1HTOA

Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 149
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htoA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htoA01
1RL9A 3M10A 5J99A 4HPPA 2CRKA 1VRPA 2D3AA 3NG0A 4Q2RA 4AM1A 2WGSA 2D3CA 4LNNA 1LGRA 4RF7A 3JQ3A 3DREA 1I0EA 5J9AA 3L2EB 4LNFA 1HTQA 3JU6A 3L2EA 4ACFA 1SD0A 1G0WA 1U6RA 1P52A 4XYCA 2J1QA 4GW0A 4RF8A 4BG4B 4GVZA 4S17A 3ZXRA 4RF6A 1QK1A 4BG4A 1M15A 2OJWA 4Z9MA 3FKYA 2QC8A 2UU7A 3JU5A 4GVYA 3ZXVA 2GLSA 4LNIA 1F52A 2D3BA 1FPYA 3DRBA 4GW2A 2WHIA 4LNKA 4BAXA 2BVCA 1HTOA 1P50A 1BG0A 3JPZA 1CRKA 1QH4A 1F1HA 3B6RA 4RF9A 4LNOA 4S0RA 3L2DA 2LGSA 4BHLA
chains in the Genus database with same CATH superfamily
1WWTA 4HPLB 1YX6B 3I9V1 1E8XA 3DBLI 3P2BA 4AUQC 2D3CA 1SIJA 3AU4A 3QQ8B 4O1NA 2YVCA 3DVGY 1T0SC 3N1ZC 2A5UA 2M1MA 3GZNB 1OEYA 1RWSA 1FNWA 2KN5A 4HK2A 2CU1A 3NRZA 5H92C 1VRPA 4AM1A 2NPTA 3AE5B 2LJ5A 3DVGX 3ML8A 1CJEA 4WQOB 4XDCA 1XF5L 2IY1B 2JXTA 1IP9A 2EMTA 1T5XD 2QCZA 3W5UB 5J17A 1ZDXA 1OTRB 4A6QA 1WR6E 4XX5A 3RI7C 2JZ3B 3W1YA 3W5VB 2ZCBA 1WJNA 3URYA 4W9DA 3ZW3A 5H8YE 3T8MA 3WANA 1QT9A 3ZJVA 4RCOA 1E0ZA 2O2VA 5CHFA 3H1UA 3D32A 2KAJA 4GVZA 1D4BA 2FBWB 4A8XC 1GG3A 2N7DA 2NR2A 4A9AA 1C4PA 3L10B 2HTHA 2IZVB 1BG0A 4EZJA 2LEKA 4JX1C 2KQ7A 4YSYB 1HA5A 1KH0A 1WX9A 1P0RA 2L05A 2KDBA 1E8YA 2A4ZA 2KJHB 4ACFA 2WLBA 1VDVA 4KDLB 1JW9D 2OJWA 3TEZA 2MCNB 2LASA 1MFWA 1KLGD 2DNFA 4JLCA 1E7VA 2J7QB 4WJOA 2D2QA 4OW0A 3LDZE 3I5JC 3DREA 3RNAC 1R4NB 1NEKB 3P4QB 2LRWA 3GOEA 3U7DA 4C7YA 3L2EA 1PYWD 1FO4A 3MC0B 4XZ4A 5DPTA 2FE8A 3ZJTA 3N32A 4OZBA 3X0WA 1L0XB 4DHZB 1TGZB 4AJYB 1I4PA 3KYDD 2D5GA 2AYOB 2LRUA 3AULA 3FAHA 1GAQB 3AEBB 3SEBA 1J19A 3QA8A 3JVZX 2W3SA 4E74A 4GSWA 3N1XC 1B1ZA 4NJ6A 4EKUA 1F52A 2KTRB 2MJEA 4HJGE 4LDTB 4ASWC 1ET9A 1XO3A 2JQRB 2LGXA 1VZ7A 2ASQA 2H89B 3AN1A 1FM0D 1ESFA 5JZEB 1TYGB 2KFJA 2KWUB 1YOVB 3V62A 3Q3MC 3AI5A 2LUMA 2NVUI 5LXHA 1IYFA 3UIOB 3K9OB 3KLSX 4FJYA 3ECIA 3TEYA 5HI1A 2MSED 1R7SA 3SFDB 3ZJUA 1UBIA 3MC8A 1J0GA 3HK0A 4II2B 1WE6A 2QHOA 1ZUD2 5E6PA 2D33A 3VUWA 2WXPA 2CJOA 4YL8A 1WGGA 4OVUA 2L76A 3NJTA 2Y3AA 2MHJA 1YQBA 4WWNA 2IBIB 3PRPB 1KTKA 1ZOYB 4GLSC 1YQ4B 4EZKA 4AOFA 1Y56A 4NAWB 3DRBA 3UQBA 4ANVA 1XT9B 3CIRB 4ANWA 2BYVE 3ZLZA 2L1AA 2KWVB 2R2QA 3LVVA 1TY0A 2DYOA 2KMAA 3I63C 1TT4A 1SEBD 2K3UA 4ANXA 3AECB 4JGHB 1WX7A 5BYQA 4F1SA 2D10A 3AE9B 2WXRA 2MW5A 4BVUC 3V3XA 4GMVA 2PIAA 1SGHA 3KUDB 3VDZA 2ZW0A 4I6NB 2D3AA 4OHJA 1I42A 4GDKB 5E6NA 3ZDMC 4KVGB 1KLUD 3UIPB 2KWDA 5G5GA 4KGTA 4CHKA 2DAJA 4REZA 3AE3B 2EMSA 2Y5CA 1UF0A 2GBMA 4FJVB 3BYYB 1PQSA 2PJHA 1SD0A 4XYCA 1PGXA 2I38A 1PDXA 4HDOA 2B3AA 2Y5BB 1KRHA 2I1JA 3GB1A 1WYWB 3RUIB 3EFUA 3JPZA 2MJ3A 1GJZA 4KKJA 3UQAA 1HEZE 3EGRA 3RD2A 4D2KA 5IKCM 3EECA 1L4DB 3TSSA 4IW0A 1CZPA 2WHIA 3Q8BA 5BMHA 2OJRA 4GB9A 3WCQA 5AUIA 4DXAB 3A9KA 3W1SA 4RNAA 1P7EA 1UWMA 4HKQA 1WMHB 1V6EA 2MBEA 2KJRA 1RYJA 3LB8C 4RF6A 2KHWB 1FXIA 2PVOD 3KW5B 1D5MC 3B08A 4BAXA 3AEGB 3V60A 3K9PB 2JPHA 4ZYNA 1WJ4A 1ISNA 3P4RB 1FMAD 2J0JA 2MRPA 2AL6A 2KVZA 2OOBB 4KDIC 1WZ0A 3PRZA 2BGFA 5J9AA 4BZAA 3WAOA 4L23A 3EFCA 5LNK1 2DAFA 1P52A 2KANA 5FR6A 2PE6B 3RFZB 1E6EB 3GZNI 4R3DA 5C23A 4OVVA 1V1OA 2KJ6A 3PZDA 2BKFA 2M0XA 4FA6A 2MP2A 2MP2B 3QAQA 3VXWA 1WF9A 1Z2MA 3B9JA 4FN2A 1LFDA 2KVRA 2EKEC 1CQVA 5JHBA 5L95C 1STEA 4C00A 4FBJB 2ZNVB 3PT2B 1VR9A 4DQOC 3NVWA 2K25A 1NENB 1Q5WB 2RD0A 2N0SB 2LVPA 2KT7A 3P1MA 2R61A 4ZRIA 2HTME 3DWGC 2GBRA 3NHEB 3UINB 3EA6A 1I7HA 4WIPA 1RRBA 4HPPA 4XC2A 5D2MB 1EM7A 3ZTCA 2ZW1A 4EE2A 1YN3A 4TUUA 3VTVA 4EEWA 4HJKA 3APCA 3NS8A 2WXMA 1JALA 1TJEA 2IO2B 3C8YA 2JWZA 2V3NA 2UYZB 3IVFA 2N9XA 4JIOU 5HFYA 3IXSA 4N6EB 3QC8B 2KFKA 3L2DA 1C3TA 1V8CA 2DYMA 4F7ZA 4RGOS 2C60A 1QOBA 2LVQA 3IG5A 1ACCA 2Z0DB 5LLIA 4JQWC 1C9FA 1ZPSA 3TEXA 3VTWA 3LVWA 4PT5A 4GXBA 2BWFA 4IWQA 3Q3FA 1WGKA 1XLPA 4RFBA 1TKEA 1I4RA 2L8JA 2JF5A 3SD5A 4HCNB 3AEAB 2I2YA 2N7JA 1IGCA 1RLFA 2KLCA 2JUOA 1WIAA 3TCAA 1J7BA 