1HTOA

Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
477
structure length
477
Chain Sequence
b'TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 149
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htoA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htoA01
1RL9A 4LNIA 1M15A 4Z9MA 3ZXRA 3NG0A 1CRKA 4RF6A 3M10A 4GVZA 1BG0A 4ACFA 4BHLA 4HPPA 3JU5A 1G0WA 2UU7A 5J9AA 4BG4B 4BAXA 3JPZA 1VRPA 1HTOA 5J99A 2CRKA 3ZXVA 3L2EA 2LGSA 1LGRA 1F52A 4LNFA 1HTQA 1F1HA 3DRBA 4LNKA 2GLSA 1I0EA 1U6RA 4XYCA 3B6RA 3JU6A 4AM1A 4BG4A 4GW0A 2WHIA 2D3BA 2J1QA 3FKYA 3L2DA 2WGSA 4GVYA 2OJWA 3L2EB 4RF7A 4S17A 1P50A 4LNOA 1QH4A 3DREA 1SD0A 1FPYA 4GW2A 4S0RA 1P52A 4Q2RA 4RF9A 4LNNA 1QK1A 3JQ3A 2QC8A 4RF8A 2BVCA 2D3CA 2D3AA
chains in the Genus database with same CATH superfamily
2VRRB 3ENEA 1TZOA 2L0TA 4JPSA 2AQ3B 2BBCA 3IVFA 2KQ4X 4TQ1A 2EKEC 1NBFC 2PVGC 4KX6B 1U6RA 2Q5WD 1A5RA 2WHIA 1OFFA 2WX0A 2YLMA 2L7RA 3JSVB 2D3AA 3ZIMA 4HKQA 4K1RB 3A9KA 3IAM1 2RDHA 2WQYB 4GGQA 1K8RB 4GDLB 2LVQA 2X38A 1I4GA 2L05A 3RZFA 1U4AA 4IWQA 2KJHB 2R61A 1FIQA 1C1YB 2JX5A 1FO4A 4RGTA 1XXGA 3L16A 1V86A 1J8CA 3IT4B 2G45B 1NEKB 1UUPA 3P4PB 1M15A 2PE9A 2QJLA 4MSQB 5EE9A 4P6VF 3NVZA 2CJOA 1CMXB 2M8SA 2N9XA 5GXGB 2INCC 3P42A 2JZPA 2INDC 4W9KA 2O2VB 5EDSA 4FLHA 2CU1A 3VHTC 3VRBB 3Q14C 2DENB 1YOVB 2JVCA 5DPTA 4GDKB 4WWPA 2RDBC 4BFRA 4KGSA 4WJPA 4PS3A 4G3XB 1E6EB 3P1MA 3X0WA 3CMMB 4HXDA 3IBEA 4DBGA 2LHEA 4KDLB 3SD5A 3ZNHB 3BWUD 4RF7A 3T9LA 1FNWA 3LN6A 3H8HA 2LGIA 1E8YA 5D3IB 4BKSD 2LVOA 1RFKA 4RGOS 2WXFA 1R4MI 4ICVA 3LDZE 2M4NA 3NS8A 4KDIC 4NAWB 1XLPA 3B9JA 2WXGA 3N1XC 1Z2MA 5L83A 5IOIA 2I38A 2AEHA 1WXSA 1WE7A 2NBWB 1XCTL 4HRSA 2KACA 4YSYB 3ZXRA 2GBMA 2KTRB 4BOSC 3WALA 2G9HD 3BVZA 2N7EA 3LJ3A 1WZ0A 4F8CB 4LTUA 2ICIA 1IGDA 3PT2B 3S2AA 4DHZB 1QQRA 2BS3B 3PRZA 1IGCA 1AWDA 4AJWA 3QJZA 2CHZA 5AZGA 1LXDA 1ET6A 3I3TB 5JHAA 5DCNA 2GOWA 4PK1A 1BT0A 4RCOA 1A70A 3DBHI 4P1BC 3LN7A 1CJEA 1TKEA 4EE2A 3ECIA 3W9CB 3N9YC 1WJ6A 3PZ8A 3DOWA 3UINB 4GXBA 4ASWC 4B0MA 3MJWA 3CWIA 3UQBA 1VZ6A 2MLBA 2ZVOA 2BT6A 1TKYA 4S17A 2AL6A 2PMVA 4RH6A 2WP9B 1IP9A 3AE3B 2NPTB 1TKGA 1YD8U 5D94A 2L1AA 5LXIB 1FCCC 1H8CA 4YTNB 3NZSA 1MI0A 3QC8B 4L2YA 2JYEA 4A55A 4EEWA 4RMAA 3KUDB 4ZDVA 1F1HA 1KLGD 1WGRA 3ZUNA 3R7RA 4FHKA 1J19A 2D33A 2K22A 1TY0A 4RF9A 1NYQA 2PTLA 3GZNB 2NR2A 3A4RA 2JPHA 1TIFA 1KF6B 2LXAA 3VQIA 3DVNV 2INNE 4RGMA 1WX7A 3GOEA 2FUHB 3Q2AC 3Q8EA 3OWEB 2DZJA 2MBOA 2DLBA 3MC8A 3WIMA 4JQWC 3IG5A 5GMVA 2KDIA 3PHXB 1E0ZA 1TJEA 3V05A 1E8XA 3DHHC 1ET9A 4GB9A 2GRIA 5LNK1 2M19A 2LASA 4FJVB 1UH6A 4RNAA 4NAMA 3TUOA 2DWQA 2AYOB 1JWSD 4A90A 1YQBA 3ZTDA 3ZYYX 3A1QA 3DBSA 1GAQB 1OTRB 3APCA 2V4LA 3N20C 1PFDA 2IGGA 1WH3A 2J7QB 2INPE 4ZRIA 4MH0E 1CQVA 1N60A 1RM6C 3L0WB 1SEBD 5C1ZA 4NQKE 4W9LA 3VXWA 1LM8B 5C3JB 5IN7A 3CIRB 4ZRPA 4A20A 2RPVA 4TQ0A 1T0RC 3H6NA 3V6EB 3KYDD 2HJ8A 5AZFA 3TCAA 1FMAD 2O6VD 2FNJB 5KHOA 1Q0WB 5G55A 1V4GA 3LVWA 4B6WA 2MSED 2KFKA 1DOYA 4MGKE 4MELA 4IUMB 4CHKA 1F0ZA 4HPMB 3ML9A 1EF1A 1TBEA 4HDOA 3L17A 2IGHA 2Y5PA 1VZ7A 2IO3B 1F77A 2C7MB 2BS4B 2KXJA 4BG4B 1E10A 4ZYSA 4IW0A 5IAAC 2KHWB 1N62A 2Z59B 3ZQ4A 2DYMA 2B76B 1R7SA 4WAAA 2GLSA 2GBRA 3W1SA 1YJJA 1VDVA 3DBLI 2ZEQA 1ZUD2 2K6QA 4YTPB 1WJUA 2RD0A 4M00A 1KTKA 3ZJTA 1SSNA 1WGGA 5H8YE 4YT0B 2M1MA 3EA6A 1K53A 4CYEA 4RF6A 2LD9A 3HRDD 4KV2A 2QDFA 2FCNA 2N9KA 1WX9A 2LGDA 2CRKA 4AJYB 4JL9A 1QZEA 4HPLB 3W2DA 3IFWB 3ALBA 1D5XC 3CF6E 3FAHA 5AEKB 3I57A 2ZNVC 2PE6B 2IJ0A 1T0YA 1XCQL 4MACA 1Q5WB 2ZVNA 2LVPA 5HHDG 3DBRB 4W9GA 3AE1B 2VZKD 5BMGA 4TSSA 3U7DA 4HROA 2WGSA 1BUIC 2PEAA 3APFA 2MHJA 5KHQA 3JQ3A 2JRHA 3WA0A 3EGRA 1D3ZA 2K25A 1QF6A 3TJPA 4E74A 2YEPF 3EHVA 3PLVA 4GN1A 1QLBB 4XZ4A 3L2EA 2KN5A 3PTFC 3OG5A 4W9EA 4WH4A 4EFOA 2BYTA 4HJGE 2KKCA 1B1ZA 2JUOA 3QK0A 3NHEB 2ZPNA 3JW0X 4M0WB 3W1SC 1GNUA 2WDQB 1T5XD 4P1CC 5J17A 2Z0DB 1YN3A 4II2B 1KRHA 2WXJA 3PRMB 5C2TB 3NOBA 2E3TA 1P9DU 4O1NA 3WANA 4L1BA 1PYWD 1YN4A 4KIKA 