2GWDA

Crystal structure of plant glutamate cysteine ligase in complex with mg2+ and l-glutamate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
436
structure length
436
Chain Sequence
EPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the redox control of plant glutamate cysteine ligase.
pubmed doi rcsb
source organism Brassica juncea
molecule tags Ligase
molecule keywords Glutamate cysteine ligase
total genus 159
structure length 436
sequence length 436
ec nomenclature ec 6.3.2.2: Glutamate--cysteine ligase.
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04107 GCS2 Glutamate-cysteine ligase family 2(GCS2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.590.20 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2gwdA00
1R8GA 2D33A 3NZTA 2GWDA 3LN7A 3LN6A 1V4GA 2GWCA 1TT4A 1VA6A 2D32A
chains in the Genus database with same CATH superfamily
3FKYA 2UU7A 1CRKA 1SD0A 1G0WA 5J99A 1VRPA 4BG4A 1I0EA 4LNIA 4XYCA 3IG8A 4Q2RA 2D32A 4GVZA 3L2EA 2D3BA 4RF9A 4RF7A 4ACFA 3L2EB 1HTQA 1U6RA 4RF6A 1P52A 2GWDA 1VA6A 1HTOA 1F1HA 3B6RA 4LNKA 4S17A 3LVVA 3JQ3A 4LNFA 1LGRA 3JU6A 3DRBA 2D33A 3JPZA 1F52A 2D3CA 4Z9MA 3LN7A 2OJWA 1V4GA 2LGSA 4BAXA 3IG5A 2WHIA 4GW0A 4BG4B 4LNOA 2D3AA 3DREA 2GWCA 3LN6A 4GVYA 3JU5A 2CRKA 1R8GA 3L2DA 1RL9A 3ZXRA 2BVCA 1TT4A 4GW2A 5J9AA 1FPYA 2GLSA 3NZTA 4S0RA 4AM1A 3ZXVA 2WGSA 3LVWA 3NG0A 4HPPA 1QH4A 2J1QA 3M10A 4BHLA 2QC8A 1QK1A 1BG0A 1M15A 4LNNA 1P50A 4RF8A
chains in the Genus database with same CATH topology
2D33A 3FKYA 2D3CA 3LN7A 2OJWA 1V4GA 4BAXA 2UU7A 3IG5A 2GWDA 3NZTA 1VA6A 3LVWA 2D3AA 2QC8A 3LN6A 2GWCA 3IG8A 2D32A 3LVVA 1R8GA 2D3BA 1TT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8G A;  2D33 A;  3NZT A;  2GWD A;  3LN7 A;  3LN6 A;  1V4G A;  2GWC A;  1TT4 A;  1VA6 A;  2D32 A; 
#chains in the Genus database with same CATH topology
 3FKY A;  2UU7 A;  1CRK A;  1SD0 A;  1G0W A;  5J99 A;  1VRP A;  4BG4 A;  1I0E A;  4LNI A;  4XYC A;  3IG8 A;  4Q2R A;  2D32 A;  4GVZ A;  3L2E A;  2D3B A;  4RF9 A;  4RF7 A;  4ACF A;  3L2E B;  1HTQ A;  1U6R A;  4RF6 A;  1P52 A;  2GWD A;  1VA6 A;  1HTO A;  1F1H A;  3B6R A;  4LNK A;  4S17 A;  3LVV A;  3JQ3 A;  4LNF A;  1LGR A;  3JU6 A;  3DRB A;  2D33 A;  3JPZ A;  1F52 A;  2D3C A;  4Z9M A;  3LN7 A;  2OJW A;  1V4G A;  2LGS A;  4BAX A;  3IG5 A;  2WHI A;  4GW0 A;  4BG4 B;  4LNO A;  2D3A A;  3DRE A;  2GWC A;  3LN6 A;  4GVY A;  3JU5 A;  2CRK A;  1R8G A;  3L2D A;  1RL9 A;  3ZXR A;  2BVC A;  1TT4 A;  4GW2 A;  5J9A A;  1FPY A;  2GLS A;  3NZT A;  4S0R A;  4AM1 A;  3ZXV A;  2WGS A;  3LVW A;  3NG0 A;  4HPP A;  1QH4 A;  2J1Q A;  3M10 A;  4BHL A;  2QC8 A;  1QK1 A;  1BG0 A;  1M15 A;  4LNN A;  1P50 A;  4RF8 A; 
#chains in the Genus database with same CATH homology
 2D33 A;  3FKY A;  2D3C A;  3LN7 A;  2OJW A;  1V4G A;  4BAX A;  2UU7 A;  3IG5 A;  2GWD A;  3NZT A;  1VA6 A;  3LVW A;  2D3A A;  2QC8 A;  3LN6 A;  2GWC A;  3IG8 A;  2D32 A;  3LVV A;  1R8G A;  2D3B A;  1TT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...