1HTOA

Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 149
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htoA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htoA01
3JU6A 4BHLA 1G0WA 2J1QA 3NG0A 1HTQA 2LGSA 1RL9A 3L2EB 3L2EA 4AM1A 4BAXA 1HTOA 4GW0A 1BG0A 3DREA 4HPPA 3B6RA 4LNIA 5J99A 3JPZA 4ACFA 4S0RA 1M15A 2CRKA 5J9AA 4LNNA 4LNOA 1I0EA 3M10A 1F52A 2D3BA 4BG4B 4BG4A 4GVYA 1F1HA 3ZXVA 1VRPA 4RF6A 2BVCA 3L2DA 2OJWA 1FPYA 3DRBA 1CRKA 3FKYA 4Q2RA 4Z9MA 2UU7A 2QC8A 1QH4A 4LNFA 1P52A 4GW2A 1SD0A 4RF8A 2D3AA 2GLSA 2WHIA 1U6RA 1QK1A 4GVZA 2D3CA 1LGRA 4XYCA 4RF9A 3JQ3A 3ZXRA 3JU5A 4RF7A 4S17A 4LNKA 1P50A 2WGSA
chains in the Genus database with same CATH superfamily
4PS8A 1HEZE 4MH0E 4ZRJA 1XD3B 3PTFC 2WXKA 2V3PA 4G11A 4LCDE 1H8CA 5IO9A 3M62B 4I6PA 4LLGM 2EKIA 1I4HA 2C7HA 2KXJA 1VZ6A 5KHQA 4DQOC 1JRPA 4BVUC 2IDYA 2KZRA 4MACA 4REZA 4NQKE 1L0VB 2CJOA 3LN6A 1SE4A 4KIKB 2WP9B 5CHFA 2Y3AA 3BYYB 2MP2A 4IWOA 4BG4B 1V97A 1Y56A 2LVOA 3TMPB 1WYGA 4OW0A 4Z9MA 3TEZA 3KLSX 1WH3A 2DZMA 4ANWA 1GNUA 4FBJB 4MJSA 2BS4B 2WXJA 3CSTA 1I4XA 1AWDA 1RWSA 3Q2AC 1JCKB 5AUKA 4C7ZA 2GWCA 2LJIA 1SIFA 5EE3A 2KWUB 2O6VD 3ZXVA 4IC7B 1YD8U 1NI2A 3JVZX 1E10A 1TBEA 1WWTA 1L0XB 2ZW0A 4NZLB 2GBMA 1SD0A 2JXTA 5HFYA 3NZ3A 2IBIB 4MGZE 4D2KA 3AEEB 2L8JA 5D3DA 1E5WA 4HPLB 1JWMD 1UGMA 4MSMB 2C60A 4MGYE 2MLBA 1HQRD 4NAWB 4YSYB 2V3NA 2WDQB 5FR3A 1JWUD 4HJGE 1SB3C 1OTRB 5FR6A 3GZNI 2Z59B 3ZNGC 3V3XA 4NQLB 2FUG1 1N6ZA 1QZEA 1HTQA 1AARA 2J7QB 3AU5A 1RFKA 4GXBA 2DYMA 5BYSA 1V1PA 3DREA 1X1MA 2KDBA 2N1WA 1QLBB 3DRBA 4ZRPA 4WWNA 3HVDA 2N7EA 4MSQB 4OZCA 1LGRA 2KDEB 1ESFA 2WDVB 3U4EG 2EMTA 3VTUA 4BKSA 3EFCA 3DHGC 1M94A 2BB6A 2CJNA 2BS2B 1BG0A 3WIMA 5E6JA 3ZVVA 1WRIA 1S1QB 2LI5A 2K6QA 2LVQA 1WXSA 2ICIA 1QH4A 3HRDD 1IYFA 2JWZA 4C56C 3DBHI 2J0JA 3RNBC 2KN4A 5IOIA 1LO5D 1IGCA 3L10B 5EDSA 5C3JB 3AE9B 4M8NA 2YVCA 1V2YA 3KVFB 4DHZB 2O2VA 3ZDTA 1R4NI 2M56B 1FXTB 3N3KB 3M95A 3BZDB 2L76A 2NPTB 1IBXB 4I6LB 1P9DU 4K7SA 2ZCBA 4HVBA 4NPNA 5J17A 3IT4B 3RNEC 4WJPA 2IY0B 1SSNA 1U4AA 1PUTA 3LVVA 3L54A 2PJHA 4YSZB 1V5TA 2BKRB 3RPFC 2QHOA 4W9IA 1MJDA 2GBNA 3QARA 1NENB 2LVPA 2J1QA 3P1MA 4HPMB 4ZYNA 5L95C 3H8HA 4R3DA 4WJNA 1QF6A 4WURA 4DXGA 1L6UA 4GDKA 3TIXA 1DOXA 5DPSA 1T5XD 1NYQA 1IP9A 1NVID 2KQ7A 1KFYB 3TEXA 1OEYJ 3LDZE 2XN9C 3NRZA 3AEGB 3B2GA 3OJ4B 4IM2A 4W9LA 4USAA 3RUIB 2JUOA 1XLNA 3AU4A 3RZWC 4XE0A 1HZ6A 3BINA 5TSSA 1V6EA 1CK1A 1FXAA 2KACA 5JHBA 2XEWA 4YT0B 3EFUA 4B9KA 3R2IA 3PVLA 2RPVA 1YN4A 3W1SC 4M0WA 2INNE 2AYOB 1R7SA 1PDXA 4RFBA 1XCTL 4DHZE 1U6RA 1EU3A 4XX5A 3I3TB 2IY1B 3HM3A 2IGGA 3A1QB 1I35A 4F1SA 4RNAA 3K9OB 3HIZA 2FIFA 4K1RB 5L83A 2G45B 3IAM1 2MQJA 1GPXA 3VAWA 4JGHB 1OGWA 2X8XX 4NAMA 2J42A 3RYTA 1YJ1A 2MBEA 2BKFA 5T8IA 3BK1A 4PYZA 4DDID 4C4VA 1HXYD 4BKSD 3DVNU 1WF9A 1ROEA 2PKOA 1WIAA 3A33B 1UZXB 3DVGY 5HI1A 2JZZA 1TS3A 1DOIA 3VR9B 1WE6A 4OZAA 2WXPA 4YXDB 3ZW3A 3TUOA 3IVFA 4W9DA 1P0RA 2G3QB 2KWCA 2WXMA 2IGHA 1FRDA 2L3ZA 4FJZA 5DCNA 2WXNA 1WE7A 2M0XA 2CR5A 2W82A 2RGFA 1WSPA 1P98A 4C7YA 3Q8AA 4W9EA 4KV2A 3W9CB 3VUWA 2MEKA 3VFKA 1VR9A 3Q3NC 4IM3A 4J6IA 1KRHA 3NVYA 1I4GA 2PE6B 3VRBB 1J7AA 4MDKE 1T0YA 3ZJUA 1QT9A 2B76B 2V1YA 3AMZA 4W9JA 1BT0A 4WWMA 1QOBA 2KVZA 2BBCA 5IN7A 4J3OD 2JZPA 3NZUA 1TS4A 1NYRA 3SR6A 2WU5B 3K9PB 2J53A 4GW0A 3TSSA 3I57A 3VRAB 1G6JA 1WR6E 4GMVA 2BGFA 2KANA 5CHVC 5J99A 2K1FA 1J8CA 5CTRC 4DBGA 2BWFA 3WAMA 4LDTB 4ANUA 4ANXA 3E9SA 3PLUA 3PS6A 2RDHA 1J0GA 1WJUA 1N63A 2MBHA 4A6QA 3A9JB 4W9FA 4P7IA 4NY0A 3LN7A 3ETRA 1QOAA 3NS1A 1VDVA 3MC0B 2FBWB 2JY6A 4IUMB 3LVWA 1VRAB 2LGXA 3U7ZA 2N9EB 2PEAA 3MHSD 4GDLB 1VZ7A 4OVZA 3ZQ4A 4AJYB 4RCOA 3HUIA 4XWWA 1CJEA 1YMHE 1CQVA 4II3B 5I4DA 1E8WA 3DDCB 2ZPYA 1MI0A 3MC8A 4N9F4 3VH4B 2WS3B 4NJCA 3L2EA 3D32A 4BOZB 1VZ8A 4ITKA 4XDDA 1SJED 4LNNA 1RYJA 4XGAB 3P2BA 2CU1A 4EOYA 2UU7A 3Q69A 1E7UA 3HM6X 2ZEQA 3IT6B 3N9YC 1F9JA 4MELA 2LRWA 1VJKA 1HA5A 4KZCA 1P7EA 2KT7A 1GOZA 3EGRA 4ACFA 