4RF6A

Crystal structure of double-domain arginine kinase from anthopleura japonicas
Total Genus 248
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
248
sequence length
715
structure length
696
Chain Sequence
HMADPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGIDAGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
molecule keywords Arginine kinase
total genus 248
structure length 696
sequence length 715
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf6A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf6A04
4BHLA 1HTOA 4AM1A 4RF8A 3DRBA 2J1QA 3JU5A 2WHIA 4BG4A 3NG0A 1SD0A 1QK1A 1P50A 1BG0A 3L2EA 4GVZA 4RF6A 2BVCA 4RF9A 4LNFA 3ZXRA 1M15A 1RL9A 3JPZA 2LGSA 1FPYA 4Q2RA 1G0WA 1VRPA 4LNIA 1P52A 3JU6A 2CRKA 3L2EB 4GW2A 5J9AA 2GLSA 3DREA 3ZXVA 4GVYA 1F1HA 3B6RA 1I0EA 4XYCA 4BG4B 4LNKA 4HPPA 1CRKA 1QH4A 3L2DA 3M10A 3JQ3A 4RF7A 4LNNA 4LNOA 4S17A 4ACFA 1LGRA 1HTQA 1F52A 4GW0A 1U6RA 5J99A 2WGSA 4S0RA 4Z9MA
chains in the Genus database with same CATH superfamily
3NZTA 1R8GA 1TT4A 1BG0A 3L2EA 3LN7A 1RL9A 3JPZA 2OJWA 4Q2RA 1VRPA 3LVVA 3L2EB 2GLSA 3ZXVA 1CRKA 1QH4A 4LNOA 3M10A 3JQ3A 4RF8A 2WHIA 1QK1A 3IG8A 4RF6A 4GVZA 4RF9A 3ZXRA 1M15A 2LGSA 4LNIA 1G0WA 3JU6A 2CRKA 2UU7A 1VA6A 3DREA 3B6RA 4XYCA 4LNKA 5J9AA 4AM1A 2D33A 3DRBA 3JU5A 4BG4A 3NG0A 1SD0A 1P50A 2QC8A 3LN6A 3LVWA 1P52A 2GWCA 1F1HA 1I0EA 3L2DA 4LNNA 2D32A 4S17A 2GWDA 1LGRA 1V4GA 1HTQA 4GW0A 1U6RA 5J99A 4S0RA 4BHLA 1HTOA 2J1QA 2D3BA 2BVCA 4LNFA 2D3CA 1FPYA 3FKYA 4GW2A 3IG5A 4GVYA 4BG4B 4HPPA 4RF7A 4BAXA 4ACFA 2D3AA 1F52A 2WGSA 4Z9MA
chains in the Genus database with same CATH topology
4BHLA 1HTOA 4AM1A 4RF8A 3DRBA 2J1QA 3JU5A 2WHIA 4BG4A 3NG0A 1SD0A 1QK1A 1P50A 1BG0A 3L2EA 4GVZA 4RF6A 2BVCA 4RF9A 4LNFA 3ZXRA 1M15A 1RL9A 3JPZA 2LGSA 1FPYA 4Q2RA 1G0WA 1VRPA 4LNIA 1P52A 3JU6A 2CRKA 3L2EB 4GW2A 5J9AA 2GLSA 3DREA 3ZXVA 4GVYA 1F1HA 3B6RA 1I0EA 4XYCA 4BG4B 4LNKA 4HPPA 1CRKA 1QH4A 3L2DA 3M10A 3JQ3A 4RF7A 4LNNA 4LNOA 4S17A 4ACFA 1LGRA 1HTQA 1F52A 4GW0A 1U6RA 5J99A 2WGSA 4S0RA 4Z9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHL A;  1HTO A;  4AM1 A;  4RF8 A;  3DRB A;  2J1Q A;  3JU5 A;  