1U6RA

Transition state analog complex of muscle creatine kinase (r134k) mutant
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
380
structure length
380
Chain Sequence
b'PFGNTHNKYKLNYKSEEEYPDLSKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDDLDPHYVLSSRVRTGKSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Creatine kinase, M chain
publication title Structural asymmetry and intersubunit communication in muscle creatine kinase
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 130
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1u6rA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1u6rA02
1U6RA 1VRPA 1M15A 3L2EB 4GVZA 4Q2RA 1F1HA 1P52A 2LGSA 4ACFA 4LNOA 3JU5A 3DRBA 4RF9A 3L2EA 4S0RA 4RF7A 2CRKA 3M10A 1G0WA 3DREA 1P50A 1SD0A 2GLSA 2WHIA 2J1QA 4RF6A 3NG0A 5J9AA 1F52A 4Z9MA 5J99A 3JU6A 4LNFA 3ZXRA 2WGSA 3JPZA 4RF8A 1RL9A 4BHLA 1HTOA 1BG0A 1LGRA 4LNIA 1FPYA 2BVCA 1I0EA 4GVYA 3JQ3A 3L2DA 1CRKA 4LNKA 4GW2A 1QH4A 4BG4B 4GW0A 4S17A 4XYCA 1HTQA 1QK1A 4AM1A 3B6RA 4HPPA 4BG4A 4LNNA 3ZXVA
chains in the Genus database with same CATH superfamily
1U6RA 1VRPA 3L2EB 1F1HA 4ACFA 3DREA 1P50A 1F52A 1VA6A 2D3CA 4RF8A 1RL9A 2BVCA 1CRKA 4S17A 1QH4A 4BG4B 4GW0A 3IG5A 4XYCA 1HTQA 1QK1A 2D32A 4GVZA 4LNOA 3JU5A 4RF9A 2UU7A 3L2EA 3FKYA 1G0WA 2WHIA 3NG0A 5J9AA 3ZXRA 4BHLA 1BG0A 2D3AA 4LNIA 3L2DA 4GW2A 4BG4A 1M15A 2D3BA 1P52A 2LGSA 3DRBA 4RF7A 4BAXA 2CRKA 3M10A 2GLSA 4RF6A 2QC8A 5J99A 2GWDA 3JU6A 4LNFA 2WGSA 2GWCA 1TT4A 1FPYA 3B6RA 3ZXVA 4Q2RA 3IG8A 3LN6A 4S0RA 1R8GA 1SD0A 2J1QA 4Z9MA 3LVWA 3LN7A 1V4GA 3JPZA 3NZTA 1HTOA 1LGRA 2D33A 1I0EA 4GVYA 3JQ3A 4LNKA 2OJWA 3LVVA 4AM1A 4HPPA 4LNNA
chains in the Genus database with same CATH topology
1U6RA 1VRPA 1M15A 3L2EB 4GVZA 4Q2RA 1F1HA 1P52A 2LGSA 4ACFA 4LNOA 3JU5A 3DRBA 4RF9A 3L2EA 4S0RA 4RF7A 2CRKA 3M10A 1G0WA 3DREA 1P50A 1SD0A 2GLSA 2WHIA 2J1QA 4RF6A 3NG0A 5J9AA 1F52A 4Z9MA 5J99A 3JU6A 4LNFA 3ZXRA 2WGSA 3JPZA 4RF8A 1RL9A 4BHLA 1HTOA 1BG0A 1LGRA 4LNIA 1FPYA 2BVCA 1I0EA 4GVYA 3JQ3A 3L2DA 1CRKA 4LNKA 4GW2A 1QH4A 4BG4B 4GW0A 4S17A 4XYCA 1HTQA 1QK1A 4AM1A 3B6RA 4HPPA 4BG4A 4LNNA 3ZXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U6R A;  1VRP A;  1M15 