1HTOA

Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE
total genus 149
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htoA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htoA01
4LNIA 1G0WA 3JPZA 1RL9A 3ZXVA 2LGSA 1SD0A 4BG4B 4BAXA 3NG0A 1HTOA 3DREA 4GVYA 1BG0A 5J99A 4HPPA 5J9AA 3FKYA 4AM1A 4LNFA 4S17A 2UU7A 2QC8A 3DRBA 4XYCA 1HTQA 1I0EA 4RF8A 4GW2A 4BG4A 1CRKA 2CRKA 3JQ3A 1VRPA 1FPYA 4RF6A 4Z9MA 1P50A 2WGSA 3JU5A 3L2DA 4Q2RA 1M15A 1LGRA 4LNOA 1F1HA 3M10A 1P52A 3L2EA 2D3AA 2BVCA 4GW0A 2J1QA 1F52A 3JU6A 4LNKA 3L2EB 2OJWA 1QK1A 4ACFA 4RF9A 3B6RA 1U6RA 4GVZA 2D3CA 4RF7A 1QH4A 2GLSA 4BHLA 4LNNA 2D3BA 2WHIA 4S0RA 3ZXRA
chains in the Genus database with same CATH superfamily
1UWXA 3IHPC 1WZ3A 2L32A 3LXFA 3ZKJC 3HUIA 2DLBA 4K7UA 3FKYA 3AE9B 1Q5WB 3VAWA 1IPGA 3K9PB 2KMCA 1GG3A 3AXCA 3SFEB 1M15A 2NTTA 5DPRA 2WDTB 1XLNA 4B0MA 4JGHB 4KDIC 1L7YA 1L2NA 3PGEA 1S3SG 2LUMA 1XCTL 1K53A 1HEZE 2LASA 1WIAA 3TIXA 2KJRA 1VJKA 4CHKA 1WM3A 3JYUA 2IGHA 4MACA 2D33A 2WNMA 1CRKA 2HDEA 5BMIA 4OZBA 4WWMA 1I7HA 4A8XC 3GZNI 1JWAD 4HRSA 3AE3B 4TSSA 5JXVA 4HKQA 3PZ7A 3KYDD 1G0WA 1WXSA 1SSNA 2CJNA 1R4NI 4NPNA 3CMMB 3O13A 3ZIMA 3SDLC 1GNUA 3SEBA 3BIID 2DZIA 3P4RB 4IM2A 4ANWA 3DVGY 2K1FA 2WHIA 2SAKA 3P63A 3QK0A 1L0YB 2KJ6A 1WH3A 4OVUA 4IC7B 1L4DB 3BWUD 3GP7A 2K8BA 3P4QB 4MGZE 1SIFA 3PVLA 3UF8A 1V81A 1VZ8A 2Y5BB 4ARIA 3S2AA 3A9KA 2KTRA 4YSYB 5JZEB 3ML8A 3PT2B 3ONSA 1T0RC 2DWQA 1WYWB 1GJZA 4KGRA 1JRPA 4HKZE 3WALA 4R3DA 2D3GA 1TJEA 5D3DA 1XLQA 4D2KA 2C7MB 1F2RC 4YTNB 4W9KA 1X1MA 4KDLB 3BZDB 3PRPB 4BAXA 2BYEA 1XCQL 3C8YA 3PREA 3R2TA 3V3XA 1QF6A 1IGCA 1OTRB 3APFA 4MT5A 5DCNA 4ANVA 2FCNA 4LNFA 4K7SA 3RZWC 2DYOA 3LN6A 1WGYA 1N61A 2K6DB 4ITKA 2N7JA 1YJJA 1JMLA 3H7PA 4I6NB 2CKHB 4IDIA 2WP9B 4MJSB 1J19A 4WH4A 1UNSA 4L23A 3PS6A 3W5VB 2Z0DB 3DPDA 3OG5A 2G4SA 1IGDA 2V3NA 4GMVA 3HM6X 4KIKA 1FXAA 3FILA 5HKHA 2INPE 4DBGA 1A5RA 2WXMA 2KMMA 5C2TB 1BT0A 1LFDA 2MP2B 4XE0A 4K3CA 2PE9A 1AW7A 4P6VF 4W9LA 3LYYA 3VHTC 5CHFA 1WX8A 3HK0A 1D4BA 3AECB 2JYTA 1KM7A 2LHDA 3KUDB 2LGSA 1C4PA 2DZJA 2ZVNA 2O6VD 3RD2A 1C77A 4M8MA 5D7GA 4MSMB 4HCNB 1VZ6A 4M8NA 3M3JA 3DOWA 2FUHB 1D6EC 3EHVA 3AN1A 3TCAA 4W9IA 2WXQA 3M63B 3FILB 3L16A 3HIZA 2W3RA 1UUPA 4KGTA 1IYFA 1WYGA 3KYCD 2R2QA 4EOYA 3BK1A 3U4EG 3TJPA 1TY0A 4AS1A 1L0VB 1I0EA 1YNTE 1J7BA 2KFKB 4I6LB 2GOWA 1B9RA 2D5GA 5MPOA 4TV3A 2GB1A 3TEYA 2J1QA 1QZEA 2JY6A 4RF7A 1TYGB 2K8CA 3VQIA 1GC6A 3KWVA 3BVZA 2DENB 3CIRB 2WXLA 1OQQA 2KN5A 2BS4B 4MDKE 2PKOA 3WAPA 2J52A 2KDIA 1UD7A 3EC8A 3ZJUA 1E8YA 1FFVA 2IGGA 1HE8A 4FJYA 1RWSA 2EELA 1PQSA 2MW5A 3U30A 2ZEQA 2MCNB 2M56B 1OEYJ 2N1WA 3DVNU 4W9HA 3LJ3A 5AZGA 4EZKA 3DBSA 3BVGA 4XGAB 5EE1A 2JWZA 3N1XC 3RNGC 1TKEA 3HVDA 3IG3A 4PS3A 1KJTA 1R4MI 2CR5A 3VTVA 4GW0A 2KD0A 3R7RA 3V62A 4MEMA 3OJ4B 4IM0A 2QMTA 1EM7A 3Q3OC 3W1SA 2WDRB 3HHMA 4WJNA 2IO1B 1JWUD 1K50A 1TGZB 3BYTB 2LGXA 4TQ0A 1C1YB 5D6JB 2KTFA 3PZDA 4FULA 2K9XA 3N3KB 4C56C 4PYUA 2LRUA 5L83A 2YVCA 4BHLA 5T8IA 3VRAB 4PT5A 2CHWA 4CQNA 3Q2AC 2KANA 1WE6A 4OHJA 2KWDA 3DVGX 1EF5A 4E71A 1A70A 4RCOA 4A6QA 2BKFA 1Q10A 3SFDB 1WJ4A 1QOGA 2E3TA 4AJYB 4NZLB 3SD5A 1PGBA 1CZPA 2JT4B 3AE6B 5AUKA 2WXJA 1E7VA 2Z8LA 3VDZA 4HJGE 1S1QB 4J6IA 1KFYB 1N63A 1SB3C 4DWFA 4CO7A 2O2VA 1V1OA 3VH3B 1LXDA 3Q8BA 1V86A 4II2B 4ZHPA 1E90A 3ZW3A 2NPTA 3IXSA 2FBWB 3ZDMC 2M17A 2HE7A 4PS8A 3DQVA 2AL3A 2INNE 3ABVB 5FK9C 3U7DA 4AUQC 2XN9C 1GUAB 2IO2B 2L8JA 2H89B 3RNAC 1V4GA 4C7YA 5D3IB 4RF0A 1QT9A 2I38A 3RPFC 2XK5A 3W9CB 1EUVB 3B2FA 2LGDA 3ZXRA 2GI9A 4MH8A 3LVWA 4GDLA 4I6PA 2HD5B 2WXGA 4DHZB 2VH2A 3RFZB 4BKTA 4LDTB 2JUOA 1ACCA 3URYA 2L76A 2HTHA 3M10A 1R8GA 2O2VB 3L17A 2I2YA 4F8CB 3PRMB 2KC2A 2VZKD 2JQRB 3UGBB 1E0ZA 3R8BA 1N62A 2FAZA 4EZJA 3EFUA 1YQBA 4RF8A 3TEXA 3NUHB 5HFYA 2WGSA 1T0QC 4OW0A 1SE2A 4G11A 2LVPA 1FNVA 3JU6A 4WAFA 1UBQA 2XK5B 3MC0B 5BO4B 1T3QA 1ZPSA 2KOXA 1SJED 4K81A 3WAOA 1R4NB 2MQJA 3A1QB 3TUOA 2BWFA 1YOVB 3ML9A 2V4IB 