1Z5SB 1M4VA 3MHZA 2KKCA 4X57B 2WDVB 3PSEB 2INPE 3H7PA 1V4GA 4RF7A 3CF6E 2HD5B 3VRBB 4RF0A 3A1QA 3A1QB 4ZRPA 2V1YA 2PLPA 3HIZA 1QK1A 1YQ3B 2KQSA 4W9CA 1TTNA 4HXDA 2N9PC 2LI5A 1V97A 3HVDA 4MGKE 5T8IA 1MPEA 2ZPYA 2VZKB 1D5XC 2N9KA 2JRHA 2G1EA 3ZO5B 1XEEA 4LNFA 4I6LB 4DHJB 3UF8A 1R4MB 1LXDA 2BYFA 1XQQA 2G4DB 3RNGC 5DCNA 3BWUD 5G5HA 3DHGC 2G45B 4HVBA 3ZNGC 3AEDB 3AE7B 1WRDB 4JWUC 4B0EA 1OQQA 2WYQA 1ZE3D 3R2IA 1AARA 2GI9A 3PLUA 1R8GA 1IGDA 3LYYA 4DHZE 1ZDVA 3DBHB 4GIVA 4W9GA 3U2SC 1T0QC 2XNAC 4BKSA 4G0NB 1NVID 3BZDB 1UWXA 2PEAA 2D32A 2CU3A 1EF5A 4K7SA 2KDEB 1XCQL 4K7WA 1RAXA 1XXGA 3C0RB 4NQKE 2BF8B 3APFA 4XGAB 2GBNA 3DWMA 5DPWA 2K6QA 5JHAA 3LXFA 2NMQA 3V05A 3OJ3A 1V86A 3BYTB 2BYEA 5TR5A 2YLMA 3N20C 3M10A 3PHXB 4WJQA 4EUTA 3DVNU 2PKOA 1ZP0B 1TS3A 3H7SA 1XD3B 3C19A 4W9IA 3QWZB 2V0GA 1WR1A 4OZCA 3MP9A 5D3IB 4G50A 1TY2A 1E90A 2W3RA 2OEDA 2LGSA 1FNVA 2KXJA 1Q0WB 3M95A 4IM2A 1QOAA 2KX0A 4L1BA 1FXAA 1SJHD 1SE3A 2W82A 1UGJA 4YSXB 1N5WA 1E10A 1GNUA 1I4HA 4IM0A 5L83A 2LGYA 1FPYA 3R3MA 5IP4D 2JU6X 2UWQA 3WALA 1YNTE 3GE3C 4K3CA 3AE4B 4P1CC 2CKHB 1UUPA 1MJDA 4PS7A 1NBFC 5J99A 4MACA 1Q1OA 3JYUA 2J52A 5G55A 2E3TA 1V2YA 3B0AA 3T3OA 1EO6A 4ZYSA 3A9JA 2WNMA 3A9JB 2TSSA 4TMAB 4PYZA 4BKSD 1I4GA 5KHQA 1NYQA 2KQ4X 2WXKA 4KSLC 3ZVVA 2KC1A 4W9EA 3ZNHB 5DPRA 1E5WA 2QC8A 4NPNA 3AMZA 2JSVX 3GE8C 3U30A 3S2AA 2ZEQA 2ZVNA 1RL9A 1JQ4A 2W9NA 2K8BA 4BG4B 2AQ1B 4WAFA 4Z9MA 3FKYA 4ITKA 2RDHA 4GVYA 2DHZA 2LGIA 2JYTA 4ZRJA 3UGBB 2KTRA 2GOWA 4AQ7A 1V80A 5FKAC 1SSNA 1YJ1A 5E6OA 2MLBA 5J2RA 2BKRB 4B95A 2HE7A 3A4SC 3ZYYX 4IUMB 2LGDA 4F8CB 3I3TB 2N9LA 3RNFC 4G3XB 3BVGA 4YSZB 1EF1A 1ZGUB 2L52A 4MJSA 4MJSB 4NNJB 1NYRA 3E56A 2LD9A 1TKYA 1V49A 3NG0A 1V5OA 1L0VB 3AM9A 2Q5WD 2K8CA 2K9XA 2DZKA 2GWCA 2J4XA 3ZXRA 5MPOA 1G6JA 4C56C 5FR3A 3SDLC 2MEKA 4NAWA 1E8WA 4MSMB 1KF6B 2BVCA 1C77A 3GS2A 2WU5B 4ARCA 3RNBC 3T9LA 2FUG1 1C78A 1TZ1A 5E6JA 2KN4A 2REXA 4A3OA 3Q3NC 4TSSA 5D94A 3R66C 1H8CA 1E8ZA 4YTNB 3RMKC 1HZ6A 2JX5A 1FEHA 2M8SA 1H4RA 4WJPA 3VTUA 3TIXA 4W9JA 4AS1A 3HRDD 3VRAB 1CK1A 4N58A 2PVGC 1HE8A 1VJKA 4ICUA 4CO7A 2WXGA 3DHIC 4GDKA 2JY6A 4YTMB 1DOYA 4RM8A 4NJCA 4FHKA 1ROEA 3NOBA 2VH2A 4MM3B 3PV1A 2JVCA 1CMXB 3U7ZA 4JWSC 2GWDA 3Q3OC 1WGDA 2IY0B 4LDTD 1Y8RC 3Q14C 4CYEA 4EZLA 3B2GA 1PUTA 1ET6A 3MFGA 1SF0A 3W1SC 3VH4B 3L17A 3U4EG 2ACZB 3QJZA 2MX2A 3AV8A 3SR6A 3BY4B 2FIFA 4DDID 3P4SB 2INCC 1JWMD 2BT6A 4WQMA 2L83A 2LVOA 1FRDA 4DBGA 4FXCA 1FRRA 2L0FA 1R4MI 3H8HA 3QX1A 3OJ4B 1IPGA 1HXYD 1TT5B 2BQQA 4S17A 4WJNA 3AE8B 2O6VA 2O6VB 2K5PA 2UU7A 3JU5A 1MVKA 1C76A 3KYCD 4NAMA 3AE2B 3PPAA 4GDLA 4GDLB 4AP4C 1KM7A 2QILA 2K22A 5AUKA 3R8BA 2IO3B 2IGGA 3Q8AA 1WMHA 3DOWA 1JRUA 4LJPB 2L32A 4KZCA 3DBHI 4ANUA 3L13A 2KK8A 1E7UA 2J42A 3DQVA 3VR8B 5C3JB 2GLSA 2JZZA 3MHSD 2RDGA 2ZNVC 3ALBA 2WXJA 4RMAA 4RF9A 4US9A 4A3PA 1GB1A 1WXVA 3DHHC 4P16A 3HM6X 1IBXB 1QOFA 2ZCCA 1D6EC 1TS2A 1SBBB 3ML9A 1P9DU 2CR5A 2KYWA 3L4PA 2RSUA 4RF1A 1XLQA 4KV2A 3QHTA 4I6PA 1J7CA 2FCSA 2XK5B 3AEEB 3NVYA 3WAMA 2BYTA 4KX6B 1N6ZA 4N9F4 2V3SA 5CHWA 3HVZA 1N5XA 4ZOHC 1UZXB 1P3QU 1NI2A 2L7RA 2WXHA 3VAWA 2AEHA 4W9FA 2KC2A 3PRMB 3H9DA 1YN4A 3KWVA 2D07B 2L00B 4DK5A 3ONSA 2IGDA 5IN7A 4LJOB 4FLHA 1TBEA 3AB5A 4MGIE 5HHDG 5LXIB 4OVZA 2W55A 4IWPA 1L0YB 1DYQA 3KUZA 2BB6A 1FCCC 1TS5A 2GB1A 4TKNA 3BIID 4M8NA 2LFIA 3DDCB 3L08A 3BINA 1WRIA 2O6VD 3EHVA 5HKHA 2JT4B 3CWIA 2MWSB 4IWOA 3U52E 2K8HA 4JPSA 1OQRA 2EELA 1VLBA 3DBRB 4B0MA 1FFVA 3MTNB 1GPXA 1ZW7A 4L2YA 3NZUA 3R2TA 2W54A 3Q2AC 3VVWB 1I4XA 4BBNC 3V6EB 2GMIC 3WAPA 3Q6BA 1QILA 3KUCB 4K1RB 1UGMA 4IOIE 1LGRA 3NVZA 3BK2A 1L6UA 1BUIC 5GMVA 4RGTA 2DLBA 1QF6A 5J18A 1UH6A 3MC9A 3I57A 3OG5A 2HJ1A 3O13A 2GBJA 2J0KA 1DOXA 1QLBB 4II3B 3ZTDA 2BPSA 1JMLA 2D3GA 1A70A 3IAM1 2YEPB 3QIJA 1D3ZA 4KIKB 3L0WB 1HZ5A 4EFOA 3RULA 5BMGA 4M0WB 4RGMA 4A55A 2DENB 2L3ZA 3NS1A 3VUYA 2QJLA 2DYBA 1M94A 3AE6B 1QOGA 3RNEC 4BOSC 2WQYB 1N61A 2N7EA 2WXQA 2G9HD 3L54A 1KFYB 2DZIA 