4JX1C 3ZKJC 1AW7A 3CMMB 3LB8C 2ONQA 2LGYA 2DHZA 1ZXHA 1WGDA 3M63B 3AE7B 1ZXIA 2MH7A 3T8MA 3Q8BA 4K3BA 1JRUA 1N61A 3ZXRA 1B9RA 4LNKA 1FCLA 2ZPNA 2WU2B 3FILA 4KVGB 1Z5SB 1QOGA 4IOIE 2N9KA 5D7GA 4LNIA 4A20A 2O6VB 1TZ1A 2ZW1A 1V80A 2ACZB 3P4PB 3PGEA 1PGAA 2GLSA 1D5XC 4IG7B 2DYBA 3KH0A 3JW0X 3GOEA 2BW2A 4KIKA 5EE0A 2HTME 1FNUA 2Z0EB 1C79A 3SFEB 4BG4A 1VA6A 3NVVA 1JWAD 1OEYA 2L05A 4LNFA 3GE3C 4HKQA 3KWVA 2JXXA 2PLPA 2IPKD 1T6BX 2NS5A 2WGSA 4RGMA 2RDBC 3UIOB 1RAXA 3DOWA 3ENEA 2KTRB 1STEA 1V49A 5BYQA 2J52A 2KQ4X 2SAKA 1UUPA 1WJ6A 4PS3A 4A55A 2MBBB 1B1ZA 3IFWB 4AQ7A 3AI5A 2W3SA 2REXA 2GWDA 2VZKD 4ZDVA 2JSVX 4MM3B 4B0EA 5J18A 2V4IB 2Z8LA 3DWGC 3N30A 2JVCA 4NAWA 2I1JA 2WXOA 1L4ZB 1F0ZA 1SGHA 2K9XA 2MJ3A 2B3AA 1F2RC 3U7DA 4KSKC 2DBYA 3JU5A 3RN9C 2KD0A 1CZPA 1K51A 2BYVE 3LXFA 1EF5A 2VH2A 3QHTA 4N58A 1WXMA 1TZOA 1XQQA 3IG3A 3N20C 4CHKA 4G3XB 2NBWB 1H4RA 3ZTCA 4WWPA 4WAAA 2HJ8A 4KKJA 2QEJC 3I9V1 4W9GA 3VHTC 1UNSA 4IKGA 3V60A 2WHIA 3AV8A 1I7HA 3NVWA 1C3TA 2JT4B 4MT5A 1SEBD 3JU6A 3SDLC 3ZJVA 1C4AA 3NVZA 5E6OA 3GZNB 2AL6A 1I4RA 1TT4A 1FIQA 5BO4B 4KZ0A 2LGDA 3PZ8A 3AE1B 4GW2A 2LD9A 2N4FA 1ET6A 4WIPA 1T0RC 4ARIA 2R61A 2OOBB 2JQRB 3B08A 4DHJD 4RF1A 3SEBA 4DXFA 2QSDA 3VDZA 4WH4A 4GLSC 2ZVOA 3VTWA 2KVRA 5DPRA 4N6EB 1EU4A 3Q3FA 3AE3B 2A4ZA 3DBSA 4EKUA 4GU2A 3AEFB 4RM8A 5HKHA 2N1VA 2NPTA 3MHZA 1GUAB 2KX3A 5LLIA 1E90A 2IGDA 3C0RB 1IBXA 4YSXB 4ZRKA 4K3CA 3PZ7A 2LMCA 5AUIA 1LFDA 2DZIA 2MRPA 4ZHOA 3KUDB 1VRPA 3EECA 4BOSC 2MBQA 1P52A 1HZ5A 1IPGA 1L6VA 2W55A 3WANA 1C4PA 1QKZA 4E71A 3BVZA 2D3CA 2RDGA 2GBJA 1D5ZC 1WXVA 1Q0WB 5E6PA 2AQ1B 3RNAC 3MTNB 1RL9A 2FCMA 4PS7A 5IA7A 2JPHA 3H9DA 2K0PA 3DBRB 1RFAA 1YX5B 1TS5A 3DVNV 3QQ8B 1AYFA 3A4SC 1YJIA 1M4VA 4URKA 1ZDXA 2WXHA 4OVUA 3OJ3A 2BYTA 4A9AA 3H6NA 4TV3A 2NTTA 4HKZE 1V1PB 5HHDG 3ZRFA 4HPPA 1MHXA 2G4SA 3RT3B 2DZKA 1P7FA 2NVUI 3Q14C 2DLBA 3UIPB 4ICUA 4FA6A 5H8YE 2QC8A 3LYYA 4A90A 4RF9A 4GGQA 2INDC 1T3QA 2BPSA 2L83A 4E74A 3R3MA 1S3SG 3HK0A 1SE9A 3QC8B 2NCNA 3M10A 2DYOA 2KO3A 2H88B 2I38A 2K8CA 5BMHA 2SEBD 2JRHA 1I4QA 1MG8A 1JWBD 2KC1A 3W5UB 2N7JA 3U30A 2KNBA 3PRMB 4TMAB 1N60A 4JLCA 1P50A 3A1QA 2YEPB 2KFJA 4M01A 2FAZA 1TKYA 2M1MA 2KHWB 1IUEA 1V86A 2IZVB 5J9AA 3NHEB 2HJ1A 5J2RA 2AX5A 2PPHA 4PK1A 2KMAA 3E56A 2RSUA 3HVZA 5AEKB 3P4QB 3QJZA 3ZNZB 3TEWA 2QMTA 3AE8B 2WYQA 3PO0A 4IM0A 2KLCA 4MGIE 4BFRA 3V05A 2D32A 2CU3A 1NI3A 1LQBA 1L2NA 1R4MB 3IHPC 5MPOA 1XLQA 2AL3A 3ZNID 3QK0A 4EEWA 2KK8A 2MW5A 3DBLB 1ZUD2 1MFWA 5AZGA 3Q3MC 1AN8A 2LUMA 1F77A 2VH1A 2DNFA 4K81A 2INPE 4HEA1 3X23A 4CO7A 1TGZB 2Z0DB 1YQBA 1KLVA 1L7YA 2QILA 2KTFA 5IP4D 1RRBA 1WRDB 2V3SA 5G2NA 4FJYA 5CX3A 1MPEA 2KDIA 3TCAA 4II2B 5GMVA 3APCA 2D5GA 2GI9A 2KQSA 2KOXA 4XWTA 3KW5B 1D6EC 2WDRB 4GSWA 2W54A 4S0RA 1WGKA 2DAJA 2PE9A 4RGTA 3AB5A 4YWGG 4BZAA 4RF6A 1RM6C 4ZRIA 1C76A 2OJWA 1JROA 5GXGB 1BUIC 3RULA 2KN5A 2ZCCA 3RNCC 1E7PB 2JF5A 1FEHA 2JWUA 1UELA 3APDA 3QX1A 4P1CC 1C4CA 3VR8B 3NOBA 2WQYB 4M00A 4YL8A 1BXTA 1WGRA 3JSVB 3Q8EA 4CYEA 2L32A 3BY4B 1ACCA 3R66C 3A9JA 3RI7C 2KWVB 1SE3A 2MWSB 5BYRA 4XYCA 4ZRQA 4G0NB 2EKEC 4FJVB 2KLGA 3V6EB 1V5OA 4MGKE 4US8A 2BB5A 2XK5B 2CRKA 4GDLA 3KQ4A 2D3BA 2PIAA 3RZFA 2MX2A 2CHXA 1P1AA 2QIEB 3L2DA 1F2RI 2N7DA 3HHMA 1SIJA 1CRKA 3AH7A 4WAFA 2ZZPB 5C23A 3AE5B 3DHHC 4RM9A 3AEBB 3ONSA 1VCBA 3URYA 1ZGUB 1WXQA 1OQYA 3ECIA 3H7SA 4I6NB 2M4NA 3PRPB 2JYEA 2HDEA 3PREA 4IDIA 5G5GA 5JZEB 3RNFC 1NEKB 2G1EA 1FXIA 3FKYA 3GP7A 1FNVA 2FCSA 2LXAA 4XC2A 2NR2A 4JIOU 2BWES 3PV1A 2DAFA 2FCNA 1PFDA 2OHFA 3V6CB 3ZO5B 3FAHA 3VUYA 2CKHB 1YQ4B 2KJ6A 3AE2B 2I1KA 2GB1A 4LNOA 2AEHA 2LHEA 1EWCA 2LFIA 2DX5B 2WLBA 1FNWA 2KJHB 1K53A 3WAOA 1WYWB 1N62A 2JRIB 3A9KB 5G5HA 3UQBA 1FCCC 2Y5PA 3DWMA 4NNJB 4KKIA 2K25A 2V4LA 5EE1A 1E0ZA 2UWQA 3RNGC 3RCZA 4JPSA 1HTOA 5AZHA 4F8CB 3N1ZC 2N9XA 3GB1A 1QILA 4KDLB 3U52E 1YJJA 4Q2JA 1KLGD 4M8MA 4F7ZA 2IYDB 4PYUA 2K22A 1PGXA 4DWFA 2UYZB 4ASWC 1WR1A 5C2TB 3PPAA 2IJ0A 4OVVA 2INCC 4LJOB 3SD5A 1D3ZA 4RGNA 1ET9A 1NDDA 4BBNF 3UI3A 3AEDB 3AEAB 3H7PB 3H1UA 2OEDA 5TR5A 3T9LA 1WMHA 2N9PC 2WXGA 1XT9B 3WALA 4B6WA 2KTRA 3MFGA 2D11A 4EUTA 4P16A 1E6EB 1L4DB 1UGJA 1EM7A 1XLOA 5IAAC 4ZYSA 3PSEB 5D6JB 4Q2RA 3AXCA 3R2TA 3ZNHB 1WGYA 1C78A 1KH0A 2LHDA 2R2QA 1J7BA 1LM8B 4ZOHC 4HCPB 1WGGA 2V9HA 3W1SA 4MM3A 1RLFA 1WM3A 4TSSA 2XNAC 1KJTA 4MH8A 3OG5A 2W3RA 2L52A 4P1BC 3BVGA 4ZHPA 3C8YA 4LDTD 4GVYA 1YN5A 5C1ZA 2IO3B 1ENFA 1FM0D 4XZ4A 2BT6A 5D2MB 1BMLC 4RH6A 2ZNVB 4GOCA 4FHJA 1ZW7A 1VD2A 2LGIA 2N0SB 3CIRB 2CS4A 2PTLA 4FXCA 4G50A 1MVKA 4MEMA 3WA0A 1WZ3A 1FMAD 3B6RA 2YEPF 3L16A 4BKGA 3VXWA 1WJ4A 3DPDA 2HD5B 3N1YC 3PT2B 2L0TA 2DZJA 3TJPA 4A3PA 3AULA 1TY0A 4CQNA 2BS3B 2LASA 2A5UA 4TUUA 3WAPA 4LTUA 1YOVB 1SJHD 3N32A 3FILB 2KDMA 1PYWD 2FCQA 3P42A 1E8YA 1ZOYB 2MJEA 2C9WB 4GB9A 4EZLA 3P4SB 2NBUA 1TYGB 1TT5B 4YTMB 3L0WB 1V1OA 4RF8A 1IGDA 1Q5WB 4HDOA 3LJ3A 2GBRA 1GB1A 2L0FA 3CWIA 1WX9A 3MJ5A 5LNK1 2KKCA 3UQAA 1GJZA 2MSED 4EE2A 3NUHB 2K5PA 2KYWA 1GB4A 3IG5A 2KFKB 1SXTA 2LEKA 1QOFA 2KMMA 4WQMA 1OQRA 2C7MB 3V61A 1E8ZA 3ZJTA 1D4BA 2JU6X 4B0MA 3PRZA 2LJ5A 3PZDA 2KMCA 3R7RA 3UINB 4WJOA 3AE4B 1NBFC 3AM9A 1ZE3D 4NJ7A 4W9KA 1A70A 2AQ2B 2TSSA 4HDQA 4TQ1A 2ASQA 4P6VF 3FC4A 4KSLC 4C00A 2E6XA 2K8BA 2MP2B 4OZBA 3VTVA 4L23A 1F1HA 1LXDA 3QCAA 1FO4A 1R8GA 2EELA 3AN1A 1JALA 4NJ6A 2LUEA 1YN3A 3KUZA 4L2YA 1YIWA 3W2DA 4MJSB 1UBQA 2LGSA 1C1YB 1QQRA 1GAQB 1I42A 4FULA 1EF1A 1I0EA 3DBHB 4DXAB 4YTPB 2YLMA 5AZFA 3VUXA 2BQQA 2FE8A 4TQ0A 3T3NA 2MBOA 4K7UA 1WJNA 3M3JA 1G0WA 2D3GA 1R4NB 1XEEA 4GIVA 4OHJA 3T3OA 2V0GA 2QDFA 4HROA 3DCGA 2GBKA 1UD7A 3UGBB 4JWSC 4KGRA 1T0SC 1UF0A 3B9JA 3NS8A 1KTKA 1DYQA 1J7CA 3V62A 1FRRA 4WQOB 2E3TA 2AWTA 2R2OA 3N1XC 1SF0A 4RMAA 5FK9C 1ZKHA 3KWLA 4N59A 4AOFA 1Z2MA 2WXRA 2IO1B 1WZ0A 1EO6A 1PQSA 3S2AA 4E3CA 5EE9A 1E9MA 3UF8A 5G55A 3NJTA 3DBRI 1OFFA 3RMKC 1MG4A 2RD0A 1ZPSA 1E7VA 1WX7A 1N5WA 4FHKA 3B2FA 4A8XC 2M17A 2M19A 2EMSA 3L4PA 3PHXB 2FIDA 4RF0A 1TJEA 2WXLA 1Y8RC 5DPTA 1D5MC 3OWEB 2G4DB 2L1AA 4JWUC 5H92C 1TIFA 3C19A 1UH6A 2W9NA 4KDIC 3A4RA 1F52A 3SFDB 3U8ZA 2ZNVC 2BVCA 1EUVB 1J19A 2O2VB 2LRUA 2WXIA 2WXQA 1XF5L 2WXFA 4FLHA 5LXIB 1WX8A 1KLUD 3ML9A 2BTEA 3L08A 1QK1A 4AWJA 2PMVA 2K8HA 3JQ3A 4IWQA 1L0YB 4HWIB 1XLPA 1Q10A 3KYCD 1TKEA 1PGBA 3DQVA 2WWZA 4IW0A 1JQ4A 3JPZA 5BMIA 3GE8C 4KGTA 1YQ3B 3BWUD 4DDGD 3AE6B 2K6DB 2RMMA 3MJWA 2DWQA 2C7NB 3CF6E 3AECB 3ZGZA 4AP4C 1XXGA 3R7QA 4GN1A 3ABVB 1KF6B 4DK5A 3O13A 1Q1OA 1FFUA 2LZ6A 2WX1A 4AUQC 2MCNB 2MJDA 1GC6A 3JSVA 1N5XA 5DPWA 1HE8A 3NZSA 2KAJA 4GDKB 1DGJA 3OLMD 3X0WA 2K39A 2Q5WD 2JZ3B 4AJWA 3I63C 1R4MI 3ZTDA 3W1YA 3WCQA 2JYTA 2XK5A 3DBLI 4PT5A 1WGHA 2QJLA 2D10A 2M0AA 2HTHA 4KGSA 1TY2A 1EWYC 4WJQA 3APFA 3I5JC 5LXHA 3EHVA 4HK2A 2IO0B 2J0MA 3EUB2 3ZLZA 4JE3B 2RR9A 3R8BA 3BVMA 2CHWA 1JMLA 1V9JA 3TEYA 2ON8A 1E8XA 2MA9B 1ISNA 1GG3A 3Q8FA 4KX6B 1UWMA 2GMIC 4UDUC 4JL9A 4HXDA 1V4GA 3VQIA 2KJRA 4M0WB 3EC8A 3SU8X 5JXVA 2BYFA 2Y5CA 3BK2A 3ZRCA 5CHWA 3JYUA 3KUCB 5E6NA 1K50A 3QIJA 3RD2A 4BKTA 2C5LC 4US9A 2PW9A 2CHZA 4YTNB 3B1LX 4LK0M 1TKGA 2D33A 1WXAA 4ICVA 3ZYYX 1SE2A 2N9LA 2WNMA 5IKCM 3Q3JA 2J4XA 3Q3OC 1L5PA 3A9KA 2L7RA 3L13A 1C77A 5BMGA 2XBBC 4EZKA 3BIID 4W9CA 3P63A 1CMXB 1JW9D 4C4VB 1K52A 4BHLA 1MHHE 1DOYA 2D07B 1TTNA 4WWOA 4A3OA 1C9FA 3ML8A 2M8SA 3QA8A 4FN2A 3VH3B 4FADA 4QAYA 4HRSA 1YX6B 2AQ3B 3ZUNA 3TBLD 1XO3A 3IAS1 4BBNC 2DENB 3CSFA 4AS1A 1WI0A 4C80A 3J9CA 2I2YA 3DVGX 2Y5BB 3O65B 2D2QA 4HJKA 3VVWB 3H7PA 1ZP0B 3Q6BA 2NTSA 3QAQA 3TL5A 3P4RB 4GVZA 4IWPA 4L1BA 4BAXA 5D3IB 1YNTE 2X38A 3MP9A 1M15A 2FUHB 5D94A 1KOTA 2O6VA 1JWSD 1WY8A 2GRIA 2VRRB 2ZVNA 1VLBA 2D3AA 2IO2B 3ALBA 4ARCA 4EFOA 2LXCA 2VZKB 5JHAA 3ZIMA 3KYDD 4TKNA 2OJRA 2PVGC 2WX0A 2BYEA 2G9HD 3IBEA 4ANVA 2H89B 2PVOD 2HE7A 2NMQA 2RPQA 2QCZA 3OAWA 1OQQA 1WFYA 4H2AA 3BYTB 3Q8CA 4S17A 3RFZB 2MHJA 1KM7A 2K3UA 3NG0A 1UBIA 4AM1A 4RGOS 1V8CA 5HG2A 1I4PA 4B95A 3ZDMC 1FD6A 2GOWA 1TS2A 5JH5C 4W9HA 1WM2A 3DHIC 2JX5A 2WDTB 1A5RA 3SHQA 1GC7A 5FKAC 3IXSA 3QWZB 2LWPA 3L2EB 3NY5A 4HLEA 2KDFB 3PLVA 3NZTA 3IG8A 3MC9A 1P3QU 4XDCA 1FFVA 3PHWB 3GS2A 2L00B 1T0QC 5KHOA 3U2SC 4LJPB 2KC2A 1UWXA 1ZDVA 2ZJDA 2J0KA 4RF7A 1K8RB 3L17A 3EA6A 2KX0A 1SBBB 4DHJB 2FNJB 4O1NA 3W5VB 2BF8B 4X57B 2NBVB 1XCQL 1FPYA 4EZJA 2KFKA 4JQWC 3B0AA 4K7WA 1V81A 2KWDA 1WMHB 4M02A 4HCNB