2PE6B 3NHEB 1YQ4B 2OOBB 3L54A 3JU5A 2LXAA 1K8RB 3ZTCA 2IO3B 1P52A 2B3AA 1C79A 2PJHA 3A9KB 2NS5A 1HXYD 1WXMA 2KVRA 2BYFA 2FNJB 4OZAA 2JZ3B 2PMVA 4A55A 1I4HA 4NJ6A 2NCNA 3ZNGC 1TKGA 3SR6A 1GC7A 2AQ1B 4O1NA 2J53A 4GDLB 1XLPA 2JU6X 1C9FA 2KDFB 4FXCA 2DAJA 2FIDA 2NTSA 3PTFC 2YEPB 2K0PA 2KDMA 4GLSC 2KX0A 3HRDD 3L13A 2BVCA 3MP9A 5L95C 1I4PA 1I4GA 3RT3B 3UINB 5IOIA 4W9JA 1OFFA 2M0XA 4E3CA 1OQRA 3AE5B 2O6VB 2R61A 4HXDA 1WXVA 3O65B 4BFRA 1MG4A 4WJPA 4HWIB 3A9JA 4L1BA 2KACA 2BKRB 3KVFB 4KIKB 2BT6A 5HHDG 4JLCA 2JZPA 5G2NA 3AI5A 3LB8C 4DDID 1FRRA 1WMHA 2WXOA 1J7AA 2L1AA 1V49A 3BINA 1G6JA 1TT4A 2V3SA 1YX6B 2LVQA 1XQQA 3QIJA 4NJCA 1FCCC 1XF5L 5EE9A 3Q8AA 1EU4A 2KQSA 2ZCCA 4ICUA 2DYBA 4LNNA 4WAAA 1LO5D 4KGSA 1P3QU 4GSWA 1ZP0B 1TBEA 2C9WB 2WXNA 4F1SA 3IVFA 2LWPA 3P2BA 3JSVA 4K3BA 4BOZB 1L5PA 2CRKA 1FD6A 2ON8A 4B6WA 5KHOA 1KRHA 4XDCA 3QQ8B 3ZJVA 2V3PA 3Q3FA 1WXQA 1NYRA 4YWGG 3RMKC 3TSSA 4BKSD 1LQBA 4LDTD 2N7EA 2C7NB 2CHXA 2JRHA 2REXA 2WS3B 2J4XA 2MA9B 1PUTA 2FCMA 2NPTB 4KKIA 1FNWA 3VXWA 1BXTA 3DWGC 1RFKA 2N7DA 3HM3A 4BBNC 4FHKA 3AH7A 3CWIA 5E6PA 4QAYA 2LI5A 3OWEB 2GBJA 3WAMA 3NZUA 2ZW0A 3KUCB 3Q8FA 1WI0A 2WYQA 4IUMB 4US9A 3QHTA 3W1YA 3AULA 4GDKB 2N9XA 2LFIA 1LM8B 2LGYA 1WJNA 1UH6A 2ZVOA 4GXBA 3DBLB 1BMLC 4AJWA 3TBLD 3AE7B 4JPSA 1WRIA 1V80A 2PVOD 1ZGUB 2WXPA 3AE4B 2DNFA 3NRZA 3V61A 5LXIB 1WWTA 5EE3A 1UGMA 2N9KA 1R7SA 1P9DU 5BYQA 3AB5A 1I4XA 5IA7A 4HPPA 1DYQA 4ANUA 5E6JA 3B2GA 1CMXB 2N4FA 1WMHB 4YSZB 3IG5A 2MHJA 2BF8B 2L7RA 4HEA1 2GBMA 1N5XA 1YX5B 1H8CA 4A3PA 2QSDA 3OLMD 1KOTA 2WXFA 2W55A 1I42A 2GBKA 3U7ZA 1Y8RC 2WXKA 3ETRA 3X23A 3AEBB 3V6CB 2OEDA 1I4RA 3UI3A 3KH0A 1NVID 4IW0A 1ET9A 4HCPB 5BYRA 4TMAB 4HVBA 2W82A 1V2YA 2M0AA 1WXAA 2AYOB 3P4SB 1KLUD 1UF0A 2LJIA 3WANA 3AE1B 5G5GA 3B0AA 2DHZA 3PPAA 3DRBA 2KFJA 3ZLZA 3DVNV 1WJUA 1QLBB 3AE2B 5JH5C 2H88B 1VDVA 1L6UA 3VR8B 4M01A 5JHBA 4KX6B 3W5UB 3L4PA 4N59A 1D5XC 3IG8A 1N6ZA 3NOBA 3EUB2 1TZ1A 2V4LA 2RPQA 1K51A 2AQ3B 2BB5A 2MBEA 2LGIA 5FKAC 4JWSC 1MI0A 1TT5B 2FIFA 2RSUA 4OVZA 3RUIB 2HTME 3Q3JA 3T3NA 1BG0A 2X38A 3HVZA 4YTMB 4JIOU 4RNAA 1C4AA 1RYJA 3GOEA 2KWUB 2JSVX 2M8SA 3AU5A 4HDOA 1WGDA 3DHGC 4WWNA 3QCAA 3H6NA 5JHAA 4KSLC 3PLVA 3JPZA 2RDGA 3V6EB 2M4NA 4M0WB 4K1RB 1WE7A 1E9MA 1L6VA 3IAM1 1MG8A 4BG4A 1EWYC 3Q3NC 1Z5SB 4ZRIA 1YMHE 2VRRB 2DX5B 2MBQA 2NBWB 2QDFA 3VUYA 5GMVA 2XEWA 3X0WA 2ONQA 1V8CA 3GS2A 2CJOA 1Q1OA 2DYMA 3U52E 1ZW7A 4KV2A 1F9JA 2LD9A 2L05A 4MM3A 4ZOHC 1VRPA 5DPWA 1UBIA 2D32A 2GMIC 2LZ6A 2KVZA 1ZKHA 1C4CA 1XT9B 2PVGC 3MFGA 2KMAA 5CHVC 2KHWB 3LDZE 1YIWA 3AEEB 2L00B 4FBJB 2Q5WD 3GB1A 2IJ0A 2FCSA 2FUG1 1WRDB 1I4QA 1YD8U 2CU1A 1TTNA 3JSVB 1HTQA 1P1AA 1VLBA 4DXGA 2EMSA 1GB4A 3ZRFA 4WQOB 1CJEA 3NJTA 2V0GA 1E6EB 4A3OA 1FNUA 2IDYA 2D3BA 2HJ1A 1H4RA 1P7EA 3ZQ4A 1C78A 4AQ7A 3NG0A 4TQ1A 5J99A 4W9CA 2JRIB 2LRWA 3NY5A 3T8MA 1TS5A 2XBBC 3JQ3A 3IT6B 4Z9MA 4YTPB 3BY4B 2QHOA 4A90A 3E56A 2JX5A 2KC1A 3CF6E 2LJ5A 2J0JA 1QK1A 1T0SC 2EKIA 2B76B 4GIVA 4FHJA 4KVGB 4RGMA 2JWUA 3RCZA 1HTOA 2L0FA 4ZRQA 1Y56A 3U2SC 1E8XA 4G50A 4JE3B 4W9EA 4LJOB 3AU4A 4E74A 4EFOA 4RGTA 3VFKA 3Q6BA 2QEJC 3PZ8A 2GWCA 2WDQB 5BMHA 3I3TB 3SU8X 2NVUI 2NR2A 5C23A 4C7ZA 1I35A 4F7ZA 3PO0A 2QIEB 1YQ3B 4WJQA 5FR3A 1MPEA 2L0TA 2EKEC 1AWDA 2GWDA 4UDUC 3EGRA 2BYTA 1RAXA 3A1QA 1YJ1A 4BZAA 2NBVB 3UIOB 2KLCA 1NENB 3BYYB 1QKZA 1JWMD 4K7WA 3I5JC 4MGIE 2D2QA 2J7QB 2N9LA 3QJZA 3K9OB 1DOXA 2IYDB 4BG4B 4N9F4 2M1MA 3JVZX 3J9CA 2WU2B 4AOFA 4XZ4A 5C3JB 3A33B 5LNK1 2IGDA 3Q14C 2Z0EB 1GPXA 1DOIA 4HPMB 2NMQA 3ZYYX 3A4RA 3VUXA 2K39A 1FEHA 2UYZB 1SEBD 2MSED 3C0RB 2ZPNA 2GRIA 3ALBA 3B6RA 5TR5A 3DHIC 3N32A 3IT4B 3AEDB 4C00A 3Q3MC 3CSFA 1NI3A 4IM3A 1XXGA 2CHZA 2E6XA 2KZRA 4W9DA 2C5LC 1MJDA 2KO3A 2MLBA 3VRBB 1YN3A 2INDC 3ZUNA 1JW9D 3BVMA 3QARA 2QJLA 1ESFA 3KW5B 4DK5A 2HJ8A 2BBCA 1CK1A 3MC9A 1B1ZA 2BQQA 4ZRPA 4DHJD 4MJSA 4L2YA 3LN7A 3DBRB 2PEAA 1VRAB 4EZLA 1F1HA 2PLPA 4HPLB 3D32A 1UELA 4NAWB 3L2EB 2K3UA 4YL8A 2KT7A 