2DZMA 2PW9A 1U4AA 3TUOA 3DVNV 5C2TB 2QSDA 2ZPNA 3IFWB 1XLNA 4RGNA 1N60A 3N1YC 2LXCA 3RYTA 3NZ3A 2DBYA 4XE0A 1FCLA 4A90A 2IO0B 2OHFA 1PFDA 2AWTA 4WAAA 1I0EA 2QEJC 4IM3A 5EE9A 3PLVA 4EOYA 3JSVB 3L16A 1ENFA 4DXFA 1ZXHA 1X1MA 1WSPA 2WXOA 2KOXA 1PGBA 4HWIB 2ZVOA 4GW2A 3FILB 4KGRA 5KHOA 3UI3A 3HHMA 4XWTA 1L2NA 1GB4A 2G3QB 2NTTA 4P1BC 2KMCA 2Z8LA 1K53A 5IA7A 3P42A 4GOCA 2FAZA 1YMHE 3WIMA 1EU4A 4C4VB 1SE2A 4NY0A 2KMMA 4FULA 1S3SG 1QQRA 4TQ1A 1AN8A 1K52A 4JE3B 4DDGD 2QMTA 2NBUA 4Q2JA 2AX5A 2K1FA 3QARA 1WE7A 2AQ2B 2BS3B 5HG2A 3DCGA 3ZQ4A 4HEA1 3TL5A 5BMIA 1WY8A 1JWAD 2FIDA 4MT5A 5D7GA 2SEBD 4P6VF 4IC7B 2JZPA 1JWBD 4N59A 1YD8U 1AW7A 1SIFA 1UELA 2VRRB 1BMLC 1NI3A 1YIWA 2NPTB 3VFKA 3P4PB 3P63A 3SFEB 2VZKD 1TS4A 3Q69A 3APDA 2WDQB 3V6CB 3RPFC 3ABVB 2INNE 3KWLA 2KLGA 4DHJD 1VZ8A 4OZAA 1P50A 4QAYA 4C7ZA 1VZ6A 1F2RI 4TQ0A 1RFKA 2WX0A 2WGSA 3FC4A 2IO1B 2O2VB 1S1QB 2N1WA 2QIEB 2MH7A 2N1VA 3N3KB 2LHEA 4GU2A 3JW0X 2IYDB 5I4DA 3AH7A 4MH0E 4W9LA 4FJZA 4MDKE 3KH0A 1N63A 3LN6A 5D3DA 2NTSA 2RPVA 3NZSA 2I1KA 5BO4B 1WXSA 1UBQA 4WWMA 5JXVA 3JU6A 1P98A 1I4QA 2IGHA 3A4RA 2M4NA 3PHWB 2LJIA 5AZFA 4DWFA 3Q8EA 1FXTB 3VHTC 1T3QA 2YEPF 1TKGA 2PE9A 1FFUA 4PS8A 2M56B 4KGSA 4BBNF 3TJPA 2KNBA 3IG3A 2MQJA 5C1ZA 3OAWA 1F0ZA 2PMVA 2WXIA 3L2EB 4FHJA 1N62A 3TEWA 4US8A 4BG4A 2FNJB 4IDIA 2PTLA 1SJED 2RPQA 1MG8A 3QCAA 2MBHA 2FUHB 5TSSA 3B6RA 4LCDE 1WFYA 2Y5PA 2K0PA 1UNSA 3AEFB 4W9HA 1HQRD 4LNNA 4NJ7A 4G11A 1V5TA 2ICIA 4K81A 3W2DA 4GW0A 2J1QA 4YTPB 1M15A 4PYUA 1WM2A 2JXXA 1VA6A 1WGHA 5IO9A 1UD7A 5IOIA 1V9JA 5EE1A 4ZDVA 2KTFA 2B76B 3O65B 1WJ6A 1WX8A 4E3CA 1LO5D 1C4AA 1HTQA 1YN5A 3ENEA 2NBWB 3R7RA 1XLOA 3HUIA 4C80A 4M8MA 3SU8X 2BS4B 1D5ZC 4WURA 3PO0A 4PS3A 1VRAB 4JL9A 1MHXA 4LTUA 3DBRI 3Q3JA 5AEKB 1KOTA 2C9WB 1QZEA 2LWPA 4MH8A 1A5RA 3CSTA 2FCMA 4KKIA 4WWOA 4LK0M 1P1AA 1I35A 1TZOA 2BS2B 4HKZE 3RN9C 1JCKB 1SE9A 3M62B 1WI0A 2MBQA 4B6WA 3IT4B 2QDFA 3RNCC 1C79A 3U8ZA 2LUEA 2AL3A 1EWYC 5EE3A 3DBLB 1EUVB 2Z0EB 4XWWA 2INDC 3NZTA 1C1YB 4M00A 1XCTL 1WZ3A 3RCZA 2WXLA 3GP7A 4ZRKA 5G2NA 2ZZPB 2IDYA 4MGYE 1F2RC 2N4FA 2FCQA 1HTOA 4MM3A 2FCNA 2CHXA 1GC7A 3W9CB 4M01A 1MHHE 2VH1A 2KDMA 3ETRA 4MSQB 3BK1A 2WXFA 4NQLB 1FD6A 3NUHB 5DPSA 2WWZA 1OFFA 2MJDA 2V4IB 4USAA 1AWDA 1WJUA 1L6VA 4BOZB 1WXAA 2M0AA 4ZHPA 4ICVA 2KACA 4KSKC 2JRIB 3IAS1 1J8CA 4HCPB 2M19A 3JQ3A 2C7MB 2V4LA 5BYSA 4H2AA 2K39A 3WA0A 3LJ3A 3M63B 4K3BA 3AE1B 1P7FA 4MGZE 2CHZA 3MJ5A 2GRIA 3N30A 1F1HA 1F9JA 4WH4A 1KJTA 2DX5B 2ONQA 2WP9B 1EWCA 2PPHA 4MEMA 1WXMA 3EUB2 2BTEA 4P7IA 1JWSD 4PK1A 1Q10A 2EKIA 3PVLA 4YXDB 2C7HA 1MG4A 2XN9C 3H6NA 2R2OA 1BT0A 3OWEB 4M02A 2IPKD 1GOZA 1JROA 3DPDA 2LHDA 4LNKA 2WU2B 4TV3A 4WWPA 3A9KB 4FADA 3ZGZA 3RZFA 1IBXA 2WDRB 1RM6C 1TIFA 3AU5A 1DOIA 5IAAC 1FNUA 4BKGA 1K50A 3ZIMA 1G0WA 2BW2A 3A33B 3PGEA 1B9RA 1E7PB 1T0YA 5EDSA 4HPMB 2L0TA 2XK5A 5AZGA 3ZUNA 2K6DB 2WXNA 3N9YC 1JRPA 2LMCA 1IUEA 1F77A 4GGQA 3ZNZB 1DGJA 1V1PA 2NCNA 1V1PB 3TBLD 4E71A 1GC6A 4ZHOA 1JWUD 2KDFB 1T6BX 2KX3A 2DWQA 4J6IA 1YJJA 3ZDTA 2CHWA 1J7AA 3ZXVA 3R7QA 4A20A 3DBSA 1QH4A 4AJWA 2M17A 2BBCA 1OEYJ 2J0MA 4YWGG 4RF8A 3B1LX 5CTRC 4IKGA 3ZKJC 1QKZA 2HJ8A 5D6JB 1OGWA 1YX5B 3X23A 4CQNA 4HROA 3IHPC 3CSFA 3PTFC 4LNOA 2ON8A 3IT6B 2V9HA 3E9SA 2KZRA 3QK0A 3J9CA 3AXCA 3ZNID 2XBBC 5JH5C 1L4ZB 3OLMD 2E6XA 1V81A 3B2FA 2CS4A 1YJIA 2SAKA 1SE4A 2KFKB 2KWCA 2RGFA 3PS6A 3VH3B 3LN7A 2KD0A 1K51A 2J53A 3T3NA 3SHQA 1BXTA 2JWUA 4ARIA 1VD2A 2BWES 5BYRA 2C7NB 3ZRFA 2WX1A 4YT0B 1CRKA 2CJNA 2BB5A 3NY5A 3Q8CA 1R4NI 4XDDA 1AYFA 3PREA 1GUAB 4KIKA 1WXQA 4HLEA 2KO3A 3RZWC 4M0WA 2HDEA 4RH6A 2V3PA 3KVFB 4HDQA 2NBVB 3ZRCA 1NDDA 5GXGB 3RT3B 2Z59B 4S0RA 4MELA 1SXTA 4B9KA 4NZLB 1LM8B 3H7PB 2XEWA 4IG7B 2X38A 1MI0A 3KQ4A 4RM9A 2H88B 2LZ6A 2G4SA 3VUXA 1KLVA 1SB3C 1L5PA 2WS3B 3TMPB 4DXGA 2NS5A 1FIQA 3IG8A 1ZKHA 1LQBA 2D3BA 3Q8FA 2RDBC 2AQ3B 4K7UA 4BFRA 3BVZA 1C4CA 3CMMB 5AZHA 1WH3A 3PZ8A 4AWJA 1L7YA 4BHLA 3BVMA 2CRKA 3IBEA 3M3JA 5CHVC 4URKA 4Q2RA 1WM3A 2WDTB 1VCBA 1T0RC 4W9KA 1K8RB 3PZ7A 2MA9B 2GBKA 3JSVA 1OQYA 4GN1A 4UDUC 1PGAA 3HM3A 4J3OD 1EU3A 2MBOA 4KZ0A 4HRSA 2X8XX 1WYGA 1ZXIA 2LXAA 3VR9B 4BKTA 2C5LC 1RFAA 3FILA 2JYEA 4ZRQA 5EE0A 4LLGM 2RR9A 2IJ0A 3VQIA 2KDIA 2DZJA 2MBBB 1U6RA 5FK9C 1WGYA 5CX3A 2D11A 3MJWA 3V61A 2N9EB 4C4VA 4LNIA 3EC8A 1E9MA 2ZJDA 3NVVA 1WGRA 2RMMA