chains in the Genus database with same CATH topology
3JU6A 4BHLA 1G0WA 2J1QA 3NG0A 1HTQA 2LGSA 1RL9A 3L2EB 3L2EA 4AM1A 4BAXA 1HTOA 4GW0A 1BG0A 3DREA 4HPPA 3B6RA 4LNIA 5J99A 3JPZA 4ACFA 4S0RA 1M15A 2CRKA 5J9AA 4LNNA 4LNOA 1I0EA 3M10A 1F52A 2D3BA 4BG4B 4BG4A 4GVYA 1F1HA 3ZXVA 1VRPA 4RF6A 2BVCA 3L2DA 2OJWA 1FPYA 3DRBA 1CRKA 3FKYA 4Q2RA 4Z9MA 2UU7A 2QC8A 1QH4A 4LNFA 1P52A 4GW2A 1SD0A 4RF8A 2D3AA 2GLSA 2WHIA 1U6RA 1QK1A 4GVZA 2D3CA 1LGRA 4XYCA 4RF9A 3JQ3A 3ZXRA 3JU5A 4RF7A 4S17A 4LNKA 1P50A 2WGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU6 A;  4BHL A;  1G0W A;  2J1Q A;  3NG0 A;  1HTQ A;  2LGS A;  1RL9 A;  3L2E B;  3L2E A;  4AM1 A;  4BAX A;  1HTO A;  4GW0 A;  1BG0 A;  3DRE A;  4HPP A;  3B6R A;  4LNI A;  5J99 A;  3JPZ A;  4ACF A;  4S0R A;  1M15 A;  2CRK A;  5J9A A;  4LNN A;  4LNO A;  1I0E A;  3M10 A;  1F52 A;  2D3B A;  4BG4 B;  4BG4 A;  4GVY A;  1F1H A;  3ZXV A;  1VRP A;  4RF6 A;  2BVC A;  3L2D A;  2OJW A;  1FPY A;  3DRB A;  1CRK A;  3FKY A;  4Q2R A;  4Z9M A;  2UU7 A;  2QC8 A;  1QH4 A;  4LNF A;  1P52 A;  4GW2 A;  1SD0 A;  4RF8 A;  2D3A A;  2GLS A;  2WHI A;  1U6R A;  1QK1 A;  4GVZ A;  2D3C A;  1LGR A;  4XYC A;  4RF9 A;  3JQ3 A;  3ZXR A;  3JU5 A;  4RF7 A;  4S17 A;  4LNK A;  1P50 A;  2WGS A; 
#chains in the Genus database with same CATH topology
 4PS8 A;  1HEZ E;  4MH0 E;  4ZRJ A;  1XD3 B;  3PTF C;  2WXK A;  2V3P A;  4G11 A;  4LCD E;  1H8C A;  5IO9 A;  3M62 B;  4I6P A;  4LLG M;  2EKI A;  1I4H A;  2C7H A;  2KXJ A;  1VZ6 A;  5KHQ A;  4DQO C;  1JRP A;  4BVU C;  2IDY A;  2KZR A;  4MAC A;  4REZ A;  4NQK E;  1L0V B;  2CJO A;  3LN6 A;  1SE4 A;  4KIK B;  2WP9 B;  5CHF A;  2Y3A A;  3BYY B;  2MP2 A;  4IWO A;  4BG4 B;  1V97 A;  1Y56 A;  2LVO A;  3TMP B;  1WYG A;  4OW0 A;  4Z9M A;  3TEZ A;  3KLS X;  1WH3 A;  2DZM A;  4ANW A;  1GNU A;  4FBJ B;  4MJS A;  2BS4 B;  2WXJ A;  3CST A;  1I4X A;  1AWD A;  1RWS A;  3Q2A C;  1JCK B;  5AUK A;  4C7Z A;  2GWC A;  2LJI A;  1SIF A;  5EE3 A;  2KWU B;  2O6V D;  3ZXV A;  4IC7 B;  1YD8 U;  1NI2 A;  3JVZ X;  1E10 A;  1TBE A;  1WWT A;  1L0X B;  2ZW0 A;  4NZL B;  2GBM A;  1SD0 A;  2JXT A;  5HFY A;  3NZ3 A;  2IBI B;  4MGZ E;  4D2K A;  3AEE B;  2L8J A;  5D3D A;  1E5W A;  4HPL B;  1JWM D;  1UGM A;  4MSM B;  2C60 A;  4MGY E;  2MLB A;  1HQR D;  4NAW B;  4YSY B;  2V3N A;  2WDQ B;  5FR3 A;  1JWU D;  4HJG E;  1SB3 C;  1OTR B;  5FR6 A;  3GZN I;  2Z59 B;  3ZNG C;  3V3X A;  4NQL B;  2FUG 1;  1N6Z A;  1QZE A;  1HTQ A;  1AAR A;  2J7Q B;  3AU5 A;  1RFK A;  4GXB A;  2DYM A;  5BYS A;  1V1P A;  3DRE A;  1X1M A;  2KDB A;  2N1W A;  1QLB B;  3DRB A;  4ZRP A;  4WWN A;  3HVD A;  2N7E A;  4MSQ B;  4OZC A;  1LGR A;  2KDE B;  1ESF A;  2WDV B;  3U4E G;  2EMT A;  3VTU A;  4BKS A;  3EFC A;  3DHG C;  1M94 A;  2BB6 A;  2CJN A;  2BS2 B;  1BG0 A;  3WIM A;  5E6J A;  3ZVV A;  1WRI A;  1S1Q B;  2LI5 A;  2K6Q A;  2LVQ A;  1WXS A;  2ICI A;  1QH4 A;  3HRD D;  1IYF A;  2JWZ A;  4C56 C;  3DBH I;  2J0J A;  3RNB C;  2KN4 A;  5IOI A;  1LO5 D;  1IGC A;  3L10 B;  5EDS A;  5C3J B;  3AE9 B;  4M8N A;  2YVC A;  1V2Y A;  3KVF B;  4DHZ B;  2O2V A;  3ZDT A;  1R4N I;  2M56 B;  1FXT B;  3N3K B;  3M95 A;  3BZD B;  2L76 A;  2NPT B;  1IBX B;  4I6L B;  1P9D U;  4K7S A;  2ZCB A;  4HVB A;  4NPN A;  5J17 A;  3IT4 B;  3RNE C;  4WJP A;  2IY0 B;  1SSN A;  1U4A A;  1PUT A;  3LVV A;  3L54 A;  2PJH A;  4YSZ B;  1V5T A;  2BKR B;  3RPF C;  2QHO A;  4W9I A;  1MJD A;  2GBN A;  3QAR A;  1NEN B;  2LVP A;  2J1Q A;  3P1M A;  4HPM B;  4ZYN A;  5L95 C;  3H8H A;  4R3D A;  4WJN A;  1QF6 A;  4WUR A;  4DXG A;  1L6U A;  4GDK A;  3TIX A;  1DOX A;  5DPS A;  1T5X D;  1NYQ A;  1IP9 A;  1NVI D;  2KQ7 A;  1KFY B;  3TEX A;  1OEY J;  3LDZ E;  2XN9 C;  3NRZ A;  3AEG B;  3B2G A;  3OJ4 B;  4IM2 A;  4W9L A;  4USA A;  3RUI B;  2JUO A;  1XLN A;  3AU4 A;  3RZW C;  4XE0 A;  1HZ6 A;  3BIN A;  5TSS A;  1V6E A;  1CK1 A;  1FXA A;  2KAC A;  5JHB A;  2XEW A;  4YT0 B;  3EFU A;  4B9K A;  3R2I A;  3PVL A;  2RPV A;  1YN4 A;  3W1S C;  4M0W A;  2INN E;  2AYO B;  1R7S A;  1PDX A;  4RFB A;  1XCT L;  4DHZ E;  1U6R A;  1EU3 A;  4XX5 A;  3I3T B;  2IY1 B;  3HM3 A;  2IGG A;  3A1Q B;  1I35 A;  4F1S A;  4RNA A;  3K9O B;  3HIZ A;  2FIF A;  4K1R B;  5L83 A;  2G45 B;  3IAM 1;  2MQJ A;  1GPX A;  3VAW A;  4JGH B;  1OGW A;  2X8X X;  4NAM A;  2J42 A;  3RYT A;  1YJ1 A;  2MBE A;  2BKF A;  5T8I A;  3BK1 A;  4PYZ A;  4DDI D;  4C4V A;  1HXY D;  4BKS D;  3DVN U;  1WF9 A;  1ROE A;  2PKO A;  1WIA A;  3A33 B;  1UZX B;  3DVG Y;  5HI1 A;  2JZZ A;  1TS3 A;  1DOI A;  3VR9 B;  1WE6 A;  4OZA A;  2WXP A;  4YXD B;  3ZW3 A;  3TUO A;  3IVF A;  4W9D A;  1P0R A;  2G3Q B;  2KWC A;  2WXM A;  2IGH A;  1FRD A;  2L3Z A;  4FJZ A;  5DCN A;  2WXN A;  1WE7 A;  2M0X A;  2CR5 A;  2W82 A;  2RGF A;  1WSP A;  1P98 A;  4C7Y A;  3Q8A A;  4W9E A;  4KV2 A;  3W9C B;  3VUW A;  2MEK A;  3VFK A;  1VR9 A;  3Q3N C;  4IM3 A;  4J6I A;  1KRH A;  3NVY A;  1I4G A;  2PE6 B;  3VRB B;  1J7A A;  4MDK E;  1T0Y A;  3ZJU A;  1QT9 A;  2B76 B;  2V1Y A;  3AMZ A;  4W9J A;  1BT0 A;  4WWM A;  1QOB A;  2KVZ A;  2BBC A;  5IN7 A;  4J3O D;  2JZP A;  3NZU A;  1TS4 A;  1NYR A;  3SR6 A;  2WU5 B;  3K9P B;  2J53 A;  4GW0 A;  3TSS A;  3I57 A;  3VRA B;  1G6J A;  1WR6 E;  4GMV A;  2BGF A;  2KAN A;  5CHV C;  5J99 A;  2K1F A;  1J8C A;  5CTR C;  4DBG A;  2BWF A;  3WAM A;  4LDT B;  4ANU A;  4ANX A;  3E9S A;  3PLU A;  3PS6 A;  2RDH A;  1J0G A;  1WJU A;  1N63 A;  2MBH A;  4A6Q A;  3A9J B;  4W9F A;  4P7I A;  4NY0 A;  3LN7 A;  3ETR A;  1QOA A;  3NS1 A;  1VDV A;  3MC0 B;  2FBW B;  2JY6 A;  4IUM B;  3LVW A;  1VRA B;  2LGX A;  3U7Z A;  2N9E B;  2PEA A;  3MHS D;  4GDL B;  1VZ7 A;  4OVZ A;  3ZQ4 A;  4AJY B;  4RCO A;  3HUI A;  4XWW A;  1CJE A;  1YMH E;  1CQV A;  4II3 B;  5I4D A;  1E8W A;  3DDC B;  2ZPY A;  1MI0 A;  3MC8 A;  4N9F 4;  3VH4 B;  2WS3 B;  4NJC A;  3L2E A;  3D32 A;  4BOZ B;  1VZ8 A;  4ITK A;  4XDD A;  1SJE D;  4LNN A;  1RYJ A;  4XGA B;  3P2B A;  2CU1 A;  4EOY A;  2UU7 A;  3Q69 A;  1E7U A;  3HM6 X;  2ZEQ A;  3IT6 B;  3N9Y C;  1F9J A;  4MEL A;  2LRW A;  1VJK A;  1HA5 A;  4KZC A;  1P7E A;  2KT7 A;  1GOZ A;  3EGR A;  4ACF A;  4JX1 C;  3ZKJ C;  1AW7 A;  3CMM B;  3LB8 C;  2ONQ A;  2LGY A;  2DHZ A;  1ZXH A;  1WGD A;  3M63 B;  3AE7 B;  1ZXI A;  2MH7 A;  3T8M A;  3Q8B A;  4K3B A;  1JRU A;  1N61 A;  3ZXR A;  1B9R A;  4LNK A;  1FCL A;  2ZPN A;  2WU2 B;  3FIL A;  4KVG B;  1Z5S B;  1QOG A;  4IOI E;  2N9K A;  5D7G A;  4LNI A;  4A20 A;  2O6V B;  1TZ1 A;  2ZW1 A;  1V80 A;  2ACZ B;  3P4P B;  3PGE A;  1PGA A;  2GLS A;  1D5X C;  4IG7 B;  2DYB A;  3KH0 A;  3JW0 X;  3GOE A;  2BW2 A;  4KIK A;  5EE0 A;  2HTM E;  1FNU A;  2Z0E B;  1C79 A;  3SFE B;  4BG4 A;  1VA6 A;  3NVV A;  1JWA D;  1OEY A;  2L05 A;  4LNF A;  3GE3 C;  4HKQ A;  3KWV A;  2JXX A;  2PLP A;  2IPK D;  1T6B X;  2NS5 A;  2WGS A;  4RGM A;  2RDB C;  3UIO B;  1RAX A;  3DOW A;  3ENE A;  2KTR B;  1STE A;  1V49 A;  5BYQ A;  2J52 A;  2KQ4 X;  2SAK A;  1UUP A;  1WJ6 A;  4PS3 A;  4A55 A;  2MBB B;  1B1Z A;  3IFW B;  4AQ7 A;  3AI5 A;  2W3S A;  2REX A;  2GWD A;  2VZK D;  4ZDV A;  2JSV X;  4MM3 B;  4B0E A;  5J18 A;  2V4I B;  2Z8L A;  3DWG C;  3N30 A;  2JVC A;  4NAW A;  2I1J A;  2WXO A;  1L4Z B;  1F0Z A;  1SGH A;  2K9X A;  2MJ3 A;  2B3A A;  1F2R C;  3U7D A;  4KSK C;  2DBY A;  3JU5 A;  3RN9 C;  2KD0 A;  1CZP A;  1K51 A;  2BYV E;  3LXF A;  1EF5 A;  2VH2 A;  3QHT A;  4N58 A;  1WXM A;  1TZO A;  1XQQ A;  3IG3 A;  3N20 C;  4CHK A;  4G3X B;  2NBW B;  1H4R A;  3ZTC