2V3SA 4FADA 1OQRA 4K7SA 1SF0A 4AP4C 3AEDB 1FXTB 3PS6A 4KZ0A 1UWXA 2WXNA 1L0VB 5HFYA 1QT9A 3DVNU 3NY5A 3U8ZA 3NZUA 4IWPA 1BMLC 3VDZA 5T8IA 2OJRA 4HK2A 2KDMA 2WYQA 3AE6B 2MBHA 4MGYE 2I2YA 3U2SC 1AYFA 1ZPSA 3AEBB 1VD2A 3MP9A 2W3SA 4KSKC 2AQ2B 1I0EA 1TS2A 3HIZA 5BO4B 1KH0A 3V6CB 2FCMA 4G0NB 1ZOYB 4Z9MA 4P7IA 5J99A 2XNAC 4URKA 1XQQA 3AECB 4LNIA 1V1PB 4XDDA 3I9V1 1FCLA 3IG3A 4OVVA 4C4VB 1SJHD 1T0SC 2RPQA 4E3CA 4M8MA 4WQOB 1UF0A 2DX5B 2HDEA 4NNJB 3W5VB 2QEJC 3BK1A 2LRUA 1R4NB 2RMMA 1CZPA 1KOTA 4WAFA 1UELA 3UGBB 5JH5C 4AS1A 1WE6A 2W9NA 1Q1OA 4A3OA 2QMTA 3OJ4B 1I4QA 2UYZB 3VUYA 4BAXA 2MW5A 1WSPA 2LUEA 5BYSA 4WIPA 2J0JA 2M56B 3QQ8B 1P3QU 1UNSA 2L76A 2W55A 3KYCD 4ANUA 3OLMD 3ZNZB 1XF5L 2L00B 1IBXA 4WWMA 2IY1B 1TGZB 2X8XX 3U4EG 2IGDA 3ABVB 3O65B 3ZRCA 4W9DA 5AUKA 4A6QA 2V0GA 3GE3C 3NJTA 3L08A 3L4PA 3RNBC 1WJ4A 1WMHA 3ETRA 4ARCA 3A4SC 3MC9A 1E90A 1FXAA 4PYZA 1JW9D 3P4SB 4L23A 3QHTA 4BVUC 4QAYA 3APDA 4NJ6A 3DREA 4OZAA 4S0RA 1MG4A 3U7ZA 3BYTB 3PO0A 3Q8AA 1J7AA 2NBUA 2DYBA 1L6VA 3PRPB 1HEZE 1WR1A 4TMAB 2OHFA 5DPWA 1QH4A 2EMSA 1ACCA 4IWOA 2QILA 4WWNA 2CHWA 3PZ7A 3AU4A 2LZ6A 4C00A 2TSSA 3KWLA 4F1SA 3J9CA 4JIOU 4E71A 2XN9C 3Q8FA 4EKUA 1HTQA 1UWMA 1DGJA 1J7CA 1GB1A 2WU2B 1TS5A 2DAJA 3AM9A 2K9XA 2KYWA 4ZRKA 4GDLA 1E9MA 3FILB 4Q2RA 1WZ3A 2RSUA 2GI9A 4GIVA 4P16A 4W9JA 2XBBC 3WCQA 4W9HA 3ZNGC 1TYGB 5E6OA 3GE8C 1K50A 4ZOHC 2KOXA 4DHJD 4NY0A 2C60A 1PQSA 3H7SA 2AWTA 4NJ7A 4XYCA 3R66C 4US8A 4JE3B 2M17A 2EMTA 3RNCC 2CU3A 1VLBA 2K1FA 4GU2A 1IYFA 3RCZA 1L0XB 1WX8A 1V97A 2JZZA 4YTMB 1CRKA 2O2VA 4BBNC 1L5PA 2L3ZA 4F7ZA 1G6JA 4W9IA 3UI3A 1VA6A 4HWIB 4CQNA 2BKFA 3IXSA 4GDKA 2L52A 1I4XA 3FKYA 2BTEA 1EWYC 2IPKD 3C19A 1WXMA 4XE0A 1R4MB 1QKZA 4HEA1 1ZDVA 1WXVA 2K39A 4YL8A 1WJNA 3NUHB 3Q3FA 4M8NA 1EWCA 3ZGZA 2EKIA 3RN9C 1YX5B 1YNTE 3KUCB 4WQMA 2D5GA 2WLBA 3GP7A 3MJ5A 4TUUA 3JYUA 4WJOA 3B08A 4MM3A 1YQ3B 1N63A 2WX1A 2WXHA 4J3OD 4NAWA 1FRDA 3IG8A 2L8JA 2C7HA 2PW9A 5BYQA 4KVGB 4K7WA 1YIWA 5G5HA 3MC0B 1WFYA 2KTRA 2MJDA 3O13A 4FJZA 2N7JA 1I7HA 5HI1A 1XLQA 1XEEA 4HCPB 4IG7B 3VTUA 3DVGX 2LI5A 3QAQA 5J2RA 2MH7A 3DWGC 1L0YB 1TT5B 3UF8A 2IO1B 3RNGC 1LGRA 3DBHB 2MQJA 2DBYA 1RFAA 1YMHE 1WI0A 1RAXA 3VAWA 3DDCB 3U52E 2HD5B 1CK1A 3URYA 2CHXA 3V60A 2UWQA 3A1QB 3AEEB 1RWSA 2V3PA 2KVRA 4DWFA 3M10A 1JWBD 3TMPB 1LQBA 2G4SA 4RF0A 3A33B 3VVWB 4AM1A 2KX3A 3R7QA 1ZP0B 1I4RA 5J18A 1GC6A 4GOCA 3UIOB 3SDLC 3D32A 2D32A 1HQRD 2JZ3B 4D2KA 1OQQA 4H2AA 1JWMD 1UD7A 4XWWA 1SBBB 4XWTA 3HM6X 4MH8A 5BMIA 1S3SG 2WXKA 1XLNA 1MVKA 2BYFA 4PS7A 4ICUA 1SIFA 3AE8B 4C7ZA 1FXIA 3PV1A 3RZWC 3H9DA 5EE1A 4LDTD 2KMMA 1N5WA 3MHSD 1UGJA 3AN1A 2YVCA 4A8XC 2KWDA 4GSWA 3LVVA 1JROA 1YQ4B 1SGHA 4FA6A 3A9JB 1NI3A 5IO9A 4DHZE 3AULA 3NZTA 4WJNA 2NVUI 1MFWA 5D3DA 3CSFA 1L7YA 1MHXA 2KWCA 2AL3A 2FCSA 1ZXIA 3PREA 1HE8A 5DPRA 2W54A 2KWUB 2K8BA 3HVZA 1PUTA 3SR6A 3BVMA 4HPPA 1EUVB 2LUMA 2IDYA 1V81A 2G1EA 1VRPA 5EE3A 2V9HA 1V9JA 4NJCA 4IKGA 2WWZA 3VTWA 4XC2A 2OJWA 2KT7A 2KVZA 4FHJA 2KQ7A 4ANWA 2R2OA 2MA9B 2NTSA 1GOZA 3RNAC 2O6VB 1TS4A 3DHGC 1NDDA 5I4DA 2KC2A 2KFJA 4BKGA 1XD3B 5FKAC 3TL5A 2G4DB 1JMLA 3AEGB 3VR8B 1UZXB 1N5XA 4RF8A 1WGDA 4WJQA 3LYYA 1KJTA 3NZ3A 3PLUA 3RT3B 4RF1A 1SE2A 3AH7A 2Z8LA 1VJKA 1V80A 1EO6A 1MHHE 3H7PA 1LO5D 3ZXVA 2BQQA 2KLCA 1WWTA 1WXQA 4BBNF 1HZ6A 3RYTA 1MJDA 3VR9B 4K7UA 3L2EB 1J7BA 1FPYA 1VR9A 2GB1A 3M62B 3NS1A 5CHWA 2ACZB 3ZW3A 4ZRQA 3M95A 2V1YA 3UIPB 5HKHA 2K3UA 3BZDB 3Q3JA 4CO7A 3DBLB 4LLGM 2KD0A 4EZJA 5E6JA 4BG4A 2C9WB 1OEYJ 2Y3AA 1WYGA 3WAMA 1YJIA 4C80A 1JALA 1YX6B 4KGRA 2ON8A 3AEAB 4KIKB 2LGYA 2Z0EB 1V49A 2GBJA 4HKZE 1E8WA 5MPOA 4JGHB 1WIAA 3P4QB 3WAPA 1L2NA 2VZKB 3HVDA 2MP2A 1NYRA 4B0EA 3R8BA 1E8ZA 3B1LX 1L4ZB 4M02A 1C3TA 1L4DB 3TEWA 2V3NA 3NVVA 3N32A 4J6IA 4C7YA 4TKNA 1C79A 2FIDA 1GB4A 3M3JA 2BKRB 3KUZA 2J0KA 3UQAA 2MRPA 1N61A 1FFUA 1KM7A 2C7NB 1UBIA 2KNBA 4GVZA 3NVWA 1L6UA 2CR5A 1KFYB 2K6DB 3RNEC 1STEA 4PT5A 3JPZA 4AQ7A 3AV8A 1FEHA 1WRDB 2JT4B 4KGTA 