2GWDA

Crystal structure of plant glutamate cysteine ligase in complex with mg2+ and l-glutamate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
436
structure length
436
Chain Sequence
b'EPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate cysteine ligase
publication title Structural basis for the redox control of plant glutamate cysteine ligase.
pubmed doi rcsb
source organism Brassica juncea
molecule tags Ligase
total genus 159
structure length 436
sequence length 436
ec nomenclature ec 6.3.2.2: Glutamate--cysteine ligase.
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04107 GCS2 Glutamate-cysteine ligase family 2(GCS2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.590.20 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2gwdA00
2GWCA 3LN6A 1TT4A 3LN7A 2D33A 3NZTA 1VA6A 1R8GA 2GWDA 2D32A 1V4GA
chains in the Genus database with same CATH superfamily
4S0RA 3L2EB 1M15A 4AM1A 4BAXA 1BG0A 1HTOA 1RL9A 3JPZA 1FPYA 2GLSA 4RF6A 3FKYA 1R8GA 4BG4A 1P52A 4GVYA 3JU6A 1LGRA 1CRKA 4LNKA 4BG4B 1HTQA 1F52A 2D3AA 1SD0A 4S17A 3ZXRA 2WGSA 2GWDA 2LGSA 4Z9MA 2GWCA 3IG8A 4GW0A 1G0WA 2BVCA 2D3BA 5J99A 4BHLA 4LNIA 3JQ3A 5J9AA 2OJWA 1TT4A 2CRKA 4XYCA 4ACFA 4LNOA 1VRPA 3LVWA 1F1HA 1V4GA 3NZTA 1I0EA 2D3CA 3B6RA 3LVVA 3JU5A 1P50A 2J1QA 3DREA 2UU7A 4RF9A 3LN6A 3L2EA 2D32A 1QH4A 3L2DA 3ZXVA 1U6RA 3DRBA 1QK1A 2QC8A 3NG0A 4RF8A 4LNNA 3IG5A 1VA6A 2WHIA 3LN7A 2D33A 4GVZA 4RF7A 4LNFA 4GW2A 3M10A 4HPPA 4Q2RA
chains in the Genus database with same CATH topology
4BAXA 2QC8A 3LVWA 2GWDA 1V4GA 3NZTA 2D3CA 2GWCA 3IG8A 3LVVA 3FKYA 3IG5A 1VA6A 1R8GA 2UU7A 3LN6A 3LN7A 2D33A 2D3BA 2D32A 2OJWA 1TT4A 2D3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWC A;  3LN6 A;  1TT4 A;  3LN7 A;  2D33 A;  3NZT A;  1VA6 A;  1R8G A;  2GWD A;  2D32 A;  1V4G A; 
#chains in the Genus database with same CATH topology
 4S0R A;  3L2E B;  1M15 A;  4AM1 A;  4BAX A;  1BG0 A;  1HTO A;  1RL9 A;  3JPZ A;  1FPY A;  2GLS A;  4RF6 A;  3FKY A;  1R8G A;  4BG4 A;  1P52 A;  4GVY A;  3JU6 A;  1LGR A;  1CRK A;  4LNK A;  4BG4 B;  1HTQ A;  1F52 A;  2D3A A;  1SD0 A;  4S17 A;  3ZXR A;  2WGS A;  2GWD A;  2LGS A;  4Z9M A;  2GWC A;  3IG8 A;  4GW0 A;  1G0W A;  2BVC A;  2D3B A;  5J99 A;  4BHL A;  4LNI A;  3JQ3 A;  5J9A A;  2OJW A;  1TT4 A;  2CRK A;  4XYC A;  4ACF A;  4LNO A;  1VRP A;  3LVW A;  1F1H A;  1V4G A;  3NZT A;  1I0E A;  2D3C A;  3B6R A;  3LVV A;  3JU5 A;  1P50 A;  2J1Q A;  3DRE A;  2UU7 A;  4RF9 A;  3LN6 A;  3L2E A;  2D32 A;  1QH4 A;  3L2D A;  3ZXV A;  1U6R A;  3DRB A;  1QK1 A;  2QC8 A;  3NG0 A;  4RF8 A;  4LNN A;  3IG5 A;  1VA6 A;  2WHI A;  3LN7 A;  2D33 A;  4GVZ A;  4RF7 A;  4LNF A;  4GW2 A;  3M10 A;  4HPP A;  4Q2R A; 
#chains in the Genus database with same CATH homology
 4BAX A;  2QC8 A;  3LVW A;  2GWD A;  1V4G A;  3NZT A;  2D3C A;  2GWC A;  3IG8 A;  3LVV A;  3FKY A;  3IG5 A;  1VA6 A;  1R8G A;  2UU7 A;  3LN6 A;  3LN7 A;  2D33 A;  2D3B A;  2D32 A;  2OJW A;  1TT4 A;  2D3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...