG0 A;  1RL9 A;  1SD0 A;  1HTQ A;  3JQ3 A;  2J1Q A;  3L2D A;  4GW2 A;  4Z9M A;  3L2E A;  1F52 A;  1LGR A;  3JU6 A;  4GW0 A;  3ZXR A;  3ZXV A;  3L2E B;  1M15 A;  1HTO A;  4S17 A;  4BHL A;  3DRB A;  4GVZ A;  4ACF A;  3DRE A;  1QH4 A;  3JU5 A;  4Q2R A;  5J9A A;  4XYC A;  1CRK A;  1P50 A;  3B6R A;  4GVY A;  1BG0 A;  1U6R A;  3M10 A;  4BG4 A;  1QK1 A;  4RF8 A;  2BVC A;  5J99 A;  3JPZ A;  1I0E A;  2CRK A;  4LNF A;  4AM1 A;  4RF7 A;  2WHI A;  4LNO A;  1F1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...