A;  4WWP A;  4WAA A;  2HJ8 A;  4KKJ A;  2QEJ C;  3I9V 1;  4W9G A;  3VHT C;  1UNS A;  4IKG A;  3V60 A;  2WHI A;  3AV8 A;  1I7H A;  3NVW A;  1C3T A;  2JT4 B;  4MT5 A;  1SEB D;  3JU6 A;  3SDL C;  3ZJV A;  1C4A A;  3NVZ A;  5E6O A;  3GZN B;  2AL6 A;  1I4R A;  1TT4 A;  1FIQ A;  5BO4 B;  4KZ0 A;  2LGD A;  3PZ8 A;  3AE1 B;  4GW2 A;  2LD9 A;  2N4F A;  1ET6 A;  4WIP A;  1T0R C;  4ARI A;  2R61 A;  2OOB B;  2JQR B;  3B08 A;  4DHJ D;  4RF1 A;  3SEB A;  4DXF A;  2QSD A;  3VDZ A;  4WH4 A;  4GLS C;  2ZVO A;  3VTW A;  2KVR A;  5DPR A;  4N6E B;  1EU4 A;  3Q3F A;  3AE3 B;  2A4Z A;  3DBS A;  4EKU A;  4GU2 A;  3AEF B;  4RM8 A;  5HKH A;  2N1V A;  2NPT A;  3MHZ A;  1GUA B;  2KX3 A;  5LLI A;  1E90 A;  2IGD A;  3C0R B;  1IBX A;  4YSX B;  4ZRK A;  4K3C A;  3PZ7 A;  2LMC A;  5AUI A;  1LFD A;  2DZI A;  2MRP A;  4ZHO A;  3KUD B;  1VRP A;  3EEC A;  4BOS C;  2MBQ A;  1P52 A;  1HZ5 A;  1IPG A;  1L6V A;  2W55 A;  3WAN A;  1C4P A;  1QKZ A;  4E71 A;  3BVZ A;  2D3C A;  2RDG A;  2GBJ A;  1D5Z C;  1WXV A;  1Q0W B;  5E6P A;  2AQ1 B;  3RNA C;  3MTN B;  1RL9 A;  2FCM A;  4PS7 A;  5IA7 A;  2JPH A;  3H9D A;  2K0P A;  3DBR B;  1RFA A;  1YX5 B;  1TS5 A;  3DVN V;  3QQ8 B;  1AYF A;  3A4S C;  1YJI A;  1M4V A;  4URK A;  1ZDX A;  2WXH A;  4OVU A;  3OJ3 A;  2BYT A;  4A9A A;  3H6N A;  4TV3 A;  2NTT A;  4HKZ E;  1V1P B;  5HHD G;  3ZRF A;  4HPP A;  1MHX A;  2G4S A;  3RT3 B;  2DZK A;  1P7F A;  2NVU I;  3Q14 C;  2DLB A;  3UIP B;  4ICU A;  4FA6 A;  5H8Y E;  2QC8 A;  3LYY A;  4A90 A;  4RF9 A;  4GGQ A;  2IND C;  1T3Q A;  2BPS A;  2L83 A;  4E74 A;  3R3M A;  1S3S G;  3HK0 A;  1SE9 A;  3QC8 B;  2NCN A;  3M10 A;  2DYO A;  2KO3 A;  2H88 B;  2I38 A;  2K8C A;  5BMH A;  2SEB D;  2JRH A;  1I4Q A;  1MG8 A;  1JWB D;  2KC1 A;  3W5U B;  2N7J A;  3U30 A;  2KNB A;  3PRM B;  4TMA B;  1N60 A;  4JLC A;  1P50 A;  3A1Q A;  2YEP B;  2KFJ A;  4M01 A;  2FAZ A;  1TKY A;  2M1M A;  2KHW B;  1IUE A;  1V86 A;  2IZV B;  5J9A A;  3NHE B;  2HJ1 A;  5J2R A;  2AX5 A;  2PPH A;  4PK1 A;  2KMA A;  3E56 A;  2RSU A;  3HVZ A;  5AEK B;  3P4Q B;  3QJZ A;  3ZNZ B;  3TEW A;  2QMT A;  3AE8 B;  2WYQ A;  3PO0 A;  4IM0 A;  2KLC A;  4MGI E;  4BFR A;  3V05 A;  2D32 A;  2CU3 A;  1NI3 A;  1LQB A;  1L2N A;  1R4M B;  3IHP C;  5MPO A;  1XLQ A;  2AL3 A;  3ZNI D;  3QK0 A;  4EEW A;  2KK8 A;  2MW5 A;  3DBL B;  1ZUD 2;  1MFW A;  5AZG A;  3Q3M C;  1AN8 A;  2LUM A;  1F77 A;  2VH1 A;  2DNF A;  4K81 A;  2INP E;  4HEA 1;  3X23 A;  4CO7 A;  1TGZ B;  2Z0D B;  1YQB A;  1KLV A;  1L7Y A;  2QIL A;  2KTF A;  5IP4 D;  1RRB A;  1WRD B;  2V3S A;  5G2N A;  4FJY A;  5CX3 A;  1MPE A;  2KDI A;  3TCA A;  4II2 B;  5GMV A;  3APC A;  2D5G A;  2GI9 A;  2KQS A;  2KOX A;  4XWT A;  3KW5 B;  1D6E C;  2WDR B;  4GSW A;  2W54 A;  4S0R A;  1WGK A;  2DAJ A;  2PE9 A;  4RGT A;  3AB5 A;  4YWG G;  4BZA A;  4RF6 A;  1RM6 C;  4ZRI A;  1C76 A;  2OJW A;  1JRO A;  5GXG B;  1BUI C;  3RUL A;  2KN5 A;  2ZCC A;  3RNC C;  1E7P B;  2JF5 A;  1FEH A;  2JWU A;  1UEL A;  3APD A;  3QX1 A;  4P1C C;  1C4C A;  3VR8 B;  3NOB A;  2WQY B;  4M00 A;  4YL8 A;  1BXT A;  1WGR A;  3JSV B;  3Q8E A;  4CYE A;  2L32 A;  3BY4 B;  1ACC A;  3R66 C;  3A9J A;  3RI7 C;  2KWV B;  1SE3 A;  2MWS B;  5BYR A;  4XYC A;  4ZRQ A;  4G0N B;  2EKE C;  4FJV B;  2KLG A;  3V6E B;  1V5O A;  4MGK E;  4US8 A;  2BB5 A;  2XK5 B;  2CRK A;  4GDL A;  3KQ4 A;  2D3B A;  2PIA A;  3RZF A;  2MX2 A;  2CHX A;  1P1A A;  2QIE B;  3L2D A;  1F2R I;  2N7D A;  3HHM A;  1SIJ A;  1CRK A;  3AH7 A;  4WAF A;  2ZZP B;  5C23 A;  3AE5 B;  3DHH C;  4RM9 A;  3AEB B;  3ONS A;  1VCB A;  3URY A;  1ZGU B;  1WXQ A;  1OQY A;  3ECI A;  3H7S A;  4I6N B;  2M4N A;  3PRP B;  2JYE A;  2HDE A;  3PRE A;  4IDI A;  5G5G A;  5JZE B;  3RNF C;  1NEK B;  2G1E A;  1FXI A;  3FKY A;  3GP7 A;  1FNV A;  2FCS A;  2LXA A;  4XC2 A;  2NR2 A;  4JIO U;  2BWE S;  3PV1 A;  2DAF A;  2FCN A;  1PFD A;  2OHF A;  3V6C B;  3ZO5 B;  3FAH