3B6RA

Crystal structure of human brain-type creatine kinase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
376
structure length
376
Chain Sequence
SHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Creatine kinase B-type
total genus 132
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3b6rA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3b6rA02
1QK1A 4RF8A 2WHIA 3M10A 1BG0A 5J99A 4S17A 4Q2RA 4BHLA 3DRBA 3ZXVA 1FPYA 3B6RA 2WGSA 1SD0A 4LNOA 4ACFA 2CRKA 4GVYA 4BG4B 2GLSA 4RF9A 1QH4A 4LNNA 1F52A 3JQ3A 3L2EB 4AM1A 1P50A 4XYCA 4LNFA 1F1HA 3NG0A 1RL9A 1U6RA 1HTOA 3JU6A 5J9AA 2LGSA 4RF6A 4Z9MA 1CRKA 4HPPA 3ZXRA 2BVCA 3L2EA 4GW0A 3DREA 1VRPA 4GW2A 1M15A 3JPZA 4S0RA 1P52A 4GVZA 3JU5A 1G0WA 4BG4A 1I0EA 4RF7A 4LNIA 3L2DA 1HTQA 1LGRA 4LNKA 2J1QA
chains in the Genus database with same CATH superfamily
1QK1A 4Q2RA 4BHLA 2GLSA 3LVVA 2QC8A 1R8GA 1P50A 1F1HA 3JU6A 4HPPA 2D3BA 2GWCA 1TT4A 1M15A 3JPZA 4S0RA 2WHIA 3ZXVA 1FPYA 2WGSA 4LNOA 1F52A 3L2EB 2OJWA 4XYCA 3NG0A 1HTOA 5J9AA 2D33A 2LGSA 4RF6A 4Z9MA 3L2EA 1VRPA 3JU5A 1I0EA 1HTQA 3LN7A 4LNKA 3IG8A 3M10A 1BG0A 5J99A 4S17A 2D3CA 1SD0A 2CRKA 4RF9A 2GWDA 4LNNA 3JQ3A 4LNFA 3IG5A 3NZTA 1V4GA 1RL9A 4GW0A 4RF7A 3L2DA 1LGRA 2J1QA 4RF8A 2UU7A 3DRBA 3B6RA 4ACFA 4GVYA 4BG4B 1VA6A 1QH4A 4AM1A 4BAXA 3LVWA 3LN6A 1U6RA 2D3AA 1CRKA 3ZXRA 2BVCA 3DREA 2D32A 3FKYA 4GW2A 1P52A 4GVZA 4BG4A 1G0WA 4LNIA
chains in the Genus database with same CATH topology
1QK1A 4RF8A 2WHIA 3M10A 1BG0A 5J99A 4S17A 4Q2RA 4BHLA 3DRBA 3ZXVA 1FPYA 3B6RA 2WGSA 1SD0A 4LNOA 4ACFA 2CRKA 4GVYA 4BG4B 2GLSA 4RF9A 1QH4A 4LNNA 1F52A 3JQ3A 3L2EB 4AM1A 1P50A 4XYCA 4LNFA 1F1HA 3NG0A 1RL9A 1U6RA 1HTOA 3JU6A 5J9AA 2LGSA 4RF6A 4Z9MA 1CRKA 4HPPA 3ZXRA 2BVCA 3L2EA 4GW0A 3DREA 1VRPA 4GW2A 1M15A 3JPZA 4S0RA 1P52A 4GVZA 3JU5A 1G0WA 4BG4A 1I0EA 4RF7A 4LNIA 3L2DA 1HTQA 1LGRA 4LNKA 2J1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK1 A;  4RF8 A;  2WHI A;  3M10 A;  1BG0 A;  5J99 A;  4S17 A;  4Q2R A;  4BHL A;  3DRB A;  3ZXV A;  1FPY A;  3B6R A;  2WGS A;  1SD0 A;  4LNO A;  4ACF