4RF6A

Crystal structure of double-domain arginine kinase from anthopleura japonicas
Total Genus 248
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
248
sequence length
715
structure length
696
Chain Sequence
HMADPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGIDAGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine kinase
publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
total genus 248
structure length 696
sequence length 715
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A04
2GLSA 3B6RA 2LGSA 4LNOA 3ZXRA 1P50A 4Q2RA 1P52A 4AM1A 1F1HA 2WGSA 4XYCA 3JU6A 4LNKA 4Z9MA 4BG4B 4LNIA 4GW2A 4RF8A 1QK1A 1FPYA 4S0RA 3M10A 1VRPA 1U6RA 4S17A 1RL9A 4GVYA 4RF9A 4RF6A 1SD0A 4BHLA 4RF7A 1BG0A 4HPPA 1M15A 1G0WA 1QH4A 3DRBA 3L2EA 1HTQA 1LGRA 3JQ3A 2J1QA 4ACFA 5J9AA 3ZXVA 4GW0A 1HTOA 2CRKA 1F52A 3JU5A 4LNFA 3JPZA 3L2EB 4GVZA 4BG4A 5J99A 2BVCA 2WHIA 4LNNA 3NG0A 1I0EA 1CRKA 3DREA 3L2DA
chains in the Genus database with same CATH superfamily
2GWCA 2LGSA 3LN6A 4AM1A 3JU6A 4Z9MA 2UU7A 3M10A 1RL9A 1VA6A 1HTQA 1LGRA 2J1QA 2D32A 4ACFA 3ZXVA 2CRKA 1F52A 1R8GA 4LNFA 5J99A 1I0EA 1CRKA 3DREA 2GLSA 1TT4A 3LN7A 4XYCA 4BG4B 4GW2A 1VRPA 1U6RA 3DRBA 1HTOA 3JPZA 4GVZA 2QC8A 3IG8A 2WHIA 3NG0A 4LNOA 2GWDA 2WGSA 2D33A 4LNKA 2D3AA 4LNIA 1QK1A 1FPYA 3LVWA 4RF9A 4RF6A 4BHLA 4RF7A 4HPPA 1G0WA 1QH4A 3NZTA 3JQ3A 1V4GA 4GW0A 3JU5A 2BVCA 3L2DA 3B6RA 3ZXRA 3LVVA 3FKYA 1P50A 4Q2RA 1P52A 1F1HA 4RF8A 4S0RA 2D3CA 4S17A 4GVYA 1SD0A 1BG0A 1M15A 3L2EA 4BAXA 2D3BA 5J9AA 3IG5A 2OJWA 3L2EB 4LNNA 4BG4A
chains in the Genus database with same CATH topology
2GLSA 3B6RA 2LGSA 4LNOA 3ZXRA 1P50A 4Q2RA 1P52A 4AM1A 1F1HA 2WGSA 4XYCA 3JU6A 4LNKA 4Z9MA 4BG4B 4LNIA 4GW2A 4RF8A 1QK1A 1FPYA 4S0RA 3M10A 1VRPA 1U6RA 4S17A 1RL9A 4GVYA 4RF9A 4RF6A 1SD0A 4BHLA 4RF7A 1BG0A 4HPPA 1M15A 1G0WA 1QH4A 3DRBA 3L2EA 1HTQA 1LGRA 3JQ3A 2J1QA 4ACFA 5J9AA 3ZXVA 4GW0A 1HTOA 2CRKA 1F52A 3JU5A 4LNFA 3JPZA 3L2EB 4GVZA 4BG4A 5J99A 2BVCA 2WHIA 4LNNA 3NG0A 1I0EA 1CRKA 3DREA 3L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLS A;  3B6R A;  2LGS A;  4LNO A;  3ZXR A;  1P50 A;  4Q2R A;  1P52 A;  4AM1 