A;  3L2E B;  4GVZ A;  4Q2R A;  1F1H A;  1P52 A;  2LGS A;  4ACF A;  4LNO A;  3JU5 A;  3DRB A;  4RF9 A;  3L2E A;  4S0R A;  4RF7 A;  2CRK A;  3M10 A;  1G0W A;  3DRE A;  1P50 A;  1SD0 A;  2GLS A;  2WHI A;  2J1Q A;  4RF6 A;  3NG0 A;  5J9A A;  1F52 A;  4Z9M A;  5J99 A;  3JU6 A;  4LNF A;  3ZXR A;  2WGS A;  3JPZ A;  4RF8 A;  1RL9 A;  4BHL A;  1HTO A;  1BG0 A;  1LGR A;  4LNI A;  1FPY A;  2BVC A;  1I0E A;  4GVY A;  3JQ3 A;  3L2D A;  1CRK A;  4LNK A;  4GW2 A;  1QH4 A;  4BG4 B;  4GW0 A;  4S17 A;  4XYC A;  1HTQ A;  1QK1 A;  4AM1 A;  3B6R A;  4HPP A;  4BG4 A;  4LNN A;  3ZXV A; 
#chains in the Genus database with same CATH topology
 1U6R A;  1VRP A;  3L2E B;  1F1H A;  4ACF A;  3DRE A;  1P50 A;  1F52 A;  1VA6 A;  2D3C A;  4RF8 A;  1RL9 A;  2BVC A;  1CRK A;  4S17 A;  1QH4 A;  4BG4 B;  4GW0 A;  3IG5 A;  4XYC A;  1HTQ A;  1QK1 A;  2D32 A;  4GVZ A;  4LNO A;  3JU5 A;  4RF9 A;  2UU7 A;  3L2E A;  3FKY A;  1G0W A;  2WHI A;  3NG0 A;  5J9A A;  3ZXR A;  4BHL A;  1BG0 A;  2D3A A;  4LNI A;  3L2D A;  4GW2 A;  4BG4 A;  1M15 A;  2D3B A;  1P52 A;  2LGS A;  3DRB A;  4RF7 A;  4BAX A;  2CRK A;  3M10 A;  2GLS A;  4RF6 A;  2QC8 A;  5J99 A;  2GWD A;  3JU6 A;  4LNF A;  2WGS A;  2GWC A;  1TT4 A;  1FPY A;  3B6R A;  3ZXV A;  4Q2R A;  3IG8 A;  3LN6 A;  4S0R A;  1R8G A;  1SD0 A;  2J1Q A;  4Z9M A;  3LVW A;  3LN7 A;  1V4G A;  3JPZ A;  3NZT A;  1HTO A;  1LGR A;  2D33 A;  1I0E A;  4GVY A;  3JQ3 A;  4LNK A;  2OJW A;  3LVV A;  4AM1 A;  4HPP A;  4LNN A; 
#chains in the Genus database with same CATH homology
 1U6R A;  1VRP A;  1M15 A;  3L2E B;  4GVZ A;  4Q2R A;  1F1H A;  1P52 A;  2LGS A;  4ACF A;  4LNO A;  3JU5 A;  3DRB A;  4RF9 A;  3L2E A;  4S0R A;  4RF7 A;  2CRK A;  3M10 A;  1G0W A;  3DRE A;  1P50 A;  1SD0 A;  2GLS A;  2WHI A;  2J1Q A;  4RF6 A;  3NG0 A;  5J9A A;  1F52 A;  4Z9M A;  5J99 A;  3JU6 A;  4LNF A;  3ZXR A;  2WGS A;  3JPZ A;  4RF8 A;  1RL9 A;  4BHL A;  1HTO A;  1BG0 A;  1LGR A;  4LNI A;  1FPY A;  2BVC A;  1I0E A;  4GVY A;  3JQ3 A;  3L2D A;  1CRK A;  4LNK A;  4GW2 A;  1QH4 A;  4BG4 B;  4GW0 A;  4S17 A;  4XYC A;  1HTQ A;  1QK1 A;  4AM1 A;  3B6R A;  4HPP A;  4BG4 A;  4LNN A;  3ZXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...