A;  2CRK A;  4GVY A;  4BG4 B;  2GLS A;  4RF9 A;  1QH4 A;  4LNN A;  1F52 A;  3JQ3 A;  3L2E B;  4AM1 A;  1P50 A;  4XYC A;  4LNF A;  1F1H A;  3NG0 A;  1RL9 A;  1U6R A;  1HTO A;  3JU6 A;  5J9A A;  2LGS A;  4RF6 A;  4Z9M A;  1CRK A;  4HPP A;  3ZXR A;  2BVC A;  3L2E A;  4GW0 A;  3DRE A;  1VRP A;  4GW2 A;  1M15 A;  3JPZ A;  4S0R A;  1P52 A;  4GVZ A;  3JU5 A;  1G0W A;  4BG4 A;  1I0E A;  4RF7 A;  4LNI A;  3L2D A;  1HTQ A;  1LGR A;  4LNK A;  2J1Q A; 
#chains in the Genus database with same CATH topology
 1QK1 A;  4Q2R A;  4BHL A;  2GLS A;  3LVV A;  2QC8 A;  1R8G A;  1P50 A;  1F1H A;  3JU6 A;  4HPP A;  2D3B A;  2GWC A;  1TT4 A;  1M15 A;  3JPZ A;  4S0R A;  2WHI A;  3ZXV A;  1FPY A;  2WGS A;  4LNO A;  1F52 A;  3L2E B;  2OJW A;  4XYC A;  3NG0 A;  1HTO A;  5J9A A;  2D33 A;  2LGS A;  4RF6 A;  4Z9M A;  3L2E A;  1VRP A;  3JU5 A;  1I0E A;  1HTQ A;  3LN7 A;  4LNK A;  3IG8 A;  3M10 A;  1BG0 A;  5J99 A;  4S17 A;  2D3C A;  1SD0 A;  2CRK A;  4RF9 A;  2GWD A;  4LNN A;  3JQ3 A;  4LNF A;  3IG5 A;  3NZT A;  1V4G A;  1RL9 A;  4GW0 A;  4RF7 A;  3L2D A;  1LGR A;  2J1Q A;  4RF8 A;  2UU7 A;  3DRB A;  3B6R A;  4ACF A;  4GVY A;  4BG4 B;  1VA6 A;  1QH4 A;  4AM1 A;  4BAX A;  3LVW A;  3LN6 A;  1U6R A;  2D3A A;  1CRK A;  3ZXR A;  2BVC A;  3DRE A;  2D32 A;  3FKY A;  4GW2 A;  1P52 A;  4GVZ A;  4BG4 A;  1G0W A;  4LNI A; 
#chains in the Genus database with same CATH homology
 1QK1 A;  4RF8 A;  2WHI A;  3M10 A;  1BG0 A;  5J99 A;  4S17 A;  4Q2R A;  4BHL A;  3DRB A;  3ZXV A;  1FPY A;  3B6R A;  2WGS A;  1SD0 A;  4LNO A;  4ACF A;  2CRK A;  4GVY A;  4BG4 B;  2GLS A;  4RF9 A;  1QH4 A;  4LNN A;  1F52 A;  3JQ3 A;  3L2E B;  4AM1 A;  1P50 A;  4XYC A;  4LNF A;  1F1H A;  3NG0 A;  1RL9 A;  1U6R A;  1HTO A;  3JU6 A;  5J9A A;  2LGS A;  4RF6 A;  4Z9M A;  1CRK A;  4HPP A;  3ZXR A;  2BVC A;  3L2E A;  4GW0 A;  3DRE A;  1VRP A;  4GW2 A;  1M15 A;  3JPZ A;  4S0R A;  1P52 A;  4GVZ A;  3JU5 A;  1G0W A;  4BG4 A;  1I0E A;  4RF7 A;  4LNI A;  3L2D A;  1HTQ A;  1LGR A;  4LNK A;  2J1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...