3OAWA 4XC2A 1K52A 2LUEA 4TKNA 1M94A 3AMZA 3OJ3A 4RH6A 1FRDA 2JYEA 4BBNF 4ARCA 1MFWA 1FIQA 1SE4A 1QOAA 1P50A 1OEYA 1P98A 4X57B 2QILA 2AEHA 1LGRA 2Y5CA 4P16A 3ZNZB 3H8HA 4ICVA 3DBHB 1WGKA 1FM0D 2A4ZA 4MH0E 1OQYA 2KNBA 1L0XB 4RFBA 3B08A 1GB1A 2MX2A 2ICIA 1NI2A 2G1EA 4AM1A 2K25A 2D11A 2W9NA 1R4MB 3M62B 2J42A 2MBBB 2KYWA 4ZDVA 1HZ6A 4GVZA 3NZTA 1E8ZA 4XDDA 1V9JA 1YN5A 3QA8A 2JVCA 1QOBA 1ZOYB 4RF1A 4MM3B 3WA0A 3P4PB 1XO3A 4WQMA 1FPYA 3R66C 2AX5A 1UGJA 4W9FA 1V6EA 4BKGA 3I9V1 1BUIC 1TY2A 4CYEA 4ZHOA 3KWLA 1WM2A 2V9HA 2LMCA 4EKUA 3DBRI 2EMTA 2N9PC 1HA5A 1JCKB 2QC8A 2SEBD 3NS8A 2MJDA 2JZZA 2RR9A 2O6VA 4WWPA 4M0WA 3MTNB 3V60A 2WWZA 2AQ2B 1AN8A 4RM8A 4J3OD 1ZDVA 3EA6A 1U6RA 1EU3A 1QH4A 3NVYA 3W2DA 3NZSA 2KAJA 5G55A 5J9AA 1MHXA 3APDA 2UU7A 4JX1C 2AL6A 2L52A 2MP2A 3AM9A 3WIMA 5AEKB 3ZNID 2JPHA 3R3MA 4LJPB 3UQBA 4HJKA 1F0ZA 4NNJB 3I57A 4DQOC 4B95A 2ZW1A 2CS4A 5HG2A 1WGHA 3NS1A 5TSSA 2BGFA 4MGKE 5AZFA 2G4DB 4KZ0A 2L3ZA 1N5WA 2MBHA 4WJOA 2ZCBA 1FO4A 1IP9A 3QC8B 4G3XB 3ZGZA 1F2RI 1U4AA 3PRZA 1WX9A 3DHHC 1KLGD 1SBBB 2IBIB 3ENEA 4HROA 4KSKC 5DPSA 5IAAC 2RMMA 2KN4A 4LNOA 4FLHA 3RNBC 1KF6B 1EF1A 5E6NA 5EDSA 4B9KA 1SXTA 1J7CA 4ZYNA 2K6QA 2W3SA 3PLUA 4RMAA 1RM6C 2KDBA 1SE9A 2INCC 1WFYA 4PS7A 1WR6E 3PHWB 1J0GA 3IAS1 3UIPB 4LK0M 1EO6A 2PIAA 2FE8A 3IFWB 2DAFA 1DGJA 2WLBA 4NY0A 1ENFA 2OJWA 4EE2A 3ZVVA 5H8YE 1JQ4A 1T0YA 1RL9A 2CU3A 4AWJA 2DZMA 4JWUC 1E5WA 1JALA 3H7SA 4A9AA 2YEPF 1WGGA 1PGAA 2ACZB 3M95A 1TKYA 2MWSB 4N58A 4GOCA 2WX1A 3RNFC 4PK1A 5FR6A 1QQRA 4FJZA 3C19A 4BOSC 4BKSA 1MHHE 2A5UA 3R7QA 4NQLB 4WWOA 2WQYB 3NVVA 5D2MB 3CSTA 3GE3C 3L2EA 2Y5PA 4XWWA 1F77A 2ASQA 3NVWA 2ZJDA 3W1SC 4US8A 4KKJA 2BS2B 4JQWC 5AUIA 1ROEA 3MC8A 3ECIA 2RDHA 1HQRD 2KQ4X 1WR1A 1SGHA 1VA6A 1QILA 3KUZA 2KXJA 3GE8C 1ISNA 2RD0A 3DCGA 4MELA 2UWQA 5D94A 4DDGD 3ZNHB 2G9HD 3QAQA 1D5ZC 1ZXHA 2JXTA 1DOYA 4C80A 1E8WA 4GGQA 1P0RA 2WX0A 3T9LA 1IBXB 4TUUA 2MBOA 3TMPB 5IP4D 1V1PB 3TL5A 2RPVA 1D3ZA 4FADA 4DXAB 1FXIA 1D5MC 4OVVA 2IO0B 3MHZA 4YT0B 4GN1A 2N0SB 4G0NB 4NAMA 2M19A 1VR9A 1GOZA 2L83A 1JWBD 3QWZB 2DZKA 4EEWA 4NAWA 3ZDTA 4ASWC 3MJWA 3RN9C 1HZ5A 1PGXA 2BS3B 4GB9A 4GW2A 3NVZA 2GBNA 2PTLA 4C4VA 2RGFA 1WJ6A 4LNKA 3VH4B 2K22A 1WSPA 4B0EA 3B1LX 4JL9A 3UQAA 3DBHI 3H7PB 3BK2A 4N6EB 4IWQA 1AYFA 2IY0B 2VH1A 3NZ3A 4HDQA 3DDCB 1JRUA 4FA6A 1YJIA 2Y3AA 4ZRKA 4Q2RA 3N20C 4W9GA 2WXRA 4MSQB 4ACFA 1E7PB 3EFCA 2WXIA 3RNCC 5LLIA 4P1CC 2AWTA 1SJHD 2WXHA 2KDEB 1RLFA 2KLGA 2KJHB 4FN2A 3AEGB 1L4ZB 3APCA 1WX7A 1XLOA 2ZNVC 4IWOA 1V5OA 3VUWA 3T3OA 3FAHA 4IG7B 2JXXA 4RGNA 3AV8A 1M4VA 4FJVB 5H92C 2ZPYA 2MEKA 2D10A 4S17A 4XYCA 1Z2MA 2OJRA 3VTUA 2LEKA 4RF6A 5DPTA 5IN7A 3ZRCA 1RRBA 4WURA 2D3AA 1WF9A 4M02A 1Q0WB 2J0KA 2MH7A 1T5XD 2GLSA 3DBLI 1JROA 4GDKA 1TZOA 1FXTB 1WZ0A 1SD0A 2XNAC 4REZA 1PDXA 1ZUD2 1MVKA 3JW0X 5AZHA 4LTUA 2KKCA 1JWSD 4P1BC 1KLVA 2MJ3A 3H9DA 2PPHA 4LLGM 2Z59B 3KLSX 4A20A 2GBRA 4RF9A 1KTKA 3VVWB 1T6BX 4LNIA 3N9YC 3ZXVA 1WY8A 1NBFC 1V97A 3KQ4A 3WCQA 2WDVB 1TS4A 1P7FA 2K8HA 4IKGA 1C3TA 2G3QB 3L0WB 3RNEC 3Q69A 2KQ7A 3PHXB 4ZYSA 4XX5A 2KFKA 2X8XX 1V1PA 2D07B 1F52A 2NBUA 1QOFA 2LVOA 2OHFA 2D3CA 4ZRJA 2MRPA 1SF0A 5CTRC 4P7IA 1ET6A 2BWES 4MGYE 5C1ZA 1EWCA 5G5HA 1SE3A 1NYQA 5IKCM 3N1YC 1FCLA 1RFAA 1TS2A 2I1KA 5GXGB 3L2DA 1WGRA 2KX3A 4RGOS 2TSSA 2ZZPB 1J8CA 1TS3A 3DWMA 3QX1A 4XWTA 3RI7C 5KHQA 3H1UA 2W54A 3I63C 1GAQB 3AEFB 1ZE3D 4DXFA 5J2RA 3DREA 4GVYA 1V5TA 3Q8EA 2N9EB 2I1JA 1XEEA 4YXDB 1E10A 4PYZA 2YLMA 2R2OA 2KWCA 4DHJB 1ZDXA 2IZVB 3Q8CA 5I4DA 4NQKE 4AP4C 3ZJTA 3P42A 1OGWA 1ZXIA 2BYVE 4S0RA 3L10B 3PV1A 2LHEA 2C7HA 2BPSA 3B9JA 5BMGA 5J17A 3MJ5A 4KZCA 4OZCA 4WIPA 4M00A 5CX3A 2N1VA 1UZXB 3RZFA 1SIJA 4RM9A 4II3B 5LXHA 5J18A 1YN4A 1CQVA 1STEA 1NEKB 2VZKB 5BYSA 1KH0A 3A4SC 3AE8B 2LXCA 2KK8A 5HI1A 2IPKD 2DBYA 2RDBC 4LCDE 3V05A 3MHSD 3AEAB 4C4VB 4Q2JA 3PSEB 5IO9A 1TIFA 1UWMA 5E6OA 1E7UA 1FMAD 3A9JB 4HLEA 4BVUC 2K5PA 3SHQA 3P1MA 2WU5B 3N1ZC 4URKA 3LVVA 2C60A 3GZNB 3VR9B 2KTRB 2J0MA 4YSXB 2FCQA 4HK2A 1IUEA 3ZO5B 3L08A 1AARA 5CHWA 2ZNVB 4GU2A 4H2AA 2BTEA 1IBXA 1N60A 4IWPA 3RULA 4EUTA 2MJEA 2BB6A 1FFUA 4NJ7A 3U8ZA 3FC4A 1VD2A 3IBEA 3E9SA 1NDDA 3TEZA 1PFDA 1VCBA 3EECA 3R2IA 1C76A 2QCZA 4ANXA 1XD3B 5EE0A 4IOIE 4DHZE 1PYWD 4USAA 3ZTDA 2G45B 2JF5A 2V1YA 2PW9A 3VTWA 2BW2A 3N30A 3TEWA 2IY1B 1VZ7A 2KWVB 3RYTA