1FD6A 2XK5B 3DCGA 2MWSB 2RDGA 2A5UA 1D5ZC 2QCZA 1OQYA 2NS5A 2KAJA 2BW2A 4EZLA 2KWVB 3SFEB 3SU8X 2BS2B 2GWDA 2WXOA 4GLSC 4I6LB 2WU5B 3ML8A 4HJKA 2L0FA 2KMCA 4FJYA 4KZCA 3JU6A 1IPGA 1OGWA 3BIID 1M4VA 3L2DA 3AEFB 4M0WA 2DZMA 2FCQA 5AUIA 1AN8A 3QARA 2IBIB 5AZHA 1S1QB 3TEXA 3RI7C 3LB8C 5CHFA 2LJ5A 2L32A 3W5UB 1I4HA 2KC1A 1GPXA 2WS3B 1EU4A 2PIAA 4AOFA 1F52A 3A9KB 3AE5B 4UDUC 1BXTA 5EE0A 1ZXHA 1WMHB 1C78A 4XGAB 3N30A 3PPAA 1D6EC 4ANVA 1AARA 4USAA 2WNMA 2BYEA 1C9FA 3HM3A 5TR5A 2PVOD 3LXFA 1V5TA 2ZCCA 4HVBA 1E7PB 2BGFA 2BWFA 2XEWA 1WYWB 3DHIC 4MEMA 2LMCA 1GC7A 4KKIA 1C4CA 3KH0A 2J53A 3IT6B 3IHPC 1ROEA 3QCAA 4YXDB 3MHZA 2KLGA 2HJ1A 3VRAB 2A4ZA 2Y5CA 3DRBA 1WM2A 2HTHA 2YEPB 3Q3OC 3ZDMC 1P98A 1V1PA 2DAFA 1GG3A 3C8YA 2N7DA 5D7GA 5IP4D 4C4VA 4LNNA 3AE4B 2BB6A 1RLFA 4MJSA 4LJOB 1C77A 2D3GA 3ZDTA 3W1YA 2ZCBA 3Q69A 3EECA 2Y5BB 5FR6A 3QX1A 2M0AA 2ZZPB 1WXAA 3RNFC 2D2QA 3P2BA 2KMAA 2B3AA 3X23A 1K52A 1FFVA 1TY2A 1QOGA 5HG2A 2PLPA 1FNUA 3PGEA 1V1OA 3ONSA 3VH3B 1G0WA 2QIEB 2IZVB 5E6PA 2LGSA 3I63C 2WDVB 4GMVA 3JSVA 4MSMB 4REZA 3VH4B 2E6XA 4JWUC 3EFCA 1F2RC 2WXMA 2K0PA 4M01A 5TSSA 3TEYA 2BVCA 5LXHA 4RM9A 4ZHOA 1R8GA 3TBLD 3Q6BA 1JCKB 2GBKA 4NPNA 4YSXB 3KQ4A 3RULA 4A9AA 2MBQA 2NMQA 3BY4B 2K5PA 1ENFA 3RD2A 2MEKA 5IKCM 1V6EA 4OVZA 3BYYB 1P50A 1FM0D 4G11A 4DXAB 1C76A 4MM3B 4Q2JA 1JRPA 1NI2A 3L13A 2WXIA 2JF5A 1EF5A 2FAZA 3HHMA 4DHJB 2K8HA 1Q10A 2PPHA 1HXYD 4II3B 4FN2A 2KO3A 3AE9B 2KDBA 2LRWA 2KANA 2AX5A 3ZVVA 1SD0A 1RYJA 1I4PA 5D2MB 3E9SA 2AQ1B 2JWZA 3R3MA 3AMZA 2WDTB 2FIFA 3Q3NC 4XX5A 4XDCA 4R3DA 5G5GA 1WGHA 4DQOC 5BMHA 4LCDE 1MPEA 1NENB 3FILA 2MJEA 1QOFA 2KDEB 2WXLA 4K3CA 1F9JA 1X1MA 1WGYA 1T6BX 2QSDA 4N9F4 4DDGD 1OEYA 3QIJA 4LJPB 1I42A 3OAWA 2K8CA 3N1YC 2BYVE 3GB1A 3M63B 1JRUA 3I5JC 4G50A 2KJRA 1D5MC 2ASQA 2NTTA 4ZHPA 2BWES 1V2YA 4BKSA 4NZLB 1SE9A 1YN5A 1PGBA 1VRAB 2JQRB 1T3QA 2JYTA 2MCNB 3MFGA 5G2NA 3GZNI 1EM7A 3K9PB 1ZW7A 4HLEA 4W9FA 1E7UA 3U30A 3B6RA 3ZO5B 3N3KB 1ZKHA 4OZBA 2R2QA 3Q8CA 1XT9B 1Y8RC 4BKTA 2N1VA 3NG0A 1WR6E 2JWUA 2IO2B 2I1KA 2PJHA 3PSEB 3EC8A 4HCNB 1V5OA 1C4PA 5LLIA 4RM8A 2KK8A 1SE4A 3GS2A 1V8CA 2N9EB 2ZNVB 5IA7A 2LEKA 1D4BA 3AI5A 3EUB2 3QA8A 5FR3A 4IM2A 1YJ1A 3RUIB 1SIJA 2GWCA 2J4XA 2GBNA 3BK2A 1GUAB 1ESFA 3KVFB 4JLCA 1HTOA 3ZNID 2DYOA 4DXGA 2NPTA 2DNFA 3L54A 2H88B 1I35A 2KFKB 3PZDA 2BB5A 3FC4A 2HTME 2N1WA 2NBVB 3VUXA 5L95C 3Q8BA 1DOXA 1SJED 3KW5B 2MBEA 3KWVA 4LK0M 2D3BA 2LFIA 1C4AA 3BVGA 1T0QC 3QWZB 2N4FA 1KLUD 3AB5A 1JQ4A 1M94A 5CHVC 2N0SB 2CS4A 4LDTB 3R2TA 4DDID 2IO0B 4OZCA 4ZRJA 1K51A 3DWMA 1H4RA 2JSVX 1NVID 1MG8A 2MX2A 3H7PB 2KQSA 4HDQA 2J52A 1TT4A 4BOZB 2LXCA 2KN4A 5E6NA 3P4RB 4I6PA 3DQVA 3EFUA 4OVUA 4ANXA 2V4IB 4N59A 2UU7A 4WWOA 2OOBB 1QILA 5JXVA 2OEDA 3PHWB 2D11A 3R2IA 3RFZB 1TTNA 2LGXA 4X57B 3L10B 4MGIE 2ZW1A 4GW0A 1ZDXA 3B2FA 5JHBA 3N1ZC 2W82A 3Q3MC 4IC7B 4BHLA 1RRBA 1TZ1A 3A9JA 1QOBA 4RGNA 3WAOA 2LHDA 2KZRA 1RL9A 2G3QB 2VH1A 3OJ3A 2JY6A 3PVLA 3DVGY 1FRRA 1Y56A 4LNFA 3TEZA 1N6ZA 2J42A 2ONQA 3DBRI 4TV3A 3B0AA 1SE3A 4FULA 4AWJA 3ZRFA 4MGZE 2PKOA 3ZTCA 1HZ5A 2MP2B 3V61A 2DHZA 2DZKA 2ZPYA 4PS8A 3V3XA 1QK1A 2QC8A 1P0RA 2D3CA 3B2GA 4I6NB 4IDIA 3MTNB 2MJ3A 4B95A 1LFDA 3K9OB 3DPDA 3ZJUA 2FE8A 2QHOA 1WY8A 4EUTA 4RFBA 1VZ8A 3CSTA 2J0MA 3ZJVA 1ZE3D 2IY0B 4K3BA 5FK9C 1JWUD 1TS3A 4GW2A 2O6VA 4AUQC 4BZAA 4C56C 1HA5A 4ACFA 1KLVA 3JU5A 2WXPA 2KJ6A 1PGXA 1DYQA 2KTFA 4JX1C 1SXTA 4B9KA 4ITKA 5C23A 3H1UA 1P7EA 4DK5A 2ZJDA 2HE7A 4DXFA 3SFDB 4NQLB 3ZLZA 3JVZX 2JXXA 2DZIA 3T3OA 1E7VA 3C0RB 1SB3C 2GMIC 2REXA 3RPFC 1FNVA 4WURA 4EZKA 2CJNA 4LNKA 2IYDB 2JXTA 2FBWB 1P1AA 3AE7B 1PDXA 3VTVA 2VH2A 5BYRA 4A3PA 1F2RI 5DPSA 2ZW0A 3P63A 4YSZB 4N58A 5H92C 2WDRB 2FUG1 4IOIE 3AE2B 1BG0A 1B9RA 5CTRC 2MBBB 3AU5A 3VFKA 2EELA 1E5WA 3V62A 1QOAA 4FXCA 1WM3A 4US9A 5D6JB 3HUIA 2SAKA 1XO3A 3BINA 4IM0A 2BF8B 1JWAD 1WF9A 1DOIA 2D07B 3NRZA 2RGFA 3NVYA 4YWGG 2WXQA 2CKHB 1PGAA 5J9AA 3RMKC 2RR9A 4ZYNA 3E56A 1P7FA 1ISNA 4KKJA 2KX0A 4K81A 1GJZA 2D10A 2L83A 4W9CA 3SEBA 3TSSA 1R4NI 2I1JA 1P52A 1UBQA 4OHJA 4FBJB 1WGKA 1XLOA 3VUWA 2M0XA 1IBXB 4JWSC 1UGMA 2W3RA 2LJIA 3ZKJC 1AW7A 2N9LA 4ARIA 4PYUA 2J1QA 3AXCA 5CX3A 4GVYA 2JRIB 4EOYA 1EU3A 2JU6X 2BPSA 4IM3A 2N9PC 3IAS1 3KLSX 2SEBD 3T8MA 4MDKE 2XK5A 2LWPA 3SHQA 4MT5A 4MJSB 2WXRA 4KSLC 2KDFB 1Z5SB 2NCNA 4OW0A 2C5LC 3T3NA 1ZGUB 1J0GA 5JZEB 1VCBA 3HK0A 4LNOA 1IUEA 2H89B 1WRIA 4N6EB 3TIXA