chains in the Genus database with same CATH topology
1RL9A 3M10A 5J99A 4HPPA 2CRKA 1VRPA 2D3AA 3NG0A 4Q2RA 4AM1A 2WGSA 2D3CA 4LNNA 1LGRA 4RF7A 3JQ3A 3DREA 1I0EA 5J9AA 3L2EB 4LNFA 1HTQA 3JU6A 3L2EA 4ACFA 1SD0A 1G0WA 1U6RA 1P52A 4XYCA 2J1QA 4GW0A 4RF8A 4BG4B 4GVZA 4S17A 3ZXRA 4RF6A 1QK1A 4BG4A 1M15A 2OJWA 4Z9MA 3FKYA 2QC8A 2UU7A 3JU5A 4GVYA 3ZXVA 2GLSA 4LNIA 1F52A 2D3BA 1FPYA 3DRBA 4GW2A 2WHIA 4LNKA 4BAXA 2BVCA 1HTOA 1P50A 1BG0A 3JPZA 1CRKA 1QH4A 1F1HA 3B6RA 4RF9A 4LNOA 4S0RA 3L2DA 2LGSA 4BHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL9 A;  3M10 A;  5J99 A;  4HPP A;  2CRK A;  1VRP A;  2D3A A;  3NG0 A;  4Q2R A;  4AM1 A;  2WGS A;  2D3C A;  4LNN A;  1LGR A;  4RF7 A;  3JQ3 A;  3DRE A;  1I0E A;  5J9A A;  3L2E B;  4LNF A;  1HTQ A;  3JU6 A;  3L2E A;  4ACF A;  1SD0 A;  1G0W A;  1U6R A;  1P52 A;  4XYC A;  2J1Q A;  4GW0 A;  4RF8 A;  4BG4 B;  4GVZ A;  4S17 A;  3ZXR A;  4RF6 A;  1QK1 A;  4BG4 A;  1M15 A;  2OJW A;  4Z9M A;  3FKY A;  2QC8 A;  2UU7 A;  3JU5 A;  4GVY A;  3ZXV A;  2GLS A;  4LNI A;  1F52 A;  2D3B A;  1FPY A;  3DRB A;  4GW2 A;  2WHI A;  4LNK A;  4BAX A;  2BVC A;  1HTO A;  1P50 A;  1BG0 A;  3JPZ A;  1CRK A;  1QH4 A;  1F1H A;  3B6R A;  4RF9 A;  4LNO A;  4S0R A;  3L2D A;  2LGS A;  4BHL A; 
#chains in the Genus database with same CATH topology
 1WWT A;  4HPL B;  1YX6 B;  3I9V 1;  1E8X A;  3DBL I;  3P2B A;  4AUQ C;  2D3C A;  1SIJ A;  3AU4 A;  3QQ8 B;  4O1N A;  2YVC A;  3DVG Y;  1T0S C;  3N1Z C;  2A5U A;  2M1M A;  3GZN B;  1OEY A;  1RWS A;  1FNW A;  2KN5 A;  4HK2 A;  2CU1 A;  3NRZ A;  5H92 C;  1VRP A;  4AM1 A;  2NPT A;  3AE5 B;  2LJ5 A;  3DVG X;  3ML8 A;  1CJE A;  4WQO B;  4XDC A;  1XF5 L;  2IY1 B;  2JXT A;  1IP9 A;  2EMT A;  1T5X D;  2QCZ A;  3W5U B;  5J17 A;  1ZDX A;  1OTR B;  4A6Q A;  1WR6 E;  4XX5 A;  3RI7 C;  2JZ3 B;  3W1Y A;  3W5V B;  2ZCB A;  1WJN A;  3URY A;  4W9D A;  3ZW3 A;  5H8Y E;  3T8M A;  3WAN A;  1QT9 A;  3ZJV A;  4RCO A;  1E0Z A;  2O2V A;  5CHF A;  3H1U A;  3D32 A;  2KAJ A;  4GVZ A;  1D4B A;  2FBW B;  4A8X C;  1GG3 A;  2N7D A;  2NR2 A;  4A9A A;  1C4P A;  3L10 B;  2HTH A;  2IZV B;  1BG0 A;  4EZJ A;  2LEK A;  4JX1 C;  2KQ7 A;  4YSY B;  1HA5 A;  1KH0 A;  1WX9 A;  1P0R A;  2L05 A;  2KDB A;  1E8Y A;  2A4Z A;  2KJH B;  4ACF A;  2WLB A;  1VDV A;  4KDL B;  1JW9 D;  2OJW A;  3TEZ A;  2MCN B;  2LAS A;  1MFW A;  1KLG D;  2DNF A;  4JLC A;  1E7V A;  2J7Q B;  4WJO A;  2D2Q A;  4OW0 A;  3LDZ E;  3I5J C;  3DRE A;  3RNA C;  1R4N B;  1NEK B;  3P4Q B;  2LRW A;  3GOE A;  3U7D A;  4C7Y A;  3L2E A;  1PYW D;  1FO4 A;  3MC0 B;  4XZ4 A;  5DPT A;  2FE8 A;  3ZJT A;  3N32 A;  4OZB A;  3X0W A;  1L0X B;  4DHZ B;  1TGZ B;  4AJY B;  1I4P A;  3KYD D;  2D5G A;  2AYO B;  2LRU A;  3AUL A;  3FAH A;  1GAQ B;  3AEB B;  3SEB A;  1J19 A;  3QA8 A;  3JVZ X;  2W3S A;  4E74 A;  4GSW A;  3N1X C;  1B1Z A;  4NJ6 A;  4EKU A;  1F52 A;  2KTR B;  2MJE A;  4HJG E;  4LDT B;  4ASW C;  1ET9 A;  1XO3 A;  2JQR B;  2LGX A;  1VZ7 A;  2ASQ A;  2H89 B;  3AN1 A;  1FM0 D;  1ESF A;  5JZE B;  1TYG B;  2KFJ A;  2KWU B;  1YOV B;  3V62 A;  3Q3M C;  3AI5 A;  2LUM A;  2NVU I;  5LXH A;  1IYF A;  3UIO B;  3K9O B;  3KLS X;  4FJY A;  3ECI A;  3TEY A;  5HI1 A;  2MSE D;  1R7S A;  3SFD B;  3ZJU A;  1UBI A;  3MC8 A;  1J0G A;  3HK0 A;  4II2 B;  1WE6 A;  2QHO A;  1ZUD 2;  5E6P A;  2D33 A;  3VUW A;  2WXP A;  2CJO A;  4YL8 A;  1WGG A;  4OVU A;  2L76 A;  3NJT A;  2Y3A A;  2MHJ A;  1YQB A;  4WWN A;  2IBI B;  3PRP B;  1KTK A;  1ZOY B;  4GLS C;  1YQ4 B;  4EZK A;  4AOF A;  1Y56 A;  4NAW B;  3DRB A;  3UQB