chains in the Genus database with same CATH topology
4LNIA 1G0WA 3JPZA 1RL9A 3ZXVA 2LGSA 1SD0A 4BG4B 4BAXA 3NG0A 1HTOA 3DREA 4GVYA 1BG0A 5J99A 4HPPA 5J9AA 3FKYA 4AM1A 4LNFA 4S17A 2UU7A 2QC8A 3DRBA 4XYCA 1HTQA 1I0EA 4RF8A 4GW2A 4BG4A 1CRKA 2CRKA 3JQ3A 1VRPA 1FPYA 4RF6A 4Z9MA 1P50A 2WGSA 3JU5A 3L2DA 4Q2RA 1M15A 1LGRA 4LNOA 1F1HA 3M10A 1P52A 3L2EA 2D3AA 2BVCA 4GW0A 2J1QA 1F52A 3JU6A 4LNKA 3L2EB 2OJWA 1QK1A 4ACFA 4RF9A 3B6RA 1U6RA 4GVZA 2D3CA 4RF7A 1QH4A 2GLSA 4BHLA 4LNNA 2D3BA 2WHIA 4S0RA 3ZXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNI A;  1G0W A;  3JPZ A;  1RL9 A;  3ZXV A;  2LGS A;  1SD0 A;  4BG4 B;  4BAX A;  3NG0 A;  1HTO A;  3DRE A;  4GVY A;  1BG0 A;  5J99 A;  4HPP A;  5J9A A;  3FKY A;  4AM1 A;  4LNF A;  4S17 A;  2UU7 A;  2QC8 A;  3DRB A;  4XYC A;  1HTQ A;  1I0E A;  4RF8 A;  4GW2 A;  4BG4 A;  1CRK A;  2CRK A;  3JQ3 A;  1VRP A;  1FPY A;  4RF6 A;  4Z9M A;  1P50 A;  2WGS A;  3JU5 A;  3L2D A;  4Q2R A;  1M15 A;  1LGR A;  4LNO A;  1F1H A;  3M10 A;  1P52 A;  3L2E A;  2D3A A;  2BVC A;  4GW0 A;  2J1Q A;  1F52 A;  3JU6 A;  4LNK A;  3L2E B;  2OJW A;  1QK1 A;  4ACF A;  4RF9 A;  3B6R A;  1U6R A;  4GVZ A;  2D3C A;  4RF7 A;  1QH4 A;  2GLS A;  4BHL A;  4LNN A;  2D3B A;  2WHI A;  4S0R A;  3ZXR A; 
#chains in the Genus database with same CATH topology
 1UWX A;  3IHP C;  1WZ3 A;  2L32 A;  3LXF A;  3ZKJ C;  3HUI A;  2DLB A;  4K7U A;  3FKY A;  3AE9 B;  1Q5W B;  3VAW A;  1IPG A;  3K9P B;  2KMC A;  1GG3 A;  3AXC A;  3SFE B;  1M15 A;  2NTT A;  5DPR A;  2WDT B;  1XLN A;  4B0M A;  4JGH B;  4KDI C;  1L7Y A;  1L2N A;  3PGE A;  1S3S G;  2LUM A;  1XCT L;  1K53 A;  1HEZ E;  2LAS A;  1WIA A;  3TIX A;  2KJR A;  1VJK A;  4CHK A;  1WM3 A;  3JYU A;  2IGH A;  4MAC A;  2D33 A;  2WNM A;  1CRK A;  2HDE A;  5BMI A;  4OZB A;  4WWM A;  1I7H A;  4A8X C;  3GZN I;  1JWA D;  4HRS A;  3AE3 B;  4TSS A;  5JXV A;  4HKQ A;  3PZ7 A;  3KYD D;  1G0W A;  1WXS A;  1SSN A;  2CJN A;  1R4N I;  4NPN A;  3CMM B;  3O13 A;  3ZIM A;  3SDL C;  1GNU A;  3SEB A;  3BII D;  2DZI A;  3P4R B;  4IM2 A;  4ANW A;  3DVG Y;  2K1F A;  2WHI A;  2SAK A;  3P63 A;  3QK0 A;  1L0Y B;  2KJ6 A;  1WH3 A;  4OVU A;  4IC7 B;  1L4D B;  3BWU D;  3GP7 A;  2K8B A;  3P4Q B;  4MGZ E;  1SIF A;  3PVL A;  3UF8 A;  1V81 A;  1VZ8 A;  2Y5B B;  4ARI A;  3S2A A;  3A9K A;  2KTR A;  4YSY B;  5JZE B;  3ML8 A;  3PT2 B;  3ONS A;  1T0R C;  2DWQ A;  1WYW B;  1GJZ A;  4KGR A;  1JRP A;  4HKZ E;  3WAL A;  4R3D A;  2D3G A;  1TJE A;  5D3D A;  1XLQ A;  4D2K A;  2C7M B;  1F2R C;  4YTN B;  4W9K A;  1X1M A;  4KDL B;  3BZD B;  3PRP B;  4BAX A;  2BYE A;  1XCQ L;  3C8Y A;  3PRE A;  3R2T A;  3V3X A;  1QF6 A;  1IGC A;  1OTR B;  3APF A;  4MT5 A;  5DCN A;  4ANV A;  2FCN A;  4LNF A;  4K7S A;  3RZW C;  2DYO A;  3LN6 A;  1WGY A;  1N61 A;  2K6D B;  4ITK A;  2N7J A;  1YJJ A;  1JML A;  3H7P A;  4I6N B;  2CKH B;  4IDI A;  2WP9 B;  4MJS B;  1J19 A;  4WH4 A;  1UNS A;  4L23 A;  3PS6 A;  3W5V B;  2Z0D B;  3DPD A;  3OG5 A;  2G4S A;  1IGD A;  2V3N A;  4GMV A;  3HM6 X;  4KIK A;  1FXA A;  3FIL A;  5HKH A;  2INP E;  4DBG A;  1A5R A;  2WXM A;  2KMM A;  5C2T B;  1BT0 A;  1LFD A;  2MP2 B;  4XE0 A;  4K3C A;  2PE9 A;  1AW7 A;  4P6V F;  4W9L A;  3LYY A;  3VHT C;  5CHF A;  1WX8 A;  3HK0 A;  1D4B A;  3AEC B;  2JYT A;  1KM7 A;  2LHD A;  3KUD B;  2LGS A;  1C4P A;  2DZJ A;  2ZVN A;  2O6V D;  3RD2 A;  1C77 A;  4M8M A;  5D7G A;  4MSM B;  4HCN B;  1VZ6 A;  4M8N A;  3M3J A;  3DOW A;  2FUH B;  1D6E C;  3EHV A;  3AN1 A;  3TCA A;  4W9I A;  2WXQ A;  3M63 B;  3FIL B;  3L16 