4RF6A

Crystal structure of double-domain arginine kinase from anthopleura japonicas
Total Genus 248
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
248
sequence length
715
structure length
696
Chain Sequence
b'HMADPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGIDAGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine kinase
publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
total genus 248
structure length 696
sequence length 715
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A04
1G0WA 3L2EA 4LNOA 4RF6A 4LNFA 4XYCA 3L2DA 4RF8A 4RF9A 4AM1A 1CRKA 2GLSA 3NG0A 3M10A 1SD0A 4BG4A 4LNIA 1QH4A 4BHLA 1LGRA 1HTOA 4Q2RA 4S17A 1HTQA 1VRPA 2J1QA 1BG0A 1RL9A 4GVYA 3DREA 4RF7A 3JU5A 3JPZA 4LNNA 1P52A 1I0EA 2BVCA 3B6RA 2CRKA 3JU6A 3DRBA 4GW0A 5J9AA 1QK1A 5J99A 4LNKA 3JQ3A 2LGSA 1F52A 4GW2A 2WGSA 3ZXVA 3ZXRA 3L2EB 2WHIA 4ACFA 1P50A 4Z9MA 4BG4B 4HPPA 1M15A 1FPYA 1F1HA 4S0RA 4GVZA 1U6RA
chains in the Genus database with same CATH superfamily
1G0WA 3L2EA 1TT4A 4RF6A 3NG0A 1CRKA 3M10A 1SD0A 2GWDA 3FKYA 1LGRA 4Q2RA 2D3AA 3LN7A 1VRPA 1BG0A 1RL9A 4GVYA 1V4GA 2GWCA 3DREA 4LNNA 2BVCA 3B6RA 4GW0A 1QK1A 1F52A 2WGSA 1F1HA 2LGSA 1U6RA 4LNFA 3LVVA 3JPZA 2D33A 1P52A 1I0EA 3LVWA 2CRKA 1R8GA 5J99A 3NZTA 3ZXVA 3ZXRA 3L2EB 2D3BA 4ACFA 3IG8A 4HPPA 1M15A 4S0RA 2GLSA 4LNOA 4XYCA 3L2DA 4RF8A 4AM1A 4LNIA 1QH4A 4S17A 1HTQA 4RF7A 3JU5A 2D3CA 2OJWA 1VA6A 3JU6A 3JQ3A 4GW2A 4Z9MA 2UU7A 4RF9A 3LN6A 4BG4A 4BHLA 1HTOA 3IG5A 2J1QA 4BAXA 2D32A 3DRBA 5J9AA 4LNKA 2WHIA 1P50A 4BG4B 1FPYA 2QC8A 4GVZA
chains in the Genus database with same CATH topology
1G0WA 3L2EA 4LNOA 4RF6A 4LNFA 4XYCA 3L2DA 4RF8A 4RF9A 4AM1A 1CRKA 2GLSA 3NG0A 3M10A 1SD0A 4BG4A 4LNIA 1QH4A 4BHLA 1LGRA 1HTOA 4Q2RA 4S17A 1HTQA 1VRPA 2J1QA 1BG0A 1RL9A 4GVYA 3DREA 4RF7A 3JU5A 3JPZA 4LNNA 1P52A 1I0EA 2BVCA 3B6RA 2CRKA 3JU6A 3DRBA 4GW0A 5J9AA 1QK1A 5J99A 4LNKA 3JQ3A 2LGSA 1F52A 4GW2A 2WGSA 3ZXVA 3ZXRA 3L2EB 2WHIA 4ACFA 1P50A 4Z9MA 4BG4B 4HPPA 1M15A 1FPYA 1F1HA 4S0RA 4GVZA 1U6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G0W A;  3L2E A;  4LNO A;  4RF6 A;  4LNF A;  4XYC A;  3L2D A;  4RF8 A;  