A;  4ANV A;  1XT9 B;  3CIR B;  4ANW A;  2BYV E;  3ZLZ A;  2L1A A;  2KWV B;  2R2Q A;  3LVV A;  1TY0 A;  2DYO A;  2KMA A;  3I63 C;  1TT4 A;  1SEB D;  2K3U A;  4ANX A;  3AEC B;  4JGH B;  1WX7 A;  5BYQ A;  4F1S A;  2D10 A;  3AE9 B;  2WXR A;  2MW5 A;  4BVU C;  3V3X A;  4GMV A;  2PIA A;  1SGH A;  3KUD B;  3VDZ A;  2ZW0 A;  4I6N B;  2D3A A;  4OHJ A;  1I42 A;  4GDK B;  5E6N A;  3ZDM C;  4KVG B;  1KLU D;  3UIP B;  2KWD A;  5G5G A;  4KGT A;  4CHK A;  2DAJ A;  4REZ A;  3AE3 B;  2EMS A;  2Y5C A;  1UF0 A;  2GBM A;  4FJV B;  3BYY B;  1PQS A;  2PJH A;  1SD0 A;  4XYC A;  1PGX A;  2I38 A;  1PDX A;  4HDO A;  2B3A A;  2Y5B B;  1KRH A;  2I1J A;  3GB1 A;  1WYW B;  3RUI B;  3EFU A;  3JPZ A;  2MJ3 A;  1GJZ A;  4KKJ A;  3UQA A;  1HEZ E;  3EGR A;  3RD2 A;  4D2K A;  5IKC M;  3EEC A;  1L4D B;  3TSS A;  4IW0 A;  1CZP A;  2WHI A;  3Q8B A;  5BMH A;  2OJR A;  4GB9 A;  3WCQ A;  5AUI A;  4DXA B;  3A9K A;  3W1S A;  4RNA A;  1P7E A;  1UWM A;  4HKQ A;  1WMH B;  1V6E A;  2MBE A;  2KJR A;  1RYJ A;  3LB8 C;  4RF6 A;  2KHW B;  1FXI A;  2PVO D;  3KW5 B;  1D5M C;  3B08 A;  4BAX A;  3AEG B;  3V60 A;  3K9P B;  2JPH A;  4ZYN A;  1WJ4 A;  1ISN A;  3P4R B;  1FMA D;  2J0J A;  2MRP A;  2AL6 A;  2KVZ A;  2OOB B;  4KDI C;  1WZ0 A;  3PRZ A;  2BGF A;  5J9A A;  4BZA A;  3WAO A;  4L23 A;  3EFC A;  5LNK 1;  2DAF A;  1P52 A;  2KAN A;  5FR6 A;  2PE6 B;  3RFZ B;  1E6E B;  3GZN I;  4R3D A;  5C23 A;  4OVV A;  1V1O A;  2KJ6 A;  3PZD A;  2BKF A;  2M0X A;  4FA6 A;  2MP2 A;  2MP2 B;  3QAQ A;  3VXW A;  1WF9 A;  1Z2M A;  3B9J A;  4FN2 A;  1LFD A;  2KVR A;  2EKE C;  1CQV A;  5JHB A;  5L95 C;  1STE A;  4C00 A;  4FBJ B;  2ZNV B;  3PT2 B;  1VR9 A;  4DQO C;  3NVW A;  2K25 A;  1NEN B;  1Q5W B;  2RD0 A;  2N0S B;  2LVP A;  2KT7 A;  3P1M A;  2R61 A;  4ZRI A;  2HTM E;  3DWG C;  2GBR A;  3NHE B;  3UIN B;  3EA6 A;  1I7H A;  4WIP A;  1RRB A;  4HPP A;  4XC2 A;  5D2M B;  1EM7 A;  3ZTC A;  2ZW1 A;  4EE2 A;  1YN3 A;  4TUU A;  3VTV A;  4EEW A;  4HJK A;  3APC A;  3NS8 A;  2WXM A;  1JAL A;  1TJE A;  2IO2 B;  3C8Y A;  2JWZ A;  2V3N A;  2UYZ B;  3IVF A;  2N9X A;  4JIO U;  5HFY A;  3IXS A;  4N6E B;  3QC8 B;  2KFK A;  3L2D A;  1C3T A;  1V8C A;  2DYM A;  4F7Z A;  4RGO S;  2C60 A;  1QOB A;  2LVQ A;  3IG5 A;  1ACC A;  2Z0D B;  5LLI A;  4JQW C;  1C9F A;  1ZPS A;  3TEX A;  3VTW A;  3LVW A;  4PT5 A;  4GXB A;  2BWF A;  4IWQ A;  3Q3F A;  1WGK A;  1XLP A;  4RFB A;  1TKE A;  1I4R A;  2L8J A;  2JF5 A;  3SD5 A;  4HCN B;  3AEA B;  2I2Y A;  2N7J A;  1IGC A;  1RLF A;  2KLC A;  2JUO A;  1WIA A;  3TCA A;  1J7B A;  1Z5S B;  1M4V A;  3MHZ A;  2KKC A;  4X57 B;  2WDV B;  3PSE B;  2INP E;  3H7P A;  1V4G A;  4RF7 A;  3CF6 E;  2HD5 B;  3VRB B;  4RF0 A;  3A1Q A;  3A1Q B;  4ZRP A;  2V1Y A;  2PLP A;  3HIZ A;  1QK1 A;  1YQ3 B;  2KQS A;  4W9C A;  1TTN A;  4HXD A;  2N9P C;  2LI5 A;  1V97 A;  3HVD A;  4MGK E;  5T8I A;  1MPE A;  2ZPY A;  2VZK B;  1D5X C;  2N9K A;  2JRH A;  2G1E A;  3ZO5 B;  1XEE A;  4LNF A;  4I6L B;  4DHJ B;  3UF8 A;  1R4M B;  1LXD A;  2BYF A;  1XQQ A;  2G4D B;  3RNG C;  5DCN A;  3BWU D;  5G5H A;  3DHG C;  2G45 B;  4HVB A;  3ZNG C;  3AED B;  3AE7 B;  1WRD B;  4JWU C;  4B0E A;  1OQQ A;  2WYQ A;  1ZE3 D;  3R2I A;  1AAR A;  2GI9 A;  3PLU A;  1R8G A;  1IGD A;  3LYY A;  4DHZ E;  1ZDV A;  3DBH B;  4GIV A;  4W9G A;  3U2S C;  1T0Q C;  2XNA C;  4BKS A;  4G0N B;  1NVI D;  3BZD B;  1UWX A;  2PEA A;  2D32 A;  2CU3 A;  1EF5 A;  4K7S A;  2KDE B;  1XCQ L;  4K7W A;  1RAX A;  1XXG A;  3C0R B;  4NQK E;  2BF8 B;  3APF A;  4XGA B;  2GBN A;  3DWM A;  5DPW A;  2K6Q A;  5JHA A;  3LXF A;  2NMQ A;  3V05 A;  3OJ3 A;  1V86 A;  3BYT B;  2BYE A;  5TR5 A;  2YLM A;  3N20 C;  3M10 A;  3PHX B;  4WJQ A;  4EUT A;  3DVN U;  2PKO A;  1ZP0 B;  1TS3 A;  3H7S A;  1XD3 B;  3C19 A;  4W9I A;  3QWZ B;  2V0G A;  1WR1 A;  4OZC A;  3MP9 A;  5D3I B;  4G50 A;  1TY2 A;  1E90 A;  2W3R A;  2OED A;  2LGS A;  1FNV A;  2KXJ A;  1Q0W B;  3M95 A;  4IM2 A;  1QOA A;  2KX0 A;  4L1B A;  1FXA A;  1SJH D;  1SE3 A;  2W82 A;  1UGJ A;  4YSX B;  1N5W A;  1E10 A;  1GNU A;  1I4H A;  4IM0 A;  5L83 A;  2LGY A;  1FPY A;  3R3M A;  5IP4 D;  2JU6 X;  2UWQ A;  3WAL A;  1YNT E;  3GE3 C;  4K3C A;  3AE4 B;  4P1C C;  2CKH B;  1UUP A;  1MJD A;  4PS7 A;  1NBF C;  5J99 A;  4MAC A;  1Q1O A;  3JYU A;  2J52 A;  5G55 A;  2E3T A;  1V2Y A;  3B0A A;  3T3O A;  1EO6 A;  4ZYS A;  3A9J A;  2WNM A;  3A9J B;  2TSS A;  4TMA B;  4PYZ A;  4BKS D;  1I4G A;  5KHQ A;  1NYQ A;  2KQ4 X;  2WXK A;  4KSL C;  3ZVV A;  2KC1 A;  4W9E A;  3ZNH B;  5DPR A;  1E5W A;  2QC8 A;  4NPN A;  3AMZ A;  2JSV X;  3GE8 C;  3U30 A;  3S2A A;  2ZEQ A;  2ZVN A;  1RL9 A;  1JQ4 A;  2W9N A;  2K8B A;  4BG4 B;  2AQ1 B;  4WAF A;  4Z9M A;  3FKY A;  4ITK A;  2RDH A;  4GVY A;  2DHZ A;  2LGI A;  2JYT A;  4ZRJ A;  3UGB B;  2KTR A;  2GOW A;  4AQ7 A;  1V80 A;  5FKA C;  1SSN A;  1YJ1 A;  5E6O A;  2MLB A;  5J2R A;  2BKR B;  4B95 A;  2HE7 A;  3A4S C;  3ZYY X;  4IUM B;  2LGD A;  4F8C B;  3I3T B;  2N9L A;  3RNF C;  4G3X B;  3BVG A;  4YSZ B;  1EF1 A;  1ZGU B;  2L52 A;  4MJS A;  4MJS B;  4NNJ B;  1NYR A;  3E56 A;  2LD9 A;  1TKY A;  1V49 A;  3NG0 A;  1V5O A;  1L0V B;  3AM9 A;  2Q5W D;  2K8C A;  2K9X A;  2DZK A;  2GWC A;  2J4X A;  3ZXR A;  5MPO A;  1G6J A;  4C56 C;  5FR3 A;  3SDL C;  2MEK A;  4NAW A;  1E8W A;  4MSM B;  1KF6 B;  2BVC A;  1C77 A;  3GS2 A;  2WU5 B;  4ARC A;  3RNB C;  3T9L A;  2FUG 1;  1C78 A;  1TZ1 A;  5E6J A;  2KN4 A;  2REX A;  4A3O A;  3Q3N C;  4TSS A;  5D94 A;  3R66 C;  1H8C A;  1E8Z A;  4YTN B;  3RMK C;  1HZ6 A;  2JX5 A;  1FEH A;  2M8S A;  1H4R A;  4WJP A;  3VTU A;  3TIX A;  4W9J A;  4AS1 A;  3HRD D;  3VRA B;  1CK1 A;  4N58 A;  2PVG C;  1HE8 A;  1VJK A;  4ICU A;  4CO7 A;  2WXG A;  3DHI C;  4GDK A;  2JY6 A;  4YTM B;  1DOY A;  4RM8 A;  4NJC A;  4FHK A;  1ROE A;  3NOB A;  2VH2 A;  4MM3 B;  3PV1 A;  2JVC A;  1CMX B;  3U7Z A;  4JWS C;  2GWD A;  3Q3O C;  1WGD A;  2IY0 B;  4LDT D;  1Y8R C;  3Q14 C;  4CYE A;  4EZL A;  3B2G A;  1PUT A;  1ET6 A;  3MFG A;  1SF0 A;  3W1S C;  3VH4 B;  3L17 A;  3U4E G;  2ACZ B;  3QJZ A;  2MX2 A;  3AV8 A;  3SR6 A;  3BY4 B;  2FIF A;  4DDI D;  3P4S B;  2INC C;  1JWM D;  2BT6 A;  4WQM A;  2L83 A;  2LVO A;  1FRD A;  4DBG A;  4FXC A;  1FRR A;  2L0F A;  1R4M I;  3H8H A;  3QX1 A;  3OJ4 B;  1IPG A;  1HXY D;  1TT5 B;  2BQQ A;  4S17 A;  4WJN A;  3AE8 B;  2O6V A;  2O6V B;  2K5P A;  2UU7 A;  3JU5 A;  1MVK A;  1C76 A;  3KYC D;  4NAM A;  3AE2 B;  3PPA A;  4GDL A;  4GDL B;  4AP4 C;  1KM7 A;  2QIL A;  2K22 A;  5AUK A;  3R8B A;  2IO3 B;  2IGG A;  3Q8A A;  1WMH A;  3DOW A;  1JRU A;  4LJP B;  2L32 A;  4KZC A;  3DBH I;  4ANU A;  3L13 A;  2KK8 A;  1E7U A;  2J42 A;  3DQV A;  3VR8 B;  5C3J B;  2GLS A;  2JZZ A;  3MHS D;  2RDG A;  2ZNV C;  3ALB A;  2WXJ A;  4RMA A;  4RF9 A;  4US9 A;  4A3P A;  1GB1 A;  1WXV A;  3DHH C;  4P16 A;  3HM6 X;  1IBX B;  1QOF A;  2ZCC A;  1D6E C;  1TS2 A;  1SBB B;  3ML9 A;  1P9D U;  2CR5 A;  2KYW A;  3L4P A;  2RSU A;  4RF1 A;  1XLQ A;  4KV2 A;  3QHT A;  4I6P A;  1J7C A;  2FCS A;  2XK5 B;  3AEE B;  3NVY A;  3WAM A;  2BYT A;  4KX6 B;  1N6Z A;  4N9F 4;  2V3S A;  5CHW A;  3HVZ A;  1N5X A;  4ZOH C;  1UZX B;  1P3Q U;  1NI2 A;  2L7R A;  2WXH A;  3VAW A;  2AEH A;  4W9F A;  2KC2 A;  3PRM B;  3H9D A;  1YN4 A;  3KWV A;  2D07 B;  2L00 B;  4DK5 A;  3ONS A;  2IGD A;  5IN7 A;  4LJO B;  4FLH A;  1TBE A;  3AB5 A;  4MGI E;  5HHD G;  5LXI B;  4OVZ A;  2W55 A;  4IWP A;  1L0Y B;  1DYQ A;  3KUZ A;  2BB6 A;  1FCC C;  1TS5 A;  2GB1 A;  4TKN A;  3BII D;  4M8N A;  2LFI A;  3DDC B;  3L08 A;  3BIN A;  1WRI A;  2O6V D;  3EHV A;  5HKH A;  2JT4 B;  3CWI A;  2MWS B;  4IWO A;  3U52 E;  2K8H A;  4JPS A;  1OQR A;  2EEL A;  1VLB A;  3DBR B;  4B0M A;  1FFV A;  3MTN B;  1GPX A;  1ZW7 A;  4L2Y A;  3NZU A;  3R2T A;  2W54 A;  3Q2A C;  3VVW B;  1I4X A;  4BBN C;  3V6E B;  2GMI C;  3WAP