A;  3HIZ A;  2W3R A;  1UUP A;  4KGT A;  1IYF A;  1WYG A;  3KYC D;  2R2Q A;  4EOY A;  3BK1 A;  3U4E G;  3TJP A;  1TY0 A;  4AS1 A;  1L0V B;  1I0E A;  1YNT E;  1J7B A;  2KFK B;  4I6L B;  2GOW A;  1B9R A;  2D5G A;  5MPO A;  4TV3 A;  2GB1 A;  3TEY A;  2J1Q A;  1QZE A;  2JY6 A;  4RF7 A;  1TYG B;  2K8C A;  3VQI A;  1GC6 A;  3KWV A;  3BVZ A;  2DEN B;  3CIR B;  2WXL A;  1OQQ A;  2KN5 A;  2BS4 B;  4MDK E;  2PKO A;  3WAP A;  2J52 A;  2KDI A;  1UD7 A;  3EC8 A;  3ZJU A;  1E8Y A;  1FFV A;  2IGG A;  1HE8 A;  4FJY A;  1RWS A;  2EEL A;  1PQS A;  2MW5 A;  3U30 A;  2ZEQ A;  2MCN B;  2M56 B;  1OEY J;  2N1W A;  3DVN U;  4W9H A;  3LJ3 A;  5AZG A;  4EZK A;  3DBS A;  3BVG A;  4XGA B;  5EE1 A;  2JWZ A;  3N1X C;  3RNG C;  1TKE A;  3HVD A;  3IG3 A;  4PS3 A;  1KJT A;  1R4M I;  2CR5 A;  3VTV A;  4GW0 A;  2KD0 A;  3R7R A;  3V62 A;  4MEM A;  3OJ4 B;  4IM0 A;  2QMT A;  1EM7 A;  3Q3O C;  3W1S A;  2WDR B;  3HHM A;  4WJN A;  2IO1 B;  1JWU D;  1K50 A;  1TGZ B;  3BYT B;  2LGX A;  4TQ0 A;  1C1Y B;  5D6J B;  2KTF A;  3PZD A;  4FUL A;  2K9X A;  3N3K B;  4C56 C;  4PYU A;  2LRU A;  5L83 A;  2YVC A;  4BHL A;  5T8I A;  3VRA B;  4PT5 A;  2CHW A;  4CQN A;  3Q2A C;  2KAN A;  1WE6 A;  4OHJ A;  2KWD A;  3DVG X;  1EF5 A;  4E71 A;  1A70 A;  4RCO A;  4A6Q A;  2BKF A;  1Q10 A;  3SFD B;  1WJ4 A;  1QOG A;  2E3T A;  4AJY B;  4NZL B;  3SD5 A;  1PGB A;  1CZP A;  2JT4 B;  3AE6 B;  5AUK A;  2WXJ A;  1E7V A;  2Z8L A;  3VDZ A;  4HJG E;  1S1Q B;  4J6I A;  1KFY B;  1N63 A;  1SB3 C;  4DWF A;  4CO7 A;  2O2V A;  1V1O A;  3VH3 B;  1LXD A;  3Q8B A;  1V86 A;  4II2 B;  4ZHP A;  1E90 A;  3ZW3 A;  2NPT A;  3IXS A;  2FBW B;  3ZDM C;  2M17 A;  2HE7 A;  4PS8 A;  3DQV A;  2AL3 A;  2INN E;  3ABV B;  5FK9 C;  3U7D A;  4AUQ C;  2XN9 C;  1GUA B;  2IO2 B;  2L8J A;  2H89 B;  3RNA C;  1V4G A;  4C7Y A;  5D3I B;  4RF0 A;  1QT9 A;  2I38 A;  3RPF C;  2XK5 A;  3W9C B;  1EUV B;  3B2F A;  2LGD A;  3ZXR A;  2GI9 A;  4MH8 A;  3LVW A;  4GDL A;  4I6P A;  2HD5 B;  2WXG A;  4DHZ B;  2VH2 A;  3RFZ B;  4BKT A;  4LDT B;  2JUO A;  1ACC A;  3URY A;  2L76 A;  2HTH A;  3M10 A;  1R8G A;  2O2V B;  3L17 A;  2I2Y A;  4F8C B;  3PRM B;  2KC2 A;  2VZK D;  2JQR B;  3UGB B;  1E0Z A;  3R8B A;  1N62 A;  2FAZ A;  4EZJ A;  3EFU A;  1YQB A;  4RF8 A;  3TEX A;  3NUH B;  5HFY A;  2WGS A;  1T0Q C;  4OW0 A;  1SE2 A;  4G11 A;  2LVP A;  1FNV A;  3JU6 A;  4WAF A;  1UBQ A;  2XK5 B;  3MC0 B;  5BO4 B;  1T3Q A;  1ZPS A;  2KOX A;  1SJE D;  4K81 A;  3WAO A;  1R4N B;  2MQJ A;  3A1Q B;  3TUO A;  2BWF A;  1YOV B;  3ML9 A;  2V4I B;  2PE6 B;  3NHE B;  1YQ4 B;  2OOB B;  3L54 A;  3JU5 A;  2LXA A;  1K8R B;  3ZTC A;  2IO3 B;  1P52 A;  2B3A A;  1C79 A;  2PJH A;  3A9K B;  2NS5 A;  1HXY D;  1WXM A;  2KVR A;  2BYF A;  2FNJ B;  4OZA A;  2JZ3 B;  2PMV A;  4A55 A;  1I4H A;  4NJ6 A;  2NCN A;  3ZNG C;  1TKG A;  3SR6 A;  1GC7 A;  2AQ1 B;  4O1N A;  2J53 A;  4GDL B;  1XLP A;  2JU6 X;  1C9F A;  2KDF B;  4FXC A;  2DAJ A;  2FID A;  2NTS A;  3PTF C;  2YEP B;  2K0P A;  2KDM A;  4GLS C;  2KX0 A;  3HRD D;  3L13 A;  2BVC A;  3MP9 A;  5L95 C;  1I4P A;  1I4G A;  3RT3 B;  3UIN B;  5IOI A;  4W9J A;  1OFF A;  2M0X A;  4E3C A;  1OQR A;  3AE5 B;  2O6V B;  2R61 A;  4HXD A;  1WXV A;  3O65 B;  4BFR A;  1MG4 A;  4WJP A;  4HWI B;  3A9J A;  4L1B A;  2KAC A;  2BKR B;  3KVF B;  4KIK B;  2BT6 A;  5HHD G;  4JLC A;  2JZP A;  5G2N A;  3AI5 A;  3LB8 C;  4DDI D;  1FRR A;  1WMH A;  2WXO A;  1J7A A;  2L1A A;  1V49 A;  3BIN A;  1G6J A;  1TT4 A;  2V3S A;  1YX6 B;  2LVQ A;  1XQQ A;  3QIJ A;  4NJC A;  1FCC C;  1XF5 L;  5EE9 A;  3Q8A A;  1EU4 A;  2KQS A;  2ZCC A;  4ICU A;  2DYB A;  4LNN A;  4WAA A;  1LO5 D;  4KGS A;  1P3Q U;  4GSW A;  1ZP0 B;  1TBE A;  2C9W B;  2WXN A;  4F1S A;  3IVF A;  2LWP A;  3P2B A;  3JSV A;  4K3B A;  4BOZ B;  1L5P A;  2CRK A;  1FD6 A;  2ON8 A;  4B6W A;  5KHO A;  1KRH A;  4XDC A;  3QQ8 B;  3ZJV A;  2V3P A;  3Q3F A;  1WXQ A;  1NYR A;  