chains in the Genus database with same CATH topology
1RL9A 4LNIA 1M15A 4Z9MA 3ZXRA 3NG0A 1CRKA 4RF6A 3M10A 4GVZA 1BG0A 4ACFA 4BHLA 4HPPA 3JU5A 1G0WA 2UU7A 5J9AA 4BG4B 4BAXA 3JPZA 1VRPA 1HTOA 5J99A 2CRKA 3ZXVA 3L2EA 2LGSA 1LGRA 1F52A 4LNFA 1HTQA 1F1HA 3DRBA 4LNKA 2GLSA 1I0EA 1U6RA 4XYCA 3B6RA 3JU6A 4AM1A 4BG4A 4GW0A 2WHIA 2D3BA 2J1QA 3FKYA 3L2DA 2WGSA 4GVYA 2OJWA 3L2EB 4RF7A 4S17A 1P50A 4LNOA 1QH4A 3DREA 1SD0A 1FPYA 4GW2A 4S0RA 1P52A 4Q2RA 4RF9A 4LNNA 1QK1A 3JQ3A 2QC8A 4RF8A 2BVCA 2D3CA 2D3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL9 A;  4LNI A;  1M15 A;  4Z9M A;  3ZXR A;  3NG0 A;  1CRK A;  4RF6 A;  3M10 A;  4GVZ A;  1BG0 A;  4ACF A;  4BHL A;  4HPP A;  3JU5 A;  1G0W A;  2UU7 A;  5J9A A;  4BG4 B;  4BAX A;  3JPZ A;  1VRP A;  1HTO A;  5J99 A;  2CRK A;  3ZXV A;  3L2E A;  2LGS A;  1LGR A;  1F52 A;  4LNF A;  1HTQ A;  1F1H A;  3DRB A;  4LNK A;  2GLS A;  1I0E A;  1U6R A;  4XYC A;  3B6R A;  3JU6 A;  4AM1 A;  4BG4 A;  4GW0 A;  2WHI A;  2D3B A;  2J1Q A;  3FKY A;  3L2D A;  2WGS A;  4GVY A;  2OJW A;  3L2E B;  4RF7 A;  4S17 A;  1P50 A;  4LNO A;  1QH4 A;  3DRE A;  1SD0 A;  1FPY A;  4GW2 A;  4S0R A;  1P52 A;  4Q2R A;  4RF9 A;  4LNN A;  1QK1 A;  3JQ3 A;  2QC8 A;  4RF8 A;  2BVC A;  2D3C A;  2D3A A; 
#chains in the Genus database with same CATH topology
 2VRR B;  3ENE A;  1TZO A;  2L0T A;  4JPS A;  2AQ3 B;  2BBC A;  3IVF A;  2KQ4 X;  4TQ1 A;  2EKE C;  1NBF C;  2PVG C;  4KX6 B;  1U6R A;  2Q5W D;  1A5R A;  2WHI A;  1OFF A;  2WX0 A;  2YLM A;  2L7R A;  3JSV B;  2D3A A;  3ZIM A;  4HKQ A;  4K1R B;  3A9K A;  3IAM 1;  2RDH A;  2WQY B;  4GGQ A;  1K8R B;  4GDL B;  2LVQ A;  2X38 A;  1I4G A;  2L05 A;  3RZF A;  1U4A A;  4IWQ A;  2KJH B;  2R61 A;  1FIQ A;  1C1Y B;  2JX5 A;  1FO4 A;  4RGT A;  1XXG A;  3L16 A;  1V86 A;  1J8C A;  3IT4 B;  2G45 B;  1NEK B;  1UUP A;  3P4P B;  1M15 A;  2PE9 A;  2QJL A;  4MSQ B;  5EE9 A;  4P6V F;  3NVZ A;  2CJO A;  1CMX B;  2M8S A;  2N9X A;  5GXG B;  2INC C;  3P42 A;  2JZP A;  2IND C;  4W9K A;  2O2V B;  5EDS A;  4FLH A;  2CU1 A;  3VHT C;  3VRB B;  3Q14 C;  2DEN B;  1YOV B;  2JVC A;  5DPT A;  4GDK B;  4WWP A;  2RDB C;  4BFR A;  4KGS A;  4WJP A;  4PS3 A;  4G3X B;  1E6E B;  3P1M A;  3X0W A;  3CMM B;  4HXD A;  3IBE A;  4DBG A;  2LHE A;  4KDL B;  3SD5 A;  3ZNH B;  3BWU D;  4RF7 A;  3T9L A;  1FNW A;  3LN6 A;  3H8H A;  2LGI A;  1E8Y A;  5D3I B;  4BKS D;  2LVO A;  1RFK A;  4RGO S;  2WXF A;  1R4M I;  4ICV A;  3LDZ E;  2M4N A;  3NS8 A;  4KDI C;  4NAW B;  1XLP A;  3B9J A;  2WXG A;  3N1X C;  1Z2M A;  5L83 A;  5IOI A;  2I38 A;  2AEH A;  1WXS A;  1WE7 A;  2NBW B;  1XCT L;  4HRS A;  2KAC A;  4YSY B;  3ZXR A;  2GBM A;  2KTR B;  4BOS C;  3WAL A;  2G9H D;  3BVZ A;  2N7E A;  3LJ3 A;  1WZ0 A;  4F8C B;  4LTU A;  2ICI A;  1IGD A;  3PT2 B;  3S2A A;  4DHZ B;  1QQR A;  2BS3 B;  3PRZ A;  1IGC A;  1AWD A;  4AJW A;  3QJZ A;  2CHZ A;  5AZG A;  1LXD A;  1ET6 A;  3I3T B;  5JHA A;  5DCN A;  2GOW A;  4PK1 A;  1BT0 A;  4RCO A;  1A70 A;  3DBH I;  4P1B C;  3LN7 A;  1CJE A;  1TKE A;  4EE2 A;  3ECI A;  3W9C B;  3N9Y C;  1WJ6 A;  3PZ8 A;  3DOW A;  3UIN B;  4GXB A;  4ASW C;  4B0M A;  3MJW A;  3CWI A;  3UQB A;  1VZ6 A;  2MLB A;  2ZVO A;  2BT6 A;  1TKY A;  4S17 A;  2AL6 A;  2PMV A;  4RH6 A;  2WP9 B;  1IP9 A;  3AE3 B;  2NPT B;  1TKG A;  1YD8 U;  5D94 A;  2L1A A;  5LXI B;  1FCC C;  1H8C A;  4YTN B;  3NZS A;  1MI0 A;  3QC8 B;  4L2Y A;  2JYE A;  4A55 A;  4EEW A;  4RMA A;  3KUD B;  4ZDV A;  1F1H A;  1KLG D;  1WGR A;  3ZUN A;  