A;  3VUY A;  2CKH B;  1YQ4 B;  2KJ6 A;  3AE2 B;  2I1K A;  2GB1 A;  4LNO A;  2AEH A;  2LHE A;  1EWC A;  2LFI A;  2DX5 B;  2WLB A;  1FNW A;  2KJH B;  1K53 A;  3WAO A;  1WYW B;  1N62 A;  2JRI B;  3A9K B;  5G5H A;  3UQB A;  1FCC C;  2Y5P A;  3DWM A;  4NNJ B;  4KKI A;  2K25 A;  2V4L A;  5EE1 A;  1E0Z A;  2UWQ A;  3RNG C;  3RCZ A;  4JPS A;  1HTO A;  5AZH A;  4F8C B;  3N1Z C;  2N9X A;  3GB1 A;  1QIL A;  4KDL B;  3U52 E;  1YJJ A;  4Q2J A;  1KLG D;  4M8M A;  4F7Z A;  2IYD B;  4PYU A;  2K22 A;  1PGX A;  4DWF A;  2UYZ B;  4ASW C;  1WR1 A;  5C2T B;  3PPA A;  2IJ0 A;  4OVV A;  2INC C;  4LJO B;  3SD5 A;  1D3Z A;  4RGN A;  1ET9 A;  1NDD A;  4BBN F;  3UI3 A;  3AED B;  3AEA B;  3H7P B;  3H1U A;  2OED A;  5TR5 A;  3T9L A;  1WMH A;  2N9P C;  2WXG A;  1XT9 B;  3WAL A;  4B6W A;  2KTR A;  3MFG A;  2D11 A;  4EUT A;  4P16 A;  1E6E B;  1L4D B;  1UGJ A;  1EM7 A;  1XLO A;  5IAA C;  4ZYS A;  3PSE B;  5D6J B;  4Q2R A;  3AXC A;  3R2T A;  3ZNH B;  1WGY A;  1C78 A;  1KH0 A;  2LHD A;  2R2Q A;  1J7B A;  1LM8 B;  4ZOH C;  4HCP B;  1WGG A;  2V9H A;  3W1S A;  4MM3 A;  1RLF A;  1WM3 A;  4TSS A;  2XNA C;  1KJT A;  4MH8 A;  3OG5 A;  2W3R A;  2L52 A;  4P1B C;  3BVG A;  4ZHP A;  3C8Y A;  4LDT D;  4GVY A;  1YN5 A;  5C1Z A;  2IO3 B;  1ENF A;  1FM0 D;  4XZ4 A;  2BT6 A;  5D2M B;  1BML C;  4RH6 A;  2ZNV B;  4GOC A;  4FHJ A;  1ZW7 A;  1VD2 A;  2LGI A;  2N0S B;  3CIR B;  2CS4 A;  2PTL A;  4FXC A;  4G50 A;  1MVK A;  4MEM A;  3WA0 A;  1WZ3 A;  1FMA D;  3B6R A;  2YEP F;  3L16 A;  4BKG A;  3VXW A;  1WJ4 A;  3DPD A;  2HD5 B;  3N1Y C;  3PT2 B;  2L0T A;  2DZJ A;  3TJP A;  4A3P A;  3AUL A;  1TY0 A;  4CQN A;  2BS3 B;  2LAS A;  2A5U A;  4TUU A;  3WAP A;  4LTU A;  1YOV B;  1SJH D;  3N32 A;  3FIL B;  2KDM A;  1PYW D;  2FCQ A;  3P42 A;  1E8Y A;  1ZOY B;  2MJE A;  2C9W B;  4GB9 A;  4EZL A;  3P4S B;  2NBU A;  1TYG B;  1TT5 B;  4YTM B;  3L0W B;  1V1O A;  4RF8 A;  1IGD A;  1Q5W B;  4HDO A;  3LJ3 A;  2GBR A;  1GB1 A;  2L0F A;  3CWI A;  1WX9 A;  3MJ5 A;  5LNK 1;  2KKC A;  3UQA A;  1GJZ A;  2MSE D;  4EE2 A;  3NUH B;  2K5P A;  2KYW A;  1GB4 A;  3IG5 A;  2KFK B;  1SXT A;  2LEK A;  1QOF A;  2KMM A;  4WQM A;  1OQR A;  2C7M B;  3V61 A;  1E8Z A;  3ZJT A;  1D4B A;  2JU6 X;  4B0M A;  3PRZ A;  2LJ5 A;  3PZD A;  2KMC A;  3R7R A;  3UIN B;  4WJO A;  3AE4 B;  1NBF C;  3AM9 A;  1ZE3 D;  4NJ7 A;  4W9K A;  1A70 A;  2AQ2 B;  2TSS A;  4HDQ A;  4TQ1 A;  2ASQ A;  4P6V F;  3FC4 A;  4KSL C;  4C00 A;  2E6X A;  2K8B A;  2MP2 B;  4OZB A;  3VTV A;  4L23 A;  1F1H A;  1LXD A;  3QCA A;  1FO4 A;  1R8G A;  2EEL A;  3AN1 A;  1JAL A;  4NJ6 A;  2LUE A;  1YN3 A;  3KUZ A;  4L2Y A;  1YIW A;  3W2D A;  4MJS B;  1UBQ A;  2LGS A;  1C1Y B;  1QQR A;  1GAQ B;  1I42 A;  4FUL A;  1EF1 A;  1I0E A;  3DBH B;  4DXA B;  4YTP B;  2YLM A;  5AZF A;  3VUX A;  2BQQ A;  2FE8 A;  4TQ0 A;  3T3N A;  2MBO A;  4K7U A;  1WJN A;  3M3J A;  1G0W A;  2D3G A;  1R4N B;  1XEE A;  4GIV A;  4OHJ A;  3T3O A;  2V0G A;  2QDF A;  4HRO A;  3DCG A;  2GBK A;  1UD7 A;  3UGB B;  4JWS C;  4KGR A;  1T0S C;  1UF0 A;  3B9J A;  3NS8 A;  1KTK A;  1DYQ A;  1J7C A;  3V62 A;  1FRR A;  4WQO B;  2E3T A;  2AWT A;  2R2O A;  3N1X C;  1SF0 A;  4RMA A;  5FK9 C;  1ZKH A;  3KWL A;  4N59 A;  4AOF A;  1Z2M A;  2WXR A;  2IO1 B;  1WZ0 A;  1EO6 A;  1PQS A;  3S2A A;  4E3C A;  5EE9 A;  1E9M A;  3UF8 A;  5G55 A;  3NJT A;  3DBR I;  1OFF A;  3RMK C;  1MG4 A;  2RD0 A;  1ZPS A;  1E7V A;  1WX7 A;  1N5W A;  4FHK A;  3B2F A;  4A8X C;  2M17 A;  2M19 A;  2EMS A;  3L4P A;  3PHX B;  2FID A;  4RF0 A;  1TJE A;  2WXL A;  1Y8R C;  5DPT A;  1D5M C;  3OWE B;  2G4D B;  2L1A A;  4JWU C;  5H92 C;  1TIF A;  3C19 A;  1UH6 A;  2W9N A;  4KDI C;  3A4R A;  1F52 A;  3SFD B;  3U8Z A;  2ZNV C;  2BVC A;  1EUV B;  1J19 A;  2O2V B;  2LRU A;  2WXI A;  2WXQ A;  1XF5 L;  2WXF A;  4FLH A;  5LXI B;  1WX8 A;  1KLU D;  3ML9 A;  2BTE A;  3L08 A;  1QK1 A;  4AWJ A;  2PMV A;  2K8H