4YWG G;  3RMK C;  3TSS A;  4BKS D;  1LQB A;  4LDT D;  2N7E A;  2C7N B;  2CHX A;  2JRH A;  2REX A;  2WS3 B;  2J4X A;  2MA9 B;  1PUT A;  2FCM A;  2NPT B;  4KKI A;  1FNW A;  3VXW A;  1BXT A;  3DWG C;  1RFK A;  2N7D A;  3HM3 A;  4BBN C;  4FHK A;  3AH7 A;  3CWI A;  5E6P A;  4QAY A;  2LI5 A;  3OWE B;  2GBJ A;  3WAM A;  3NZU A;  2ZW0 A;  3KUC B;  3Q8F A;  1WI0 A;  2WYQ A;  4IUM B;  4US9 A;  3QHT A;  3W1Y A;  3AUL A;  4GDK B;  2N9X A;  2LFI A;  1LM8 B;  2LGY A;  1WJN A;  1UH6 A;  2ZVO A;  4GXB A;  3DBL B;  1BML C;  4AJW A;  3TBL D;  3AE7 B;  4JPS A;  1WRI A;  1V80 A;  2PVO D;  1ZGU B;  2WXP A;  3AE4 B;  2DNF A;  3NRZ A;  3V61 A;  5LXI B;  1WWT A;  5EE3 A;  1UGM A;  2N9K A;  1R7S A;  1P9D U;  5BYQ A;  3AB5 A;  1I4X A;  5IA7 A;  4HPP A;  1DYQ A;  4ANU A;  5E6J A;  3B2G A;  1CMX B;  2N4F A;  1WMH B;  4YSZ B;  3IG5 A;  2MHJ A;  2BF8 B;  2L7R A;  4HEA 1;  2GBM A;  1N5X A;  1YX5 B;  1H8C A;  4A3P A;  2QSD A;  3OLM D;  1KOT A;  2WXF A;  2W55 A;  1I42 A;  2GBK A;  3U7Z A;  1Y8R C;  2WXK A;  3ETR A;  3X23 A;  3AEB B;  3V6C B;  2OED A;  1I4R A;  3UI3 A;  3KH0 A;  1NVI D;  4IW0 A;  1ET9 A;  4HCP B;  5BYR A;  4TMA B;  4HVB A;  2W82 A;  1V2Y A;  2M0A A;  1WXA A;  2AYO B;  3P4S B;  1KLU D;  1UF0 A;  2LJI A;  3WAN A;  3AE1 B;  5G5G A;  3B0A A;  2DHZ A;  3PPA A;  3DRB A;  2KFJ A;  3ZLZ A;  3DVN V;  1WJU A;  1QLB B;  3AE2 B;  5JH5 C;  2H88 B;  1VDV A;  1L6U A;  3VR8 B;  4M01 A;  5JHB A;  4KX6 B;  3W5U B;  3L4P A;  4N59 A;  1D5X C;  3IG8 A;  1N6Z A;  3NOB A;  3EUB 2;  1TZ1 A;  2V4L A;  2RPQ A;  1K51 A;  2AQ3 B;  2BB5 A;  2MBE A;  2LGI A;  5FKA C;  4JWS C;  1MI0 A;  1TT5 B;  2FIF A;  2RSU A;  4OVZ A;  3RUI B;  2HTM E;  3Q3J A;  3T3N A;  1BG0 A;  2X38 A;  3HVZ A;  4YTM B;  4JIO U;  4RNA A;  1C4A A;  1RYJ A;  3GOE A;  2KWU B;  2JSV X;  2M8S A;  3AU5 A;  4HDO A;  1WGD A;  3DHG C;  4WWN A;  3QCA A;  3H6N A;  5JHA A;  4KSL C;  3PLV A;  3JPZ A;  2RDG A;  3V6E B;  2M4N A;  4M0W B;  4K1R B;  1WE7 A;  1E9M A;  1L6V A;  3IAM 1;  1MG8 A;  4BG4 A;  1EWY C;  3Q3N C;  1Z5S B;  4ZRI A;  1YMH E;  2VRR B;  2DX5 B;  2MBQ A;  2NBW B;  2QDF A;  3VUY A;  5GMV A;  2XEW A;  3X0W A;  2ONQ A;  1V8C A;  3GS2 A;  2CJO A;  1Q1O A;  2DYM A;  3U52 E;  1ZW7 A;  4KV2 A;  1F9J A;  2LD9 A;  2L05 A;  4MM3 A;  4ZOH C;  1VRP A;  5DPW A;  1UBI A;  2D32 A;  2GMI C;  2LZ6 A;  2KVZ A;  1ZKH A;  1C4C A;  1XT9 B;  2PVG C;  3MFG A;  2KMA A;  5CHV C;  2KHW B;  3LDZ E;  1YIW A;  3AEE B;  2L00 B;  4FBJ B;  2Q5W D;  3GB1 A;  2IJ0 A;  2FCS A;  2FUG 1;  1WRD B;  1I4Q A;  1YD8 U;  2CU1 A;  1TTN A;  3JSV B;  1HTQ A;  1P1A A;  1VLB A;  4DXG A;  2EMS A;  1GB4 A;  3ZRF A;  4WQO B;  1CJE A;  3NJT A;  2V0G A;  1E6E B;  4A3O A;  1FNU A;  2IDY A;  2D3B A;  2HJ1 A;  1H4R A;  1P7E A;  3ZQ4 A;  1C78 A;  4AQ7 A;  3NG0 A;  4TQ1 A;  5J99 A;  4W9C A;  2JRI B;  2LRW A;  3NY5 A;  3T8M A;  1TS5 A;  2XBB C;  3JQ3 A;  3IT6 B;  4Z9M A;  4YTP B;  3BY4 B;  2QHO A;  4A90 A;  3E56 A;  2JX5 A;  2KC1 A;  3CF6 E;  2LJ5 A;  2J0J A;  1QK1 A;  1T0S C;  2EKI A;  2B76 B;  4GIV A;  4FHJ A;  4KVG B;  4RGM A;  2JWU A;  3RCZ A;  1HTO A;  2L0F A;  4ZRQ A;  1Y56 A;  3U2S C;  1E8X A;  4G50 A;  4JE3 B;  4W9E A;  4LJO B;  3AU4 A;  4E74 A;  4EFO A;  4RGT A;  3VFK A;  3Q6B A;  2QEJ C;  3PZ8 A;  2GWC A;  2WDQ B;  5BMH A;  3I3T B;  3SU8 X;  2NVU I;  2NR2 A;  5C23 A;  4C7Z A;  1I35 A;  4F7Z A;  3PO0 A;  2QIE B;  1YQ3 B;  4WJQ A;  5FR3 A;  1MPE A;  2L0T A;  2EKE C;  1AWD A;  2GWD A;  4UDU C;  3EGR A;  2BYT A;  1RAX A;  3A1Q A;  1YJ1 A;  4BZA A;  2NBV B;  3UIO B;  2KLC A;  1NEN B;  3BYY B;  1QKZ A;  1JWM D;  4K7W A;  3I5J C;  4MGI E;  2D2Q A;  2J7Q B;  2N9L A;  3QJZ A;  3K9O B;  1DOX A;  2IYD B;  4BG4 B;  4N9F 4;  2M1M A;  3JVZ X;  3J9C A;  2WU2 B;  4AOF A;  4XZ4 A;  5C3J B;  3A33 B;  5LNK 1;  2IGD A;  3Q14 C;  2Z0E B;  1GPX A;  1DOI A;  4HPM B;  2NMQ A;  3ZYY X;  3A4R A;  3VUX A;  2K39 A;  