3R7R A;  4FHK A;  1J19 A;  2D33 A;  2K22 A;  1TY0 A;  4RF9 A;  1NYQ A;  2PTL A;  3GZN B;  2NR2 A;  3A4R A;  2JPH A;  1TIF A;  1KF6 B;  2LXA A;  3VQI A;  3DVN V;  2INN E;  4RGM A;  1WX7 A;  3GOE A;  2FUH B;  3Q2A C;  3Q8E A;  3OWE B;  2DZJ A;  2MBO A;  2DLB A;  3MC8 A;  3WIM A;  4JQW C;  3IG5 A;  5GMV A;  2KDI A;  3PHX B;  1E0Z A;  1TJE A;  3V05 A;  1E8X A;  3DHH C;  1ET9 A;  4GB9 A;  2GRI A;  5LNK 1;  2M19 A;  2LAS A;  4FJV B;  1UH6 A;  4RNA A;  4NAM A;  3TUO A;  2DWQ A;  2AYO B;  1JWS D;  4A90 A;  1YQB A;  3ZTD A;  3ZYY X;  3A1Q A;  3DBS A;  1GAQ B;  1OTR B;  3APC A;  2V4L A;  3N20 C;  1PFD A;  2IGG A;  1WH3 A;  2J7Q B;  2INP E;  4ZRI A;  4MH0 E;  1CQV A;  1N60 A;  1RM6 C;  3L0W B;  1SEB D;  5C1Z A;  4NQK E;  4W9L A;  3VXW A;  1LM8 B;  5C3J B;  5IN7 A;  3CIR B;  4ZRP A;  4A20 A;  2RPV A;  4TQ0 A;  1T0R C;  3H6N A;  3V6E B;  3KYD D;  2HJ8 A;  5AZF A;  3TCA A;  1FMA D;  2O6V D;  2FNJ B;  5KHO A;  1Q0W B;  5G55 A;  1V4G A;  3LVW A;  4B6W A;  2MSE D;  2KFK A;  1DOY A;  4MGK E;  4MEL A;  4IUM B;  4CHK A;  1F0Z A;  4HPM B;  3ML9 A;  1EF1 A;  1TBE A;  4HDO A;  3L17 A;  2IGH A;  2Y5P A;  1VZ7 A;  2IO3 B;  1F77 A;  2C7M B;  2BS4 B;  2KXJ A;  4BG4 B;  1E10 A;  4ZYS A;  4IW0 A;  5IAA C;  2KHW B;  1N62 A;  2Z59 B;  3ZQ4 A;  2DYM A;  2B76 B;  1R7S A;  4WAA A;  2GLS A;  2GBR A;  3W1S A;  1YJJ A;  1VDV A;  3DBL I;  2ZEQ A;  1ZUD 2;  2K6Q A;  4YTP B;  1WJU A;  2RD0 A;  4M00 A;  1KTK A;  3ZJT A;  1SSN A;  1WGG A;  5H8Y E;  4YT0 B;  2M1M A;  3EA6 A;  1K53 A;  4CYE A;  4RF6 A;  2LD9 A;  3HRD D;  4KV2 A;  2QDF A;  2FCN A;  2N9K A;  1WX9 A;  2LGD A;  2CRK A;  4AJY B;  4JL9 A;  1QZE A;  4HPL B;  3W2D A;  3IFW B;  3ALB A;  1D5X C;  3CF6 E;  3FAH A;  5AEK B;  3I57 A;  2ZNV C;  2PE6 B;  2IJ0 A;  1T0Y A;  1XCQ L;  4MAC A;  1Q5W B;  2ZVN A;  2LVP A;  5HHD G;  3DBR B;  4W9G A;  3AE1 B;  2VZK D;  5BMG A;  4TSS A;  3U7D A;  4HRO A;  2WGS A;  1BUI C;  2PEA A;  3APF A;  2MHJ A;  5KHQ A;  3JQ3 A;  2JRH A;  3WA0 A;  3EGR A;  1D3Z A;  2K25 A;  1QF6 A;  3TJP A;  4E74 A;  2YEP F;  3EHV A;  3PLV A;  4GN1 A;  1QLB B;  4XZ4 A;  3L2E A;  2KN5 A;  3PTF C;  3OG5 A;  4W9E A;  4WH4 A;  4EFO A;  2BYT A;  4HJG E;  2KKC A;  1B1Z A;  2JUO A;  3QK0 A;  3NHE B;  2ZPN A;  3JW0 X;  4M0W B;  3W1S C;  1GNU A;  2WDQ B;  1T5X D;  4P1C C;  5J17 A;  2Z0D B;  1YN3 A;  4II2 B;  1KRH A;  2WXJ A;  3PRM B;  5C2T B;  3NOB A;  2E3T A;  1P9D U;  4O1N A;  3WAN A;  4L1B A;  1PYW D;  1YN4 A;  4KIK A;  2V3S A;  4FAD A;  1OQR A;  4K7S A;  1SF0 A;  4AP4 C;  3AED B;  1FXT B;  3PS6 A;  4KZ0 A;  1UWX A;  2WXN A;  1L0V B;  5HFY A;  1QT9 A;  3DVN U;  3NY5 A;  3U8Z A;  3NZU A;  4IWP A;  1BML C;  3VDZ A;  5T8I A;  2OJR A;  4HK2 A;  2KDM A;  2WYQ A;  3AE6 B;  2MBH A;  4MGY E;  2I2Y A;  3U2S C;  1AYF A;  1ZPS A;  3AEB B;  1VD2 A;  3MP9 A;  2W3S A;  4KSK C;  2AQ2 B;  1I0E A;  1TS2 A;  3HIZ A;  5BO4 B;  1KH0 A;  3V6C B;  2FCM A;  4G0N B;  1ZOY B;  4Z9M A;  4P7I A;  5J99 A;  2XNA C;  4URK A;  1XQQ A;  3AEC B;  4LNI A;  1V1P B;  4XDD A;  3I9V 1;  1FCL A;  3IG3 A;  4OVV A;  4C4V B;  1SJH D;  1T0S C;  2RPQ A;  4E3C A;  4M8M A;  4WQO B;  1UF0 A;  2DX5 B;  2HDE A;  4NNJ B;  3W5V B;  2QEJ C;  3BK1 A;  2LRU A;  1R4N B;  2RMM A;  1CZP A;  1KOT A;  4WAF A;  1UEL A;  3UGB B;  5JH5 C;  4AS1 A;  1WE6 A;  2W9N A;  1Q1O A;  4A3O A;  2QMT A;  3OJ4 B;  1I4Q A;  2UYZ B;  3VUY A;  4BAX A;  2MW5 A;  1WSP A;  2LUE A;  5BYS A;  4WIP A;  2J0J A;  2M56 B;  3QQ8 B;  1P3Q U;  1UNS A;  2L76 A;  2W55 A;  3KYC D;  4ANU A;  3OLM D;  3ZNZ B;  1XF5 L;  2L00 B;  1IBX A;  4WWM A;  2IY1 B;  1TGZ B;  2X8X X;  3U4E G;  2IGD A;  3ABV B;  3O65 B;  3ZRC A;  4W9D A;  5AUK A;  4A6Q A;  2V0G A;  3GE3 C;  3NJT A;  3L08 A;  3L4P A;  3RNB C;  1WJ4 A;  1WMH A;  3ETR A;  4ARC A;  3A4S C;  3MC9 A;  1E90 A;  1FXA A;  4PYZ A;  1JW9 D;  3P4S B;  4L23 A;  3QHT A;  4BVU C;  4QAY A;  3APD A;  4NJ6 A;  3DRE A;  4OZA