2WHI A;  4BG4 A;  3NG0 A;  1SD0 A;  1QK1 A;  1P50 A;  1BG0 A;  3L2E A;  4GVZ A;  4RF6 A;  2BVC A;  4RF9 A;  4LNF A;  3ZXR A;  1M15 A;  1RL9 A;  3JPZ A;  2LGS A;  1FPY A;  4Q2R A;  1G0W A;  1VRP A;  4LNI A;  1P52 A;  3JU6 A;  2CRK A;  3L2E B;  4GW2 A;  5J9A A;  2GLS A;  3DRE A;  3ZXV A;  4GVY A;  1F1H A;  3B6R A;  1I0E A;  4XYC A;  4BG4 B;  4LNK A;  4HPP A;  1CRK A;  1QH4 A;  3L2D A;  3M10 A;  3JQ3 A;  4RF7 A;  4LNN A;  4LNO A;  4S17 A;  4ACF A;  1LGR A;  1HTQ A;  1F52 A;  4GW0 A;  1U6R A;  5J99 A;  2WGS A;  4S0R A;  4Z9M A; 
#chains in the Genus database with same CATH topology
 3NZT A;  1R8G A;  1TT4 A;  1BG0 A;  3L2E A;  3LN7 A;  1RL9 A;  3JPZ A;  2OJW A;  4Q2R A;  1VRP A;  3LVV A;  3L2E B;  2GLS A;  3ZXV A;  1CRK A;  1QH4 A;  4LNO A;  3M10 A;  3JQ3 A;  4RF8 A;  2WHI A;  1QK1 A;  3IG8 A;  4RF6 A;  4GVZ A;  4RF9 A;  3ZXR A;  1M15 A;  2LGS A;  4LNI A;  1G0W A;  3JU6 A;  2CRK A;  2UU7 A;  1VA6 A;  3DRE A;  3B6R A;  4XYC A;  4LNK A;  5J9A A;  4AM1 A;  2D33 A;  3DRB A;  3JU5 A;  4BG4 A;  3NG0 A;  1SD0 A;  1P50 A;  2QC8 A;  3LN6 A;  3LVW A;  1P52 A;  2GWC A;  1F1H A;  1I0E A;  3L2D A;  4LNN A;  2D32 A;  4S17 A;  2GWD A;  1LGR A;  1V4G A;  1HTQ A;  4GW0 A;  1U6R A;  5J99 A;  4S0R A;  4BHL A;  1HTO A;  2J1Q A;  2D3B A;  2BVC A;  4LNF A;  2D3C A;  1FPY A;  3FKY A;  4GW2 A;  3IG5 A;  4GVY A;  4BG4 B;  4HPP A;  4RF7 A;  4BAX A;  4ACF A;  2D3A A;  1F52 A;  2WGS A;  4Z9M A; 
#chains in the Genus database with same CATH homology
 4BHL A;  1HTO A;  4AM1 A;  4RF8 A;  3DRB A;  2J1Q A;  3JU5 A;  2WHI A;  4BG4 A;  3NG0 A;  1SD0 A;  1QK1 A;  1P50 A;  1BG0 A;  3L2E A;  4GVZ A;  4RF6 A;  2BVC A;  4RF9 A;  4LNF A;  3ZXR A;  1M15 A;  1RL9 A;  3JPZ A;  2LGS A;  1FPY A;  4Q2R A;  1G0W A;  1VRP A;  4LNI A;  1P52 A;  3JU6 A;  2CRK A;  3L2E B;  4GW2 A;  5J9A A;  2GLS A;  3DRE A;  3ZXV A;  4GVY A;  1F1H A;  3B6R A;  1I0E A;  4XYC A;  4BG4 B;  4LNK A;  4HPP A;  1CRK A;  1QH4 A;  3L2D A;  3M10 A;  3JQ3 A;  4RF7 A;  4LNN A;  4LNO A;  4S17 A;  4ACF A;  1LGR A;  1HTQ A;  1F52 A;  4GW0 A;  1U6R A;  5J99 A;  2WGS A;  4S0R A;  4Z9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...