1FEH A;  2UYZ B;  1SEB D;  2MSE D;  3C0R B;  2ZPN A;  2GRI A;  3ALB A;  3B6R A;  5TR5 A;  3DHI C;  3N32 A;  3IT4 B;  3AED B;  4C00 A;  3Q3M C;  3CSF A;  1NI3 A;  4IM3 A;  1XXG A;  2CHZ A;  2E6X A;  2KZR A;  4W9D A;  2C5L C;  1MJD A;  2KO3 A;  2MLB A;  3VRB B;  1YN3 A;  2IND C;  3ZUN A;  1JW9 D;  3BVM A;  3QAR A;  2QJL A;  1ESF A;  3KW5 B;  4DK5 A;  2HJ8 A;  2BBC A;  1CK1 A;  3MC9 A;  1B1Z A;  2BQQ A;  4ZRP A;  4DHJ D;  4MJS A;  4L2Y A;  3LN7 A;  3DBR B;  2PEA A;  1VRA B;  4EZL A;  1F1H A;  2PLP A;  4HPL B;  3D32 A;  1UEL A;  4NAW B;  3L2E B;  2K3U A;  4YL8 A;  2KT7 A;  3OAW A;  4XC2 A;  1K52 A;  2LUE A;  4TKN A;  1M94 A;  3AMZ A;  3OJ3 A;  4RH6 A;  1FRD A;  2JYE A;  4BBN F;  4ARC A;  1MFW A;  1FIQ A;  1SE4 A;  1QOA A;  1P50 A;  1OEY A;  1P98 A;  4X57 B;  2QIL A;  2AEH A;  1LGR A;  2Y5C A;  4P16 A;  3ZNZ B;  3H8H A;  4ICV A;  3DBH B;  1WGK A;  1FM0 D;  2A4Z A;  4MH0 E;  1OQY A;  2KNB A;  1L0X B;  4RFB A;  3B08 A;  1GB1 A;  2MX2 A;  2ICI A;  1NI2 A;  2G1E A;  4AM1 A;  2K25 A;  2D11 A;  2W9N A;  1R4M B;  3M62 B;  2J42 A;  2MBB B;  2KYW A;  4ZDV A;  1HZ6 A;  4GVZ A;  3NZT A;  1E8Z A;  4XDD A;  1V9J A;  1YN5 A;  3QA8 A;  2JVC A;  1QOB A;  1ZOY B;  4RF1 A;  4MM3 B;  3WA0 A;  3P4P B;  1XO3 A;  4WQM A;  1FPY A;  3R66 C;  2AX5 A;  1UGJ A;  4W9F A;  1V6E A;  4BKG A;  3I9V 1;  1BUI C;  1TY2 A;  4CYE A;  4ZHO A;  3KWL A;  1WM2 A;  2V9H A;  2LMC A;  4EKU A;  3DBR I;  2EMT A;  2N9P C;  1HA5 A;  1JCK B;  2QC8 A;  2SEB D;  3NS8 A;  2MJD A;  2JZZ A;  2RR9 A;  2O6V A;  4WWP A;  4M0W A;  3MTN B;  3V60 A;  2WWZ A;  2AQ2 B;  1AN8 A;  4RM8 A;  4J3O D;  1ZDV A;  3EA6 A;  1U6R A;  1EU3 A;  1QH4 A;  3NVY A;  3W2D A;  3NZS A;  2KAJ A;  5G55 A;  5J9A A;  1MHX A;  3APD A;  2UU7 A;  4JX1 C;  2AL6 A;  2L52 A;  2MP2 A;  3AM9 A;  3WIM A;  5AEK B;  3ZNI D;  2JPH A;  3R3M A;  4LJP B;  3UQB A;  4HJK A;  1F0Z A;  4NNJ B;  3I57 A;  4DQO C;  4B95 A;  2ZW1 A;  2CS4 A;  5HG2 A;  1WGH A;  3NS1 A;  5TSS A;  2BGF A;  4MGK E;  5AZF A;  2G4D B;  4KZ0 A;  2L3Z A;  1N5W A;  2MBH A;  4WJO A;  2ZCB A;  1FO4 A;  1IP9 A;  3QC8 B;  4G3X B;  3ZGZ A;  1F2R I;  1U4A A;  3PRZ A;  1WX9 A;  3DHH C;  1KLG D;  1SBB B;  2IBI B;  3ENE A;  4HRO A;  4KSK C;  5DPS A;  5IAA C;  2RMM A;  2KN4 A;  4LNO A;  4FLH A;  3RNB C;  1KF6 B;  1EF1 A;  5E6N A;  5EDS A;  4B9K A;  1SXT A;  1J7C A;  4ZYN A;  2K6Q A;  2W3S A;  3PLU A;  4RMA A;  1RM6 C;  2KDB A;  1SE9 A;  2INC C;  1WFY A;  4PS7 A;  1WR6 E;  3PHW B;  1J0G A;  3IAS 1;  3UIP B;  4LK0 M;  1EO6 A;  2PIA A;  2FE8 A;  3IFW B;  2DAF A;  1DGJ A;  2WLB A;  4NY0 A;  1ENF A;  2OJW A;  4EE2 A;  3ZVV A;  5H8Y E;  1JQ4 A;  1T0Y A;  1RL9 A;  2CU3 A;  4AWJ A;  2DZM A;  4JWU C;  1E5W A;  1JAL A;  3H7S A;  4A9A A;  2YEP F;  1WGG A;  1PGA A;  2ACZ B;  3M95 A;  1TKY A;  2MWS B;  4N58 A;  4GOC A;  2WX1 A;  3RNF C;  4PK1 A;  5FR6 A;  1QQR A;  4FJZ A;  3C19 A;  4BOS C;  4BKS A;  1MHH E;  2A5U A;  3R7Q A;  4NQL B;  4WWO A;  2WQY B;  3NVV A;  5D2M B;  3CST A;  3GE3 C;  3L2E A;  2Y5P A;  4XWW A;  1F77 A;  2ASQ A;  3NVW A;  2ZJD A;  3W1S C;  4US8 A;  4KKJ A;  2BS2 B;  4JQW C;  5AUI A;  1ROE A;  3MC8 A;  3ECI A;  2RDH A;  1HQR D;  2KQ4 X;  1WR1 A;  1SGH A;  1VA6 A;  1QIL A;  3KUZ A;  2KXJ A;  3GE8 C;  1ISN A;  2RD0 A;  3DCG A;  4MEL A;  2UWQ A;  5D94 A;  4DDG D;  3ZNH B;  2G9H D;  3QAQ A;  1D5Z C;  1ZXH A;  2JXT A;  1DOY A;  4C80 A;  1E8W A;  4GGQ A;  1P0R A;  2WX0 A;  3T9L A;  1IBX B;  4TUU A;  2MBO A;  3TMP B;  5IP4 D;  1V1P B;  3TL5 A;  2RPV A;  1D3Z A;  4FAD A;  4DXA B;  1FXI A;  1D5M C;  4OVV A;  2IO0 B;  3MHZ A;  4YT0 B;  4GN1 A;  2N0S B;  4G0N B;  4NAM A;  2M19 A;  1VR9 A;  1GOZ A;  2L83 A;  1JWB D;  3QWZ B;  2DZK A;  4EEW A;  4NAW A;  3ZDT A;  4ASW C;  3MJW A;  3RN9 C;  1HZ5 A;  1PGX A;  2BS3 B;  4GB9 A;  4GW2 A;  3NVZ A;  2GBN A;  2PTL A;  4C4V A;  2RGF A;  1WJ6 A;  4LNK A;  3VH4 B;  2K22 A;  1WSP A;  4B0E