A;  4S0R A;  1MG4 A;  3U7Z A;  3BYT B;  3PO0 A;  3Q8A A;  1J7A A;  2NBU A;  2DYB A;  1L6V A;  3PRP B;  1HEZ E;  1WR1 A;  4TMA B;  2OHF A;  5DPW A;  1QH4 A;  2EMS A;  1ACC A;  4IWO A;  2QIL A;  4WWN A;  2CHW A;  3PZ7 A;  3AU4 A;  2LZ6 A;  4C00 A;  2TSS A;  3KWL A;  4F1S A;  3J9C A;  4JIO U;  4E71 A;  2XN9 C;  3Q8F A;  4EKU A;  1HTQ A;  1UWM A;  1DGJ A;  1J7C A;  1GB1 A;  2WU2 B;  1TS5 A;  2DAJ A;  3AM9 A;  2K9X A;  2KYW A;  4ZRK A;  4GDL A;  1E9M A;  3FIL B;  4Q2R A;  1WZ3 A;  2RSU A;  2GI9 A;  4GIV A;  4P16 A;  4W9J A;  2XBB C;  3WCQ A;  4W9H A;  3ZNG C;  1TYG B;  5E6O A;  3GE8 C;  1K50 A;  4ZOH C;  2KOX A;  4DHJ D;  4NY0 A;  2C60 A;  1PQS A;  3H7S A;  2AWT A;  4NJ7 A;  4XYC A;  3R66 C;  4US8 A;  4JE3 B;  2M17 A;  2EMT A;  3RNC C;  2CU3 A;  1VLB A;  2K1F A;  4GU2 A;  1IYF A;  3RCZ A;  1L0X B;  1WX8 A;  1V97 A;  2JZZ A;  4YTM B;  1CRK A;  2O2V A;  4BBN C;  1L5P A;  2L3Z A;  4F7Z A;  1G6J A;  4W9I A;  3UI3 A;  1VA6 A;  4HWI B;  4CQN A;  2BKF A;  3IXS A;  4GDK A;  2L52 A;  1I4X A;  3FKY A;  2BTE A;  1EWY C;  2IPK D;  3C19 A;  1WXM A;  4XE0 A;  1R4M B;  1QKZ A;  4HEA 1;  1ZDV A;  1WXV A;  2K39 A;  4YL8 A;  1WJN A;  3NUH B;  3Q3F A;  4M8N A;  1EWC A;  3ZGZ A;  2EKI A;  3RN9 C;  1YX5 B;  1YNT E;  3KUC B;  4WQM A;  2D5G A;  2WLB A;  3GP7 A;  3MJ5 A;  4TUU A;  3JYU A;  4WJO A;  3B08 A;  4MM3 A;  1YQ3 B;  1N63 A;  2WX1 A;  2WXH A;  4J3O D;  4NAW A;  1FRD A;  3IG8 A;  2L8J A;  2C7H A;  2PW9 A;  5BYQ A;  4KVG B;  4K7W A;  1YIW A;  5G5H A;  3MC0 B;  1WFY A;  2KTR A;  2MJD A;  3O13 A;  4FJZ A;  2N7J A;  1I7H A;  5HI1 A;  1XLQ A;  1XEE A;  4HCP B;  4IG7 B;  3VTU A;  3DVG X;  2LI5 A;  3QAQ A;  5J2R A;  2MH7 A;  3DWG C;  1L0Y B;  1TT5 B;  3UF8 A;  2IO1 B;  3RNG C;  1LGR A;  3DBH B;  2MQJ A;  2DBY A;  1RFA A;  1YMH E;  1WI0 A;  1RAX A;  3VAW A;  3DDC B;  3U52 E;  2HD5 B;  1CK1 A;  3URY A;  2CHX A;  3V60 A;  2UWQ A;  3A1Q B;  3AEE B;  1RWS A;  2V3P A;  2KVR A;  4DWF A;  3M10 A;  1JWB D;  3TMP B;  1LQB A;  2G4S A;  4RF0 A;  3A33 B;  3VVW B;  4AM1 A;  2KX3 A;  3R7Q A;  1ZP0 B;  1I4R A;  5J18 A;  1GC6 A;  4GOC A;  3UIO B;  3SDL C;  3D32 A;  2D32 A;  1HQR D;  2JZ3 B;  4D2K A;  1OQQ A;  4H2A A;  1JWM D;  1UD7 A;  4XWW A;  1SBB B;  4XWT A;  3HM6 X;  4MH8 A;  5BMI A;  1S3S G;  2WXK A;  1XLN A;  1MVK A;  2BYF A;  4PS7 A;  4ICU A;  1SIF A;  3AE8 B;  4C7Z A;  1FXI A;  3PV1 A;  3RZW C;  3H9D A;  5EE1 A;  4LDT D;  2KMM A;  1N5W A;  3MHS D;  1UGJ A;  3AN1 A;  2YVC A;  4A8X C;  2KWD A;  4GSW A;  3LVV A;  1JRO A;  1YQ4 B;  1SGH A;  4FA6 A;  3A9J B;  1NI3 A;  5IO9 A;  4DHZ E;  3AUL A;  3NZT A;  4WJN A;  2NVU I;  1MFW A;  5D3D A;  3CSF A;  1L7Y A;  1MHX A;  2KWC A;  2AL3 A;  2FCS A;  1ZXI A;  3PRE A;  1HE8 A;  5DPR A;  2W54 A;  2KWU B;  2K8B A;  3HVZ A;  1PUT A;  3SR6 A;  3BVM A;  4HPP A;  1EUV B;  2LUM A;  2IDY A;  1V81 A;  2G1E A;  1VRP A;  5EE3 A;  2V9H A;  1V9J A;  4NJC A;  4IKG A;  2WWZ A;  3VTW A;  4XC2 A;  2OJW A;  2KT7 A;  2KVZ A;  4FHJ A;  2KQ7 A;  4ANW A;  2R2O A;  2MA9 B;  2NTS A;  1GOZ A;  3RNA C;  2O6V B;  1TS4 A;  3DHG C;  1NDD A;  5I4D A;  2KC2 A;  2KFJ A;  4BKG A;  1XD3 B;  5FKA C;  3TL5 A;  2G4D B;  1JML A;  3AEG B;  3VR8 B;  1UZX B;  1N5X A;  4RF8 A;  1WGD A;  4WJQ A;  3LYY A;  1KJT A;  3NZ3 A;  3PLU A;  3RT3 B;  4RF1 A;  1SE2 A;  3AH7 A;  2Z8L A;  1VJK A;  1V80 A;  1EO6 A;  1MHH E;  3H7P A;  1LO5 D;  3ZXV A;  2BQQ A;  2KLC A;  1WWT A;  1WXQ A;  4BBN F;  1HZ6 A;  3RYT A;  1MJD A;  3VR9 B;  4K7U A;  3L2E B;  1J7B A;  1FPY A;  1VR9 A;  2GB1 A;  3M62 B;  3NS1 A;  5CHW A;  2ACZ B;  3ZW3 A;  4ZRQ A;  3M95 A;  2V1Y A;  3UIP B;  5HKH A;  2K3U A;  3BZD B;  3Q3J A;  4CO7 A;  3DBL B;  4LLG M;  2KD0 A;  4EZJ A;  5E6J A;  4BG4 A;  2C9W B;  1OEY J;  2Y3A A;  1WYG A;  3WAM A;  1YJI A;  4C80 A;  1JAL A;  1YX6 B;  4KGR A;  2ON8 A;  3AEA B;  4KIK B;  2LGY A;  2Z0E B;  1V49 A;  2GBJ A;  4HKZ E;  1E8W A;  5MPO A;  