A;  3Q6B A;  1QIL A;  3KUC B;  4K1R B;  1UGM A;  4IOI E;  1LGR A;  3NVZ A;  3BK2 A;  1L6U A;  1BUI C;  5GMV A;  4RGT A;  2DLB A;  1QF6 A;  5J18 A;  1UH6 A;  3MC9 A;  3I57 A;  3OG5 A;  2HJ1 A;  3O13 A;  2GBJ A;  2J0K A;  1DOX A;  1QLB B;  4II3 B;  3ZTD A;  2BPS A;  1JML A;  2D3G A;  1A70 A;  3IAM 1;  2YEP B;  3QIJ A;  1D3Z A;  4KIK B;  3L0W B;  1HZ5 A;  4EFO A;  3RUL A;  5BMG A;  4M0W B;  4RGM A;  4A55 A;  2DEN B;  2L3Z A;  3NS1 A;  3VUY A;  2QJL A;  2DYB A;  1M94 A;  3AE6 B;  1QOG A;  3RNE C;  4BOS C;  2WQY B;  1N61 A;  2N7E A;  2WXQ A;  2G9H D;  3L54 A;  1KFY B;  2DZI A;  2DZM A;  2PW9 A;  1U4A A;  3TUO A;  3DVN V;  5C2T B;  2QSD A;  2ZPN A;  3IFW B;  1XLN A;  4RGN A;  1N60 A;  3N1Y C;  2LXC A;  3RYT A;  3NZ3 A;  2DBY A;  4XE0 A;  1FCL A;  4A90 A;  2IO0 B;  2OHF A;  1PFD A;  2AWT A;  4WAA A;  1I0E A;  2QEJ C;  4IM3 A;  5EE9 A;  3PLV A;  4EOY A;  3JSV B;  3L16 A;  1ENF A;  4DXF A;  1ZXH A;  1X1M A;  1WSP A;  2WXO A;  2KOX A;  1PGB A;  4HWI B;  2ZVO A;  4GW2 A;  3FIL B;  4KGR A;  5KHO A;  3UI3 A;  3HHM A;  4XWT A;  1L2N A;  1GB4 A;  2G3Q B;  2NTT A;  4P1B C;  2KMC A;  2Z8L A;  1K53 A;  5IA7 A;  3P42 A;  4GOC A;  2FAZ A;  1YMH E;  3WIM A;  1EU4 A;  4C4V B;  1SE2 A;  4NY0 A;  2KMM A;  4FUL A;  1S3S G;  1QQR A;  4TQ1 A;  1AN8 A;  1K52 A;  4JE3 B;  4DDG D;  2QMT A;  2NBU A;  4Q2J A;  2AX5 A;  2K1F A;  3QAR A;  1WE7 A;  2AQ2 B;  2BS3 B;  5HG2 A;  3DCG A;  3ZQ4 A;  4HEA 1;  3TL5 A;  5BMI A;  1WY8 A;  1JWA D;  2FID A;  4MT5 A;  5D7G A;  2SEB D;  4P6V F;  4IC7 B;  2JZP A;  1JWB D;  4N59 A;  1YD8 U;  1AW7 A;  1SIF A;  1UEL A;  2VRR B;  1BML C;  1NI3 A;  1YIW A;  2NPT B;  3VFK A;  3P4P B;  3P63 A;  3SFE B;  2VZK D;  1TS4 A;  3Q69 A;  3APD A;  2WDQ B;  3V6C B;  3RPF C;  3ABV B;  2INN E;  3KWL A;  2KLG A;  4DHJ D;  1VZ8 A;  4OZA A;  1P50 A;  4QAY A;  4C7Z A;  1VZ6 A;  1F2R I;  4TQ0 A;  1RFK A;  2WX0 A;  2WGS A;  3FC4 A;  2IO1 B;  2O2V B;  1S1Q B;  2N1W A;  2QIE B;  2MH7 A;  2N1V A;  3N3K B;  2LHE A;  4GU2 A;  3JW0 X;  2IYD B;  5I4D A;  3AH7 A;  4MH0 E;  4W9L A;  4FJZ A;  4MDK E;  3KH0 A;  1N63 A;  3LN6 A;  5D3D A;  2NTS A;  2RPV A;  3NZS A;  2I1K A;  5BO4 B;  1WXS A;  1UBQ A;  4WWM A;  5JXV A;  3JU6 A;  1P98 A;  1I4Q A;  2IGH A;  3A4R A;  2M4N A;  3PHW B;  2LJI A;  5AZF A;  4DWF A;  3Q8E A;  1FXT B;  3VHT C;  1T3Q A;  2YEP F;  1TKG A;  2PE9 A;  1FFU A;  4PS8 A;  2M56 B;  4KGS A;  4BBN F;  3TJP A;  2KNB A;  3IG3 A;  2MQJ A;  5C1Z A;  3OAW A;  1F0Z A;  2PMV A;  2WXI A;  3L2E B;  4FHJ A;  1N62 A;  3TEW A;  4US8 A;  4BG4 A;  2FNJ B;  4IDI A;  2PTL A;  1SJE D;  2RPQ A;  1MG8 A;  3QCA A;  2MBH A;  2FUH B;  5TSS A;  3B6R A;  4LCD E;  1WFY A;  2Y5P A;  2K0P A;  1UNS A;  3AEF B;  4W9H A;  1HQR D;  4LNN A;  4NJ7 A;  4G11 A;  1V5T A;  2ICI A;  4K81 A;  3W2D A;  4GW0 A;  2J1Q A;  4YTP B;  1M15 A;  4PYU A;  1WM2 A;  2JXX A;  1VA6 A;  1WGH A;  5IO9 A;  1UD7 A;  5IOI A;  1V9J A;  5EE1 A;  4ZDV A;  2KTF A;  2B76 B;  3O65 B;  1WJ6 A;  1WX8 A;  4E3C A;  1LO5 D;  1C4A A;  1HTQ A;  1YN5 A;  3ENE A;  2NBW B;  3R7R A;  1XLO A;  3HUI A;  4C80 A;  4M8M A;  3SU8 X;  2BS4 B;  1D5Z C;  4WUR A;  3PO0 A;  4PS3 A;  1VRA B;  4JL9 A;  1MHX A;  4LTU A;  3DBR I;  3Q3J A;  5AEK B;  1KOT A;  2C9W B;  1QZE A;  2LWP A;  4MH8 A;  1A5R A;  3CST A;  2FCM A;  4KKI A;  4WWO A;  4LK0 M;  1P1A A;  1I35 A;  1TZO A;  2BS2 B;  4HKZ E;  3RN9 C;  1JCK B;  1SE9 A;  3M62 B;  1WI0 A;  2MBQ A;  4B6W A;  3IT4 B;  2QDF A;  3RNC C;  1C79 A;  3U8Z A;  2LUE A;  2AL3 A;  1EWY C;  5EE3 A;  3DBL B;  1EUV B;  2Z0E B;  4XWW A;  2IND C;  3NZT A;  1C1Y B;  4M00 A;  1XCT L;  1WZ3 A;  3RCZ A;  2WXL A;  3GP7 A;  4ZRK A;  5G2N A;  2ZZP B;  2IDY A;  4MGY E;  1F2R C;  2N4F A;  2FCQ A;  1HTO A;  4MM3 A;  2FCN A;  2CHX A;  1GC7 A;  3W9C B;  4M01 A;  1MHH E;  2VH1 A;  2KDM A;  3ETR A;  4MSQ B;  3BK1 A;  2WXF A;  4NQL B;  1FD6 A;  3NUH B;  5DPS A;  2WWZ A;  1OFF A;  2MJD A;  2V4I B;  4USA A;  1AWD A;  1WJU A;  1L6V A;  4BOZ B;  1WXA A;  2M0A A;  4ZHP A;  4ICV A;  2KAC A;  4KSK C;  2JRI B;  3IAS 1;  1J8C A;  4HCP B;  2M19 A;  3JQ3 A;  2C7M B;  2V4L A;  5BYS A;  4H2A A;  2K39 A;  3WA0 A;  3LJ3 A;  3M63 B;  4K3B A;  3AE1 B;  1P7F A;  4MGZ E;  2CHZ A;  3MJ5 A;  2GRI A;  3N30 A;  1F1H A;  1F9J A;  4WH4 A;  1KJT A;  2DX5 B;  2ONQ A;  2WP9 B;  1EWC A;  2PPH A;  4MEM A;  1WXM A;  3EUB 2;  2BTE A;  4P7I A;  1JWS D;  4PK1 A;  1Q10 A;  2EKI A;  3PVL A;  4YXD B;  2C7H A;  1MG4 A;  2XN9 C;  3H6N A;  2R2O A;  1BT0 A;  3OWE B;  4M02 A;  2IPK D;  1GOZ A;  1JRO A;  3DPD A;  2LHD A;  4LNK A;  2WU2 B;  4TV3 A;  4WWP A;  3A9K B;  4FAD A;  3ZGZ A;  3RZF A;  1IBX A;  2WDR B;  1RM6 C;  1TIF A;  3AU5 A;  1DOI A;  5IAA C;  1FNU A;  4BKG A;  1K50 A;  3ZIM A;  1G0W A;  2BW2 A;  3A33 B;  3PGE A;  1B9R A;  1E7P B;  1T0Y A;  5EDS A;  4HPM B;  2L0T A;  2XK5 A;  5AZG A;  3ZUN A;  2K6D B;  2WXN A;  3N9Y C;  1JRP A;  2LMC A;  1IUE A;  1F77 A;  4GGQ A;  3ZNZ B;  1DGJ A;  1V1P A;  2NCN A;  1V1P B;  3TBL D;  4E71 A;  1GC6 A;  4ZHO A;  1JWU D;  2KDF B;  1T6B X;  2KX3 A;  2DWQ A;  4J6I A;  1YJJ A;  3ZDT A;  2CHW A;  1J7A A;  3ZXV A;  3R7Q A;  4A20 A;  3DBS A;  1QH4 A;  4AJW A;  2M17 A;  2BBC A;  1OEY J;  2J0M A;  4YWG G;  4RF8 A;  3B1L X;  5CTR C;  4IKG A;  3ZKJ C;  1QKZ A;  2HJ8 A;  5D6J B;  1OGW A;  1YX5 B;  3X23 A;  4CQN A;  4HRO A;  3IHP C;  3CSF A;  3PTF C;  4LNO A;  2ON8 A;  3IT6 B;  2V9H A;  3E9S A;  2KZR A;  3QK0 A;  3J9C A;  3AXC A;  3ZNI D;  2XBB C;  5JH5 C;  1L4Z B;  3OLM D;  2E6X A;  1V81 A;  3B2F A;  2CS4 A;  1YJI A;  2SAK A;  1SE4 A;  2KFK B;  2KWC A;  2RGF A;  3PS6 A;  3VH3 B;  3LN7 A;  2KD0 A;  1K51 A;  2J53 A;  3T3N A;  3SHQ A;  1BXT A;  2JWU A;  4ARI A;  1VD2 A;  2BWE S;  5BYR A;  2C7N B;  3ZRF A;  2WX1 A;  4YT0 B;  1CRK A;  2CJN A;  2BB5 A;  3NY5 A;  3Q8C A;  1R4N I;  4XDD A;  1AYF A;  3PRE A;  1GUA B;  4KIK A;  1WXQ A;  4HLE A;  2KO3 A;  3RZW C;  4M0W A;  2HDE A;  4RH6 A;  2V3P A;  3KVF B;  4HDQ A;  2NBV B;  3ZRC A;  1NDD A;  5GXG B;  3RT3 B;  2Z59 B;  4S0R A;  4MEL A;  1SXT A;  4B9K A;  4NZL B;  1LM8 B;  3H7P B;  2XEW A;  4IG7 B;  2X38 A;  1MI0 A;  3KQ4 A;  4RM9 A;  2H88 B;  2LZ6 A;  2G4S A;  3VUX A;  1KLV A;  1SB3 C;  1L5P A;  2WS3 B;  3TMP B;  4DXG A;  2NS5 A;  1FIQ A;  3IG8 A;  1ZKH A;  1LQB A;  2D3B A;  3Q8F A;  2RDB C;  2AQ3 B;  4K7U A;  4BFR A;  3BVZ A;  1C4C A;  3CMM B;  5AZH A;  1WH3 A;  3PZ8 A;  4AWJ A;  1L7Y A;  4BHL A;  3BVM A;  2CRK A;  3IBE A;  3M3J A;  5CHV C;  4URK A;  4Q2R A;  1WM3 A;  2WDT B;  1VCB A;  1T0R C;  4W9K A;  1K8R B;  3PZ7 A;  2MA9 B;  2GBK A;  3JSV A;  1OQY A;  4GN1 A;  4UDU C;  1PGA A;  3HM3 A;  4J3O D;  1EU3 A;  2MBO A;  4KZ0 A;  4HRS A;  2X8X X;  1WYG A;  1ZXI A;  2LXA A;  3VR9 B;  4BKT A;  2C5L C;  1RFA A;  3FIL A;  2JYE A;  4ZRQ A;  5EE0 A;  4LLG M;  2RR9 A;  2IJ0 A;  3VQI A;  2KDI A;  2DZJ A;  2MBB B;  1U6R A;  5FK9 C;  1WGY A;  5CX3 A;  2D11 A;  3MJW A;  3V61 A;  2N9E B;  4C4V A;  4LNI A;  3EC8 A;  1E9M A;  2ZJD A;  3NVV A;  1WGR A;  2RMM A; 
#chains in the Genus database with same CATH homology
 1RL9 A;  3M10 A;  5J99 A;  4HPP A;  2CRK A;  1VRP A;  2D3A A;  3NG0 A;  4Q2R A;  4AM1 A;  2WGS A;  2D3C A;  4LNN A;  1LGR A;  4RF7 A;  3JQ3 A;  3DRE A;  1I0E A;  5J9A A;  3L2E B;  4LNF A;  1HTQ A;  3JU6 A;  3L2E A;  4ACF A;  1SD0 A;  1G0W A;  1U6R A;  1P52 A;  4XYC A;  2J1Q A;  4GW0 A;  4RF8 A;  4BG4 B;  4GVZ A;  4S17 A;  3ZXR A;  4RF6 A;  1QK1 A;  4BG4 A;  1M15 A;  2OJW A;  4Z9M A;  3FKY A;  2QC8 A;  2UU7 A;  3JU5 A;  4GVY A;  3ZXV A;  2GLS A;  4LNI A;  1F52 A;  2D3B A;  1FPY A;  3DRB A;  4GW2 A;  2WHI A;  4LNK A;  4BAX A;  2BVC A;  1HTO A;  1P50 A;  1BG0 A;  3JPZ A;  1CRK A;  1QH4 A;  1F1H A;  3B6R A;  4RF9 A;  4LNO A;  4S0R A;  3L2D A;  2LGS A;  4BHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...