A;  3B1L X;  4JL9 A;  3UQA A;  3DBH I;  3H7P B;  3BK2 A;  4N6E B;  4IWQ A;  1AYF A;  2IY0 B;  2VH1 A;  3NZ3 A;  4HDQ A;  3DDC B;  1JRU A;  4FA6 A;  1YJI A;  2Y3A A;  4ZRK A;  4Q2R A;  3N20 C;  4W9G A;  2WXR A;  4MSQ B;  4ACF A;  1E7P B;  3EFC A;  2WXI A;  3RNC C;  5LLI A;  4P1C C;  2AWT A;  1SJH D;  2WXH A;  2KDE B;  1RLF A;  2KLG A;  2KJH B;  4FN2 A;  3AEG B;  1L4Z B;  3APC A;  1WX7 A;  1XLO A;  2ZNV C;  4IWO A;  1V5O A;  3VUW A;  3T3O A;  3FAH A;  4IG7 B;  2JXX A;  4RGN A;  3AV8 A;  1M4V A;  4FJV B;  5H92 C;  2ZPY A;  2MEK A;  2D10 A;  4S17 A;  4XYC A;  1Z2M A;  2OJR A;  3VTU A;  2LEK A;  4RF6 A;  5DPT A;  5IN7 A;  3ZRC A;  1RRB A;  4WUR A;  2D3A A;  1WF9 A;  4M02 A;  1Q0W B;  2J0K A;  2MH7 A;  1T5X D;  2GLS A;  3DBL I;  1JRO A;  4GDK A;  1TZO A;  1FXT B;  1WZ0 A;  1SD0 A;  2XNA C;  4REZ A;  1PDX A;  1ZUD 2;  1MVK A;  3JW0 X;  5AZH A;  4LTU A;  2KKC A;  1JWS D;  4P1B C;  1KLV A;  2MJ3 A;  3H9D A;  2PPH A;  4LLG M;  2Z59 B;  3KLS X;  4A20 A;  2GBR A;  4RF9 A;  1KTK A;  3VVW B;  1T6B X;  4LNI A;  3N9Y C;  3ZXV A;  1WY8 A;  1NBF C;  1V97 A;  3KQ4 A;  3WCQ A;  2WDV B;  1TS4 A;  1P7F A;  2K8H A;  4IKG A;  1C3T A;  2G3Q B;  3L0W B;  3RNE C;  3Q69 A;  2KQ7 A;  3PHX B;  4ZYS A;  4XX5 A;  2KFK A;  2X8X X;  1V1P A;  2D07 B;  1F52 A;  2NBU A;  1QOF A;  2LVO A;  2OHF A;  2D3C A;  4ZRJ A;  2MRP A;  1SF0 A;  5CTR C;  4P7I A;  1ET6 A;  2BWE S;  4MGY E;  5C1Z A;  1EWC A;  5G5H A;  1SE3 A;  1NYQ A;  5IKC M;  3N1Y C;  1FCL A;  1RFA A;  1TS2 A;  2I1K A;  5GXG B;  3L2D A;  1WGR A;  2KX3 A;  4RGO S;  2TSS A;  2ZZP B;  1J8C A;  1TS3 A;  3DWM A;  3QX1 A;  4XWT A;  3RI7 C;  5KHQ A;  3H1U A;  2W54 A;  3I63 C;  1GAQ B;  3AEF B;  1ZE3 D;  4DXF A;  5J2R A;  3DRE A;  4GVY A;  1V5T A;  3Q8E A;  2N9E B;  2I1J A;  1XEE A;  4YXD B;  1E10 A;  4PYZ A;  2YLM A;  2R2O A;  2KWC A;  4DHJ B;  1ZDX A;  2IZV B;  3Q8C A;  5I4D A;  4NQK E;  4AP4 C;  3ZJT A;  3P42 A;  1OGW A;  1ZXI A;  2BYV E;  4S0R A;  3L10 B;  3PV1 A;  2LHE A;  2C7H A;  2BPS A;  3B9J A;  5BMG A;  5J17 A;  3MJ5 A;  4KZC A;  4OZC A;  4WIP A;  4M00 A;  5CX3 A;  2N1V A;  1UZX B;  3RZF A;  1SIJ A;  4RM9 A;  4II3 B;  5LXH A;  5J18 A;  1YN4 A;  1CQV A;  1STE A;  1NEK B;  2VZK B;  5BYS A;  1KH0 A;  3A4S C;  3AE8 B;  2LXC A;  2KK8 A;  5HI1 A;  2IPK D;  2DBY A;  2RDB C;  4LCD E;  3V05 A;  3MHS D;  3AEA B;  4C4V B;  4Q2J A;  3PSE B;  5IO9 A;  1TIF A;  1UWM A;  5E6O A;  1E7U A;  1FMA D;  3A9J B;  4HLE A;  4BVU C;  2K5P A;  3SHQ A;  3P1M A;  2WU5 B;  3N1Z C;  4URK A;  3LVV A;  2C60 A;  3GZN B;  3VR9 B;  2KTR B;  2J0M A;  4YSX B;  2FCQ A;  4HK2 A;  1IUE A;  3ZO5 B;  3L08 A;  1AAR A;  5CHW A;  2ZNV B;  4GU2 A;  4H2A A;  2BTE A;  1IBX A;  1N60 A;  4IWP A;  3RUL A;  4EUT A;  2MJE A;  2BB6 A;  1FFU A;  4NJ7 A;  3U8Z A;  3FC4 A;  1VD2 A;  3IBE A;  3E9S A;  1NDD A;  3TEZ A;  1PFD A;  1VCB A;  3EEC A;  3R2I A;  1C76 A;  2QCZ A;  4ANX A;  1XD3 B;  5EE0 A;  4IOI E;  4DHZ E;  1PYW D;  4USA A;  3ZTD A;  2G45 B;  2JF5 A;  2V1Y A;  2PW9 A;  3VTW A;  2BW2 A;  3N30 A;  3TEW A;  2IY1 B;  1VZ7 A;  2KWV B;  3RYT A; 
#chains in the Genus database with same CATH homology
 4LNI A;  1G0W A;  3JPZ A;  1RL9 A;  3ZXV A;  2LGS A;  1SD0 A;  4BG4 B;  4BAX A;  3NG0 A;  1HTO A;  3DRE A;  4GVY A;  1BG0 A;  5J99 A;  4HPP A;  5J9A A;  3FKY A;  4AM1 A;  4LNF A;  4S17 A;  2UU7 A;  2QC8 A;  3DRB A;  4XYC A;  1HTQ A;  1I0E A;  4RF8 A;  4GW2 A;  4BG4 A;  1CRK A;  2CRK A;  3JQ3 A;  1VRP A;  1FPY A;  4RF6 A;  4Z9M A;  1P50 A;  2WGS A;  3JU5 A;  3L2D A;  4Q2R A;  1M15 A;  1LGR A;  4LNO A;  1F1H A;  3M10 A;  1P52 A;  3L2E A;  2D3A A;  2BVC A;  4GW0 A;  2J1Q A;  1F52 A;  3JU6 A;  4LNK A;  3L2E B;  2OJW A;  1QK1 A;  4ACF A;  4RF9 A;  3B6R A;  1U6R A;  4GVZ A;  2D3C A;  4RF7 A;  1QH4 A;  2GLS A;  4BHL A;  4LNN A;  2D3B A;  2WHI A;  4S0R A;  3ZXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...