4JGH B;  1WIA A;  3P4Q B;  3WAP A;  1L2N A;  2VZK B;  3HVD A;  2MP2 A;  1NYR A;  4B0E A;  3R8B A;  1E8Z A;  3B1L X;  1L4Z B;  4M02 A;  1C3T A;  1L4D B;  3TEW A;  2V3N A;  3NVV A;  3N32 A;  4J6I A;  4C7Y A;  4TKN A;  1C79 A;  2FID A;  1GB4 A;  3M3J A;  2BKR B;  3KUZ A;  2J0K A;  3UQA A;  2MRP A;  1N61 A;  1FFU A;  1KM7 A;  2C7N B;  1UBI A;  2KNB A;  4GVZ A;  3NVW A;  1L6U A;  2CR5 A;  1KFY B;  2K6D B;  3RNE C;  1STE A;  4PT5 A;  3JPZ A;  4AQ7 A;  3AV8 A;  1FEH A;  1WRD B;  2JT4 B;  4KGT A;  1FD6 A;  2XK5 B;  3DCG A;  2MWS B;  2RDG A;  2A5U A;  1D5Z C;  2QCZ A;  1OQY A;  2NS5 A;  2KAJ A;  2BW2 A;  4EZL A;  2KWV B;  3SFE B;  3SU8 X;  2BS2 B;  2GWD A;  2WXO A;  4GLS C;  4I6L B;  2WU5 B;  3ML8 A;  4HJK A;  2L0F A;  2KMC A;  4FJY A;  4KZC A;  3JU6 A;  1IPG A;  1OGW A;  3BII D;  1M4V A;  3L2D A;  3AEF B;  4M0W A;  2DZM A;  2FCQ A;  5AUI A;  1AN8 A;  3QAR A;  2IBI B;  5AZH A;  1S1Q B;  3TEX A;  3RI7 C;  3LB8 C;  5CHF A;  2LJ5 A;  2L32 A;  3W5U B;  1I4H A;  2KC1 A;  1GPX A;  2WS3 B;  1EU4 A;  2PIA A;  4AOF A;  1F52 A;  3A9K B;  3AE5 B;  4UDU C;  1BXT A;  5EE0 A;  1ZXH A;  1WMH B;  1C78 A;  4XGA B;  3N30 A;  3PPA A;  1D6E C;  4ANV A;  1AAR A;  4USA A;  2WNM A;  2BYE A;  1C9F A;  3HM3 A;  5TR5 A;  2PVO D;  3LXF A;  1V5T A;  2ZCC A;  4HVB A;  1E7P B;  2BGF A;  2BWF A;  2XEW A;  1WYW B;  3DHI C;  4MEM A;  2LMC A;  1GC7 A;  4KKI A;  1C4C A;  3KH0 A;  2J53 A;  3IT6 B;  3IHP C;  1ROE A;  3QCA A;  4YXD B;  3MHZ A;  2KLG A;  2HJ1 A;  3VRA B;  2A4Z A;  2Y5C A;  3DRB A;  1WM2 A;  2HTH A;  2YEP B;  3Q3O C;  3ZDM C;  1P98 A;  1V1P A;  2DAF A;  1GG3 A;  3C8Y A;  2N7D A;  5D7G A;  5IP4 D;  4C4V A;  4LNN A;  3AE4 B;  2BB6 A;  1RLF A;  4MJS A;  4LJO B;  1C77 A;  2D3G A;  3ZDT A;  3W1Y A;  2ZCB A;  3Q69 A;  3EEC A;  2Y5B B;  5FR6 A;  3QX1 A;  2M0A A;  2ZZP B;  1WXA A;  3RNF C;  2D2Q A;  3P2B A;  2KMA A;  2B3A A;  3X23 A;  1K52 A;  1FFV A;  1TY2 A;  1QOG A;  5HG2 A;  2PLP A;  1FNU A;  3PGE A;  1V1O A;  3ONS A;  3VH3 B;  1G0W A;  2QIE B;  2IZV B;  5E6P A;  2LGS A;  3I63 C;  2WDV B;  4GMV A;  3JSV A;  4MSM B;  4REZ A;  3VH4 B;  2E6X A;  4JWU C;  3EFC A;  1F2R C;  2WXM A;  2K0P A;  4M01 A;  5TSS A;  3TEY A;  2BVC A;  5LXH A;  4RM9 A;  4ZHO A;  1R8G A;  3TBL D;  3Q6B A;  1JCK B;  2GBK A;  4NPN A;  4YSX B;  3KQ4 A;  3RUL A;  4A9A A;  2MBQ A;  2NMQ A;  3BY4 B;  2K5P A;  1ENF A;  3RD2 A;  2MEK A;  5IKC M;  1V6E A;  4OVZ A;  3BYY B;  1P50 A;  1FM0 D;  4G11 A;  4DXA B;  1C76 A;  4MM3 B;  4Q2J A;  1JRP A;  1NI2 A;  3L13 A;  2WXI A;  2JF5 A;  1EF5 A;  2FAZ A;  3HHM A;  4DHJ B;  2K8H A;  1Q10 A;  2PPH A;  1HXY D;  4II3 B;  4FN2 A;  2KO3 A;  3AE9 B;  2KDB A;  2LRW A;  2KAN A;  2AX5 A;  3ZVV A;  1SD0 A;  1RYJ A;  1I4P A;  5D2M B;  3E9S A;  2AQ1 B;  2JWZ A;  3R3M A;  3AMZ A;  2WDT B;  2FIF A;  3Q3N C;  4XX5 A;  4XDC A;  4R3D A;  5G5G A;  1WGH A;  4DQO C;  5BMH A;  4LCD E;  1MPE A;  1NEN B;  3FIL A;  2MJE A;  1QOF A;  2KDE B;  2WXL A;  4K3C A;  1F9J A;  1X1M A;  1WGY A;  1T6B X;  2QSD A;  4N9F 4;  4DDG D;  1OEY A;  3QIJ A;  4LJP B;  1I42 A;  3OAW A;  2K8C A;  3N1Y C;  2BYV E;  3GB1 A;  3M63 B;  1JRU A;  3I5J C;  4G50 A;  2KJR A;  1D5M C;  2ASQ A;  2NTT A;  4ZHP A;  2BWE S;  1V2Y A;  4BKS A;  4NZL B;  1SE9 A;  1YN5 A;  1PGB A;  1VRA B;  2JQR B;  1T3Q A;  2JYT A;  2MCN B;  3MFG A;  5G2N A;  3GZN I;  1EM7 A;  3K9P B;  1ZW7 A;  4HLE A;  4W9F A;  1E7U A;  3U30 A;  3B6R A;  3ZO5 B;  3N3K B;  1ZKH A;  4OZB A;  2R2Q A;  3Q8C A;  1XT9 B;  1Y8R C;  4BKT A;  2N1V A;  3NG0 A;  1WR6 E;  2JWU A;  2IO2 B;  2I1K A;  2PJH A;  3PSE B;  3EC8 A;  4HCN B;  1V5O A;  1C4P A;  5LLI A;  4RM8 A;  2KK8 A;  1SE4 A;  3GS2 A;  1V8C A;  2N9E B;  2ZNV B;  5IA7 A;  2LEK A;  1D4B A;  3AI5 A;  3EUB 2;  3QA8 A;  5FR3 A;  4IM2 A;  1YJ1 A;  3RUI B;  1SIJ A;  2GWC A;  2J4X A;  2GBN A;  3BK2 A;  1GUA B;  1ESF A;  3KVF B;  4JLC A;  1HTO A;  3ZNI D;  2DYO A;  