4RF7A

Crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with substrate l-arginine
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
714
structure length
692
Chain Sequence
MADPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGIGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
molecule keywords Arginine kinase
total genus 249
structure length 692
sequence length 714
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf7A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf7A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf7A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf7A04
4HPPA 3JPZA 4RF9A 1QH4A 5J9AA 1VRPA 3L2EA 4BHLA 1F1HA 3B6RA 1RL9A 1QK1A 1I0EA 3JQ3A 1FPYA 3L2DA 4BG4A 1LGRA 1HTQA 1P52A 2BVCA 3JU5A 4LNNA 4LNFA 1U6RA 4RF8A 4LNKA 3DRBA 4S0RA 4Q2RA 3JU6A 4ACFA 3L2EB 1BG0A 4Z9MA 4RF6A 4AM1A 4S17A 1F52A 1CRKA 4XYCA 2WGSA 4GW0A 4GW2A 1M15A 3NG0A 2WHIA 3M10A 2LGSA 1SD0A 2J1QA 4RF7A 1P50A 4BG4B 5J99A 4LNIA 1G0WA 4GVYA 3ZXRA 3ZXVA 1HTOA 2CRKA 4GVZA 3DREA 4LNOA 2GLSA
chains in the Genus database with same CATH superfamily
4HPPA 1QH4A 1R8GA 1F1HA 1RL9A 1TT4A 1HTQA 3JU5A 1V4GA 4RF8A 2D33A 4AM1A 4XYCA 2OJWA 3NG0A 1SD0A 4BG4B 1G0WA 4RF9A 1VRPA 3IG5A 3B6RA 1FPYA 2D3BA 2GWCA 1P52A 2BVCA 4LNFA 4Q2RA 3L2EB 1CRKA 2WGSA 4GW0A 2WHIA 2J1QA 4RF7A 5J99A 3ZXRA 4LNIA 4GVYA 3NZTA 2CRKA 4LNOA 5J9AA 3L2EA 3LN6A 3LVVA 1I0EA 1LGRA 4LNNA 2D3AA 1U6RA 4S0RA 3LN7A 3JU6A 3IG8A 4ACFA 1BG0A 2UU7A 1M15A 3M10A 2LGSA 3FKYA 3ZXVA 1HTOA 4BHLA 2GWDA 3DREA 2GLSA 3JPZA 4BAXA 1VA6A 1QK1A 3JQ3A 3L2DA 4BG4A 2D3CA 4LNKA 3DRBA 4Z9MA 4S17A 4RF6A 1F52A 2D32A 4GW2A 2QC8A 1P50A 3LVWA 4GVZA
chains in the Genus database with same CATH topology
4HPPA 3JPZA 4RF9A 1QH4A 5J9AA 1VRPA 3L2EA 4BHLA 1F1HA 3B6RA 1RL9A 1QK1A 1I0EA 3JQ3A 1FPYA 3L2DA 4BG4A 1LGRA 1HTQA 1P52A 2BVCA 3JU5A 4LNNA 4LNFA 1U6RA 4RF8A 4LNKA 3DRBA 4S0RA 4Q2RA 3JU6A 4ACFA 3L2EB 1BG0A 4Z9MA 4RF6A 4AM1A 4S17A 1F52A 1CRKA 4XYCA 2WGSA 4GW0A 4GW2A 1M15A 3NG0A 2WHIA 3M10A 2LGSA 1SD0A 2J1QA 4RF7A 1P50A 4BG4B 5J99A 4LNIA 1G0WA 4GVYA 3ZXRA 3ZXVA 1HTOA 2CRKA 4GVZA 3DREA 4LNOA 2GLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPP A;  3JPZ A;  4RF9 A;  