4RF9 A;  4AM1 A;  1CRK A;  2GLS A;  3NG0 A;  3M10 A;  1SD0 A;  4BG4 A;  4LNI A;  1QH4 A;  4BHL A;  1LGR A;  1HTO A;  4Q2R A;  4S17 A;  1HTQ A;  1VRP A;  2J1Q A;  1BG0 A;  1RL9 A;  4GVY A;  3DRE A;  4RF7 A;  3JU5 A;  3JPZ A;  4LNN A;  1P52 A;  1I0E A;  2BVC A;  3B6R A;  2CRK A;  3JU6 A;  3DRB A;  4GW0 A;  5J9A A;  1QK1 A;  5J99 A;  4LNK A;  3JQ3 A;  2LGS A;  1F52 A;  4GW2 A;  2WGS A;  3ZXV A;  3ZXR A;  3L2E B;  2WHI A;  4ACF A;  1P50 A;  4Z9M A;  4BG4 B;  4HPP A;  1M15 A;  1FPY A;  1F1H A;  4S0R A;  4GVZ A;  1U6R A; 
#chains in the Genus database with same CATH topology
 1G0W A;  3L2E A;  1TT4 A;  4RF6 A;  3NG0 A;  1CRK A;  3M10 A;  1SD0 A;  2GWD A;  3FKY A;  1LGR A;  4Q2R A;  2D3A A;  3LN7 A;  1VRP A;  1BG0 A;  1RL9 A;  4GVY A;  1V4G A;  2GWC A;  3DRE A;  4LNN A;  2BVC A;  3B6R A;  4GW0 A;  1QK1 A;  1F52 A;  2WGS A;  1F1H A;  2LGS A;  1U6R A;  4LNF A;  3LVV A;  3JPZ A;  2D33 A;  1P52 A;  1I0E A;  3LVW A;  2CRK A;  1R8G A;  5J99 A;  3NZT A;  3ZXV A;  3ZXR A;  3L2E B;  2D3B A;  4ACF A;  3IG8 A;  4HPP A;  1M15 A;  4S0R A;  2GLS A;  4LNO A;  4XYC A;  3L2D A;  4RF8 A;  4AM1 A;  4LNI A;  1QH4 A;  4S17 A;  1HTQ A;  4RF7 A;  3JU5 A;  2D3C A;  2OJW A;  1VA6 A;  3JU6 A;  3JQ3 A;  4GW2 A;  4Z9M A;  2UU7 A;  4RF9 A;  3LN6 A;  4BG4 A;  4BHL A;  1HTO A;  3IG5 A;  2J1Q A;  4BAX A;  2D32 A;  3DRB A;  5J9A A;  4LNK A;  2WHI A;  1P50 A;  4BG4 B;  1FPY A;  2QC8 A;  4GVZ A; 
#chains in the Genus database with same CATH homology
 1G0W A;  3L2E A;  4LNO A;  4RF6 A;  4LNF A;  4XYC A;  3L2D A;  4RF8 A;  4RF9 A;  4AM1 A;  1CRK A;  2GLS A;  3NG0 A;  3M10 A;  1SD0 A;  4BG4 A;  4LNI A;  1QH4 A;  4BHL A;  1LGR A;  1HTO A;  4Q2R A;  4S17 A;  1HTQ A;  1VRP A;  2J1Q A;  1BG0 A;  1RL9 A;  4GVY A;  3DRE A;  4RF7 A;  3JU5 A;  3JPZ A;  4LNN A;  1P52 A;  1I0E A;  2BVC A;  3B6R A;  2CRK A;  3JU6 A;  3DRB A;  4GW0 A;  5J9A A;  1QK1 A;  5J99 A;  4LNK A;  3JQ3 A;  2LGS A;  1F52 A;  4GW2 A;  2WGS A;  3ZXV A;  3ZXR A;  3L2E B;  2WHI A;  4ACF A;  1P50 A;  4Z9M A;  4BG4 B;  4HPP A;  1M15 A;  1FPY A;  1F1H A;  4S0R A;  4GVZ A;  1U6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...