A;  3JQ3 A;  4IWQ A;  1L0Y B;  4HWI B;  1XLP A;  1Q10 A;  3KYC D;  1TKE A;  1PGB A;  3DQV A;  2WWZ A;  4IW0 A;  1JQ4 A;  3JPZ A;  5BMI A;  3GE8 C;  4KGT A;  1YQ3 B;  3BWU D;  4DDG D;  3AE6 B;  2K6D B;  2RMM A;  3MJW A;  2DWQ A;  2C7N B;  3CF6 E;  3AEC B;  3ZGZ A;  4AP4 C;  1XXG A;  3R7Q A;  4GN1 A;  3ABV B;  1KF6 B;  4DK5 A;  3O13 A;  1Q1O A;  1FFU A;  2LZ6 A;  2WX1 A;  4AUQ C;  2MCN B;  2MJD A;  1GC6 A;  3JSV A;  1N5X A;  5DPW A;  1HE8 A;  3NZS A;  2KAJ A;  4GDK B;  1DGJ A;  3OLM D;  3X0W A;  2K39 A;  2Q5W D;  2JZ3 B;  4AJW A;  3I63 C;  1R4M I;  3ZTD A;  3W1Y A;  3WCQ A;  2JYT A;  2XK5 A;  3DBL I;  4PT5 A;  1WGH A;  2QJL A;  2D10 A;  2M0A A;  2HTH A;  4KGS A;  1TY2 A;  1EWY C;  4WJQ A;  3APF A;  3I5J C;  5LXH A;  3EHV A;  4HK2 A;  2IO0 B;  2J0M A;  3EUB 2;  3ZLZ A;  4JE3 B;  2RR9 A;  3R8B A;  3BVM A;  2CHW A;  1JML A;  1V9J A;  3TEY A;  2ON8 A;  1E8X A;  2MA9 B;  1ISN A;  1GG3 A;  3Q8F A;  4KX6 B;  1UWM A;  2GMI C;  4UDU C;  4JL9 A;  4HXD A;  1V4G A;  3VQI A;  2KJR A;  4M0W B;  3EC8 A;  3SU8 X;  5JXV A;  2BYF A;  2Y5C A;  3BK2 A;  3ZRC A;  5CHW A;  3JYU A;  3KUC B;  5E6N A;  1K50 A;  3QIJ A;  3RD2 A;  4BKT A;  2C5L C;  4US9 A;  2PW9 A;  2CHZ A;  4YTN B;  3B1L X;  4LK0 M;  1TKG A;  2D33 A;  1WXA A;  4ICV A;  3ZYY X;  1SE2 A;  2N9L A;  2WNM A;  5IKC M;  3Q3J A;  2J4X A;  3Q3O C;  1L5P A;  3A9K A;  2L7R A;  3L13 A;  1C77 A;  5BMG A;  2XBB C;  4EZK A;  3BII D;  4W9C A;  3P63 A;  1CMX B;  1JW9 D;  4C4V B;  1K52 A;  4BHL A;  1MHH E;  1DOY A;  2D07 B;  1TTN A;  4WWO A;  4A3O A;  1C9F A;  3ML8 A;  2M8S A;  3QA8 A;  4FN2 A;  3VH3 B;  4FAD A;  4QAY A;  4HRS A;  1YX6 B;  2AQ3 B;  3ZUN A;  3TBL D;  1XO3 A;  3IAS 1;  4BBN C;  2DEN B;  3CSF A;  4AS1 A;  1WI0 A;  4C80 A;  3J9C A;  2I2Y A;  3DVG X;  2Y5B B;  3O65 B;  2D2Q A;  4HJK A;  3VVW B;  3H7P A;  1ZP0 B;  3Q6B A;  2NTS A;  3QAQ A;  3TL5 A;  3P4R B;  4GVZ A;  4IWP A;  4L1B A;  4BAX A;  5D3I B;  1YNT E;  2X38 A;  3MP9 A;  1M15 A;  2FUH B;  5D94 A;  1KOT A;  2O6V A;  1JWS D;  1WY8 A;  2GRI A;  2VRR B;  2ZVN A;  1VLB A;  2D3A A;  2IO2 B;  3ALB A;  4ARC A;  4EFO A;  2LXC A;  2VZK B;  5JHA A;  3ZIM A;  3KYD D;  4TKN A;  2OJR A;  2PVG C;  2WX0 A;  2BYE A;  2G9H D;  3IBE A;  4ANV A;  2H89 B;  2PVO D;  2HE7 A;  2NMQ A;  2RPQ A;  2QCZ A;  3OAW A;  1OQQ A;  1WFY A;  4H2A A;  3BYT B;  3Q8C A;  4S17 A;  3RFZ B;  2MHJ A;  1KM7 A;  2K3U A;  3NG0 A;  1UBI A;  4AM1 A;  4RGO S;  1V8C A;  5HG2 A;  1I4P A;  4B95 A;  3ZDM C;  1FD6 A;  2GOW A;  1TS2 A;  5JH5 C;  4W9H A;  1WM2 A;  3DHI C;  2JX5 A;  2WDT B;  1A5R A;  3SHQ A;  1GC7 A;  5FKA C;  3IXS A;  3QWZ B;  2LWP A;  3L2E B;  3NY5 A;  4HLE A;  2KDF B;  3PLV A;  3NZT A;  3IG8 A;  3MC9 A;  1P3Q U;  4XDC A;  1FFV A;  3PHW B;  3GS2 A;  2L00 B;  1T0Q C;  5KHO A;  3U2S C;  4LJP B;  2KC2 A;  1UWX A;  1ZDV A;  2ZJD A;  2J0K A;  4RF7 A;  1K8R B;  3L17 A;  3EA6 A;  2KX0 A;  1SBB B;  4DHJ B;  2FNJ B;  4O1N A;  3W5V B;  2BF8 B;  4X57 B;  2NBV B;  1XCQ L;  1FPY A;  4EZJ A;  2KFK A;  4JQW C;  3B0A A;  4K7W A;  1V81 A;  2KWD A;  1WMH B;  4M02 A;  4HCN B; 
#chains in the Genus database with same CATH homology
 3JU6 A;  4BHL A;  1G0W A;  2J1Q A;  3NG0 A;  1HTQ A;  2LGS A;  1RL9 A;  3L2E B;  3L2E A;  4AM1 A;  4BAX A;  1HTO A;  4GW0 A;  1BG0 A;  3DRE A;  4HPP A;  3B6R A;  4LNI A;  5J99 A;  3JPZ A;  4ACF A;  4S0R A;  1M15 A;  2CRK A;  5J9A A;  4LNN A;  4LNO A;  1I0E A;  3M10 A;  1F52 A;  2D3B A;  4BG4 B;  4BG4 A;  4GVY A;  1F1H A;  3ZXV A;  1VRP A;  4RF6 A;  2BVC A;  3L2D A;  2OJW A;  1FPY A;  3DRB A;  1CRK A;  3FKY A;  4Q2R A;  4Z9M A;  2UU7 A;  2QC8 A;  1QH4 A;  4LNF A;  1P52 A;  4GW2 A;  1SD0 A;  4RF8 A;  2D3A A;  2GLS A;  2WHI A;  1U6R A;  1QK1 A;  4GVZ A;  2D3C A;  1LGR A;  4XYC A;  4RF9 A;  3JQ3 A;  3ZXR A;  3JU5 A;  4RF7 A;  4S17 A;  4LNK A;  1P50 A;  2WGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...