The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
159
|
sequence length |
436
|
structure length |
436
|
Chain Sequence |
EPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for the redox control of plant glutamate cysteine ligase.
pubmed doi rcsb |
molecule tags |
Ligase
|
source organism |
Brassica juncea
|
molecule keywords |
Glutamate cysteine ligase
|
total genus |
159
|
structure length |
436
|
sequence length |
436
|
ec nomenclature |
ec
6.3.2.2: Glutamate--cysteine ligase. |
pdb deposition date | 2006-05-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04107 | GCS2 | Glutamate-cysteine ligase family 2(GCS2) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Creatine Kinase; Chain A, domain 2 | Creatine Kinase; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 3LN6 A; 2GWD A; 1V4G A; 1TT4 A; 2D33 A; 2GWC A; 3NZT A; 1VA6 A; 3LN7 A; 2D32 A; 1R8G A; #chains in the Genus database with same CATH topology 2GWD A; 2LGS A; 3ZXR A; 4S0R A; 3LN6 A; 4Z9M A; 4BHL A; 3DRE A; 4ACF A; 1LGR A; 1U6R A; 1QH4 A; 1F1H A; 4GW0 A; 4GVZ A; 1HTQ A; 1QK1 A; 1P50 A; 1HTO A; 2D32 A; 5J99 A; 3NZT A; 1VRP A; 2J1Q A; 4BAX A; 2WHI A; 1M15 A; 3NG0 A; 4RF8 A; 4XYC A; 3IG5 A; 4LNN A; 2WGS A; 4RF6 A; 1FPY A; 4LNF A; 1R8G A; 4RF7 A; 4AM1 A; 1VA6 A; 2D3B A; 4BG4 B; 2CRK A; 3ZXV A; 1V4G A; 2D33 A; 2OJW A; 3FKY A; 3LVV A; 5J9A A; 3IG8 A; 3M10 A; 1SD0 A; 4GW2 A; 3JQ3 A; 1RL9 A; 2QC8 A; 3JU5 A; 1F52 A; 2D3C A; 3LVW A; 2BVC A; 1CRK A; 4LNI A; 1P52 A; 1BG0 A; 2D3A A; 2UU7 A; 1G0W A; 4BG4 A; 1TT4 A; 2GWC A; 3L2E B; 4LNO A; 3B6R A; 4GVY A; 2GLS A; 4RF9 A; 4HPP A; 3L2E A; 1I0E A; 3LN7 A; 3JPZ A; 3L2D A; 4Q2R A; 3JU6 A; 4S17 A; 3DRB A; 4LNK A; #chains in the Genus database with same CATH homology 2GWD A; 1V4G A; 2D33 A; 2OJW A; 2D3A A; 2UU7 A; 4BAX A; 3FKY A; 3LVV A; 3LN6 A; 1TT4 A; 2GWC A; 3IG8 A; 3IG5 A; 2QC8 A; 3LN7 A; 2D32 A; 1R8G A; 2D3C A; 3LVW A; 1VA6 A; 3NZT A; 2D3B A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...