1QH4 A;  5J9A A;  1VRP A;  3L2E A;  4BHL A;  1F1H A;  3B6R A;  1RL9 A;  1QK1 A;  1I0E A;  3JQ3 A;  1FPY A;  3L2D A;  4BG4 A;  1LGR A;  1HTQ A;  1P52 A;  2BVC A;  3JU5 A;  4LNN A;  4LNF A;  1U6R A;  4RF8 A;  4LNK A;  3DRB A;  4S0R A;  4Q2R A;  3JU6 A;  4ACF A;  3L2E B;  1BG0 A;  4Z9M A;  4RF6 A;  4AM1 A;  4S17 A;  1F52 A;  1CRK A;  4XYC A;  2WGS A;  4GW0 A;  4GW2 A;  1M15 A;  3NG0 A;  2WHI A;  3M10 A;  2LGS A;  1SD0 A;  2J1Q A;  4RF7 A;  1P50 A;  4BG4 B;  5J99 A;  4LNI A;  1G0W A;  4GVY A;  3ZXR A;  3ZXV A;  1HTO A;  2CRK A;  4GVZ A;  3DRE A;  4LNO A;  2GLS A; 
#chains in the Genus database with same CATH topology
 4HPP A;  1QH4 A;  1R8G A;  1F1H A;  1RL9 A;  1TT4 A;  1HTQ A;  3JU5 A;  1V4G A;  4RF8 A;  2D33 A;  4AM1 A;  4XYC A;  2OJW A;  3NG0 A;  1SD0 A;  4BG4 B;  1G0W A;  4RF9 A;  1VRP A;  3IG5 A;  3B6R A;  1FPY A;  2D3B A;  2GWC A;  1P52 A;  2BVC A;  4LNF A;  4Q2R A;  3L2E B;  1CRK A;  2WGS A;  4GW0 A;  2WHI A;  2J1Q A;  4RF7 A;  5J99 A;  3ZXR A;  4LNI A;  4GVY A;  3NZT A;  2CRK A;  4LNO A;  5J9A A;  3L2E A;  3LN6 A;  3LVV A;  1I0E A;  1LGR A;  4LNN A;  2D3A A;  1U6R A;  4S0R A;  3LN7 A;  3JU6 A;  3IG8 A;  4ACF A;  1BG0 A;  2UU7 A;  1M15 A;  3M10 A;  2LGS A;  3FKY A;  3ZXV A;  1HTO A;  4BHL A;  2GWD A;  3DRE A;  2GLS A;  3JPZ A;  4BAX A;  1VA6 A;  1QK1 A;  3JQ3 A;  3L2D A;  4BG4 A;  2D3C A;  4LNK A;  3DRB A;  4Z9M A;  4S17 A;  4RF6 A;  1F52 A;  2D32 A;  4GW2 A;  2QC8 A;  1P50 A;  3LVW A;  4GVZ A; 
#chains in the Genus database with same CATH homology
 4HPP A;  3JPZ A;  4RF9 A;  1QH4 A;  5J9A A;  1VRP A;  3L2E A;  4BHL A;  1F1H A;  3B6R A;  1RL9 A;  1QK1 A;  1I0E A;  3JQ3 A;  1FPY A;  3L2D A;  4BG4 A;  1LGR A;  1HTQ A;  1P52 A;  2BVC A;  3JU5 A;  4LNN A;  4LNF A;  1U6R A;  4RF8 A;  4LNK A;  3DRB A;  4S0R A;  4Q2R A;  3JU6 A;  4ACF A;  3L2E B;  1BG0 A;  4Z9M A;  4RF6 A;  4AM1 A;  4S17 A;  1F52 A;  1CRK A;  4XYC A;  2WGS A;  4GW0 A;  4GW2 A;  1M15 A;  3NG0 A;  2WHI A;  3M10 A;  2LGS A;  1SD0 A;  2J1Q A;  4RF7 A;  1P50 A;  4BG4 B;  5J99 A;  4LNI A;  1G0W A;  4GVY A;  3ZXR A;  3ZXV A;  1HTO A;  2CRK A;  4GVZ A;  3DRE A;  4LNO A;  2GLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...