A;  1F1H A;  2WGS A;  4XYC A;  3JU6 A;  4LNK A;  4Z9M A;  4BG4 B;  4LNI A;  4GW2 A;  4RF8 A;  1QK1 A;  1FPY A;  4S0R A;  3M10 A;  1VRP A;  1U6R A;  4S17 A;  1RL9 A;  4GVY A;  4RF9 A;  4RF6 A;  1SD0 A;  4BHL A;  4RF7 A;  1BG0 A;  4HPP A;  1M15 A;  1G0W A;  1QH4 A;  3DRB A;  3L2E A;  1HTQ A;  1LGR A;  3JQ3 A;  2J1Q A;  4ACF A;  5J9A A;  3ZXV A;  4GW0 A;  1HTO A;  2CRK A;  1F52 A;  3JU5 A;  4LNF A;  3JPZ A;  3L2E B;  4GVZ A;  4BG4 A;  5J99 A;  2BVC A;  2WHI A;  4LNN A;  3NG0 A;  1I0E A;  1CRK A;  3DRE A;  3L2D A; 
#chains in the Genus database with same CATH topology
 2GWC A;  2LGS A;  3LN6 A;  4AM1 A;  3JU6 A;  4Z9M A;  2UU7 A;  3M10 A;  1RL9 A;  1VA6 A;  1HTQ A;  1LGR A;  2J1Q A;  2D32 A;  4ACF A;  3ZXV A;  2CRK A;  1F52 A;  1R8G A;  4LNF A;  5J99 A;  1I0E A;  1CRK A;  3DRE A;  2GLS A;  1TT4 A;  3LN7 A;  4XYC A;  4BG4 B;  4GW2 A;  1VRP A;  1U6R A;  3DRB A;  1HTO A;  3JPZ A;  4GVZ A;  2QC8 A;  3IG8 A;  2WHI A;  3NG0 A;  4LNO A;  2GWD A;  2WGS A;  2D33 A;  4LNK A;  2D3A A;  4LNI A;  1QK1 A;  1FPY A;  3LVW A;  4RF9 A;  4RF6 A;  4BHL A;  4RF7 A;  4HPP A;  1G0W A;  1QH4 A;  3NZT A;  3JQ3 A;  1V4G A;  4GW0 A;  3JU5 A;  2BVC A;  3L2D A;  3B6R A;  3ZXR A;  3LVV A;  3FKY A;  1P50 A;  4Q2R A;  1P52 A;  1F1H A;  4RF8 A;  4S0R A;  2D3C A;  4S17 A;  4GVY A;  1SD0 A;  1BG0 A;  1M15 A;  3L2E A;  4BAX A;  2D3B A;  5J9A A;  3IG5 A;  2OJW A;  3L2E B;  4LNN A;  4BG4 A; 
#chains in the Genus database with same CATH homology
 2GLS A;  3B6R A;  2LGS A;  4LNO A;  3ZXR A;  1P50 A;  4Q2R A;  1P52 A;  4AM1 A;  1F1H A;  2WGS A;  4XYC A;  3JU6 A;  4LNK A;  4Z9M A;  4BG4 B;  4LNI A;  4GW2 A;  4RF8 A;  1QK1 A;  1FPY A;  4S0R A;  3M10 A;  1VRP A;  1U6R A;  4S17 A;  1RL9 A;  4GVY A;  4RF9 A;  4RF6 A;  1SD0 A;  4BHL A;  4RF7 A;  1BG0 A;  4HPP A;  1M15 A;  1G0W A;  1QH4 A;  3DRB A;  3L2E A;  1HTQ A;  1LGR A;  3JQ3 A;  2J1Q A;  4ACF A;  5J9A A;  3ZXV A;  4GW0 A;  1HTO A;  2CRK A;  1F52 A;  3JU5 A;  4LNF A;  3JPZ A;  3L2E B;  4GVZ A;  4BG4 A;  5J99 A;  2BVC A;  2WHI A;  4LNN A;  3NG0 A;  1I0E A;  1CRK A;  3DRE A;  3L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...