4DXG A;  2NPT A;  2DNF A;  3L54 A;  2H88 B;  1I35 A;  2KFK B;  3PZD A;  2BB5 A;  3FC4 A;  2HTM E;  2N1W A;  2NBV B;  3VUX A;  5L95 C;  3Q8B A;  1DOX A;  1SJE D;  3KW5 B;  2MBE A;  3KWV A;  4LK0 M;  2D3B A;  2LFI A;  1C4A A;  3BVG A;  1T0Q C;  3QWZ B;  2N4F A;  1KLU D;  3AB5 A;  1JQ4 A;  1M94 A;  5CHV C;  2N0S B;  2CS4 A;  4LDT B;  3R2T A;  4DDI D;  2IO0 B;  4OZC A;  4ZRJ A;  1K51 A;  3DWM A;  1H4R A;  2JSV X;  1NVI D;  1MG8 A;  2MX2 A;  3H7P B;  2KQS A;  4HDQ A;  2J52 A;  1TT4 A;  4BOZ B;  2LXC A;  2KN4 A;  5E6N A;  3P4R B;  4I6P A;  3DQV A;  3EFU A;  4OVU A;  4ANX A;  2V4I B;  4N59 A;  2UU7 A;  4WWO A;  2OOB B;  1QIL A;  5JXV A;  2OED A;  3PHW B;  2D11 A;  3R2I A;  3RFZ B;  1TTN A;  2LGX A;  4X57 B;  3L10 B;  4MGI E;  2ZW1 A;  4GW0 A;  1ZDX A;  3B2F A;  5JHB A;  3N1Z C;  2W82 A;  3Q3M C;  4IC7 B;  4BHL A;  1RRB A;  1TZ1 A;  3A9J A;  1QOB A;  4RGN A;  3WAO A;  2LHD A;  2KZR A;  1RL9 A;  2G3Q B;  2VH1 A;  3OJ3 A;  2JY6 A;  3PVL A;  3DVG Y;  1FRR A;  1Y56 A;  4LNF A;  3TEZ A;  1N6Z A;  2J42 A;  2ONQ A;  3DBR I;  4TV3 A;  3B0A A;  1SE3 A;  4FUL A;  4AWJ A;  3ZRF A;  4MGZ E;  2PKO A;  3ZTC A;  1HZ5 A;  2MP2 B;  3V61 A;  2DHZ A;  2DZK A;  2ZPY A;  4PS8 A;  3V3X A;  1QK1 A;  2QC8 A;  1P0R A;  2D3C A;  3B2G A;  4I6N B;  4IDI A;  3MTN B;  2MJ3 A;  4B95 A;  1LFD A;  3K9O B;  3DPD A;  3ZJU A;  2FE8 A;  2QHO A;  1WY8 A;  4EUT A;  4RFB A;  1VZ8 A;  3CST A;  2J0M A;  3ZJV A;  1ZE3 D;  2IY0 B;  4K3B A;  5FK9 C;  1JWU D;  1TS3 A;  4GW2 A;  2O6V A;  4AUQ C;  4BZA A;  4C56 C;  1HA5 A;  4ACF A;  1KLV A;  3JU5 A;  2WXP A;  2KJ6 A;  1PGX A;  1DYQ A;  2KTF A;  4JX1 C;  1SXT A;  4B9K A;  4ITK A;  5C23 A;  3H1U A;  1P7E A;  4DK5 A;  2ZJD A;  2HE7 A;  4DXF A;  3SFD B;  4NQL B;  3ZLZ A;  3JVZ X;  2JXX A;  2DZI A;  3T3O A;  1E7V A;  3C0R B;  1SB3 C;  2GMI C;  2REX A;  3RPF C;  1FNV A;  4WUR A;  4EZK A;  2CJN A;  4LNK A;  2IYD B;  2JXT A;  2FBW B;  1P1A A;  3AE7 B;  1PDX A;  3VTV A;  2VH2 A;  5BYR A;  4A3P A;  1F2R I;  5DPS A;  2ZW0 A;  3P63 A;  4YSZ B;  4N58 A;  5H92 C;  2WDR B;  2FUG 1;  4IOI E;  3AE2 B;  1BG0 A;  1B9R A;  5CTR C;  2MBB B;  3AU5 A;  3VFK A;  2EEL A;  1E5W A;  3V62 A;  1QOA A;  4FXC A;  1WM3 A;  4US9 A;  5D6J B;  3HUI A;  2SAK A;  1XO3 A;  3BIN A;  4IM0 A;  2BF8 B;  1JWA D;  1WF9 A;  1DOI A;  2D07 B;  3NRZ A;  2RGF A;  3NVY A;  4YWG G;  2WXQ A;  2CKH B;  1PGA A;  5J9A A;  3RMK C;  2RR9 A;  4ZYN A;  3E56 A;  1P7F A;  1ISN A;  4KKJ A;  2KX0 A;  4K81 A;  1GJZ A;  2D10 A;  2L83 A;  4W9C A;  3SEB A;  3TSS A;  1R4N I;  2I1J A;  1P52 A;  1UBQ A;  4OHJ A;  4FBJ B;  1WGK A;  1XLO A;  3VUW A;  2M0X A;  1IBX B;  4JWS C;  1UGM A;  2W3R A;  2LJI A;  3ZKJ C;  1AW7 A;  2N9L A;  4ARI A;  4PYU A;  2J1Q A;  3AXC A;  5CX3 A;  4GVY A;  2JRI B;  4EOY A;  1EU3 A;  2JU6 X;  2BPS A;  4IM3 A;  2N9P C;  3IAS 1;  3KLS X;  2SEB D;  3T8M A;  4MDK E;  2XK5 A;  2LWP A;  3SHQ A;  4MT5 A;  4MJS B;  2WXR A;  4KSL C;  2KDF B;  1Z5S B;  2NCN A;  4OW0 A;  2C5L C;  3T3N A;  1ZGU B;  1J0G A;  5JZE B;  1VCB A;  3HK0 A;  4LNO A;  1IUE A;  2H89 B;  1WRI A;  4N6E B;  3TIX A; 
#chains in the Genus database with same CATH homology
 1RL9 A;  4LNI A;  1M15 A;  4Z9M A;  3ZXR A;  3NG0 A;  1CRK A;  4RF6 A;  3M10 A;  4GVZ A;  1BG0 A;  4ACF A;  4BHL A;  4HPP A;  3JU5 A;  1G0W A;  2UU7 A;  5J9A A;  4BG4 B;  4BAX A;  3JPZ A;  1VRP A;  1HTO A;  5J99 A;  2CRK A;  3ZXV A;  3L2E A;  2LGS A;  1LGR A;  1F52 A;  4LNF A;  1HTQ A;  1F1H A;  3DRB A;  4LNK A;  2GLS A;  1I0E A;  1U6R A;  4XYC A;  3B6R A;  3JU6 A;  4AM1 A;  4BG4 A;  4GW0 A;  2WHI A;  2D3B A;  2J1Q A;  3FKY A;  3L2D A;  2WGS A;  4GVY A;  2OJW A;  3L2E B;  4RF7 A;  4S17 A;  1P50 A;  4LNO A;  1QH4 A;  3DRE A;  1SD0 A;  1FPY A;  4GW2 A;  4S0R A;  1P52 A;  4Q2R A;  4RF9 A;  4LNN A;  1QK1 A;  3JQ3 A;  2QC8 A;  4RF8 A;  2BVC A;  2D3C A;  2D3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...