1HTOA

Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE
total genus 149
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htoA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htoA01
1QK1A 1SD0A 4Q2RA 2QC8A 4AM1A 4GVYA 1F52A 4XYCA 1RL9A 2J1QA 4Z9MA 4S17A 1QH4A 1BG0A 1P50A 4S0RA 4LNOA 3DRBA 4BG4A 1LGRA 2UU7A 3JPZA 1FPYA 2BVCA 2WHIA 3JU5A 4LNIA 4BHLA 3FKYA 1HTOA 1P52A 3L2DA 5J99A 4LNNA 2D3CA 1U6RA 1CRKA 1VRPA 2LGSA 3M10A 4GW2A 4RF6A 2D3AA 4HPPA 4LNFA 3ZXVA 3JU6A 3ZXRA 5J9AA 3NG0A 4ACFA 3B6RA 4LNKA 1M15A 2CRKA 4BG4B 2D3BA 1F1HA 3JQ3A 2GLSA 1HTQA 4RF8A 2WGSA 4GVZA 3L2EA 4GW0A 3DREA 4RF9A 1G0WA 4RF7A 2OJWA 1I0EA 4BAXA 3L2EB
chains in the Genus database with same CATH superfamily
1C79A 3D32A 2WLBA 1KJTA 5G5GA 1RWSA 3Q3MC 3NZSA 2CKHB 2K25A 4W9HA 4NAWB 5JZEB 3WANA 4TQ0A 2QSDA 4G50A 2W55A 3Q2AC 1YJIA 1YQ4B 2C7MB 2TSSA 2WXMA 1J8CA 2LMCA 5KHOA 3A9KB 4EUTA 2OJRA 4LNIA 5C2TB 1TGZB 5J99A 1SE2A 3R8BA 3LB8C 1FEHA 2K22A 1BMLC 1MFWA 1JQ4A 3N9YC 1I35A 3K9OB 4W9CA 4YL8A 4ANUA 5HI1A 1IBXB 1RM6C 4P6VF 1BG0A 3AEFB 3HHMA 5L95C 4IWQA 1FXIA 1JROA 4C00A 1Y8RC 2X8XX 5E6JA 4XZ4A 2EKIA 2KN5A 3A9JA 3DVNU 3VDZA 4RF8A 3RT3B 3RNAC 4TUUA 1R4MI 1SF0A 3UIPB 4BKTA 2KJRA 1UWXA 5BMHA 2BKFA 1I42A 1MHXA 4MELA 1FXTB 2N1VA 2WXJA 2L52A 2CHXA 3TEZA 3NY5A 2WX1A 4IOIE 2AL6A 4NPNA 2M1MA 3U52E 3PV1A 2JZZA 3E56A 1KTKA 1JWUD 1HEZE 1K52A 2WYQA 4F8CB 1FXAA 4LK0M 2C5LC 4CYEA 3P4SB 2KO3A 2I2YA 1S1QB 2A4ZA 1VD2A 3RMKC 1E9MA 3ZJVA 2DZMA 1AW7A 1I7HA 1OQQA 1KLUD 3U2SC 3T3NA 1PFDA 3AEDB 1NI3A 4KSKC 3C19A 1R4MB 1YMHE 4CQNA 4K7UA 2BQQA 3HM3A 3Q8EA 4M00A 2RSUA 3ZRFA 2WXHA 3IBEA 2WXFA 2I1KA 3ZXVA 2J7QB 3NG0A 1PGXA 3NJTA 2JUOA 1E7PB 1WGKA 3LXFA 1IBXA 4LJPB 3BINA 2N4FA 3AV8A 3CIRB 4IDIA 4N58A 3R7RA 4ZRQA 4GVYA 1WZ3A 3WAMA 1GB1A 2QCZA 4J6IA 4MGZE 4RM9A 1RLFA 4A20A 2H88B 2KDFB 3W2DA 3FAHA 5CHVC 3A9KA 3VUYA 2D3BA 2Y5CA 1L0XB 2ZW0A 4WURA 4FJVB 4W9FA 3ZW3A 1L7YA 3TBLD 1P50A 2V3NA 1FPYA 1MJDA 2GWDA 4RCOA 3NS8A 2KC2A 1AYFA 2GLSA 2SAKA 3L16A 1XCQL 1E0ZA 1WF9A 3V62A 2DBYA 1C9FA 1QK1A 1R4NB 1GB4A 5DPRA 1XF5L 3HRDD 1WJ6A 1XT9B 4B95A 3NVWA 2HDEA 1UELA 3IAM1 5GMVA 1FCLA 1L4ZB 4C7YA 2KMAA 5EDSA 3BYYB 1CJEA 4HXDA 1H8CA 1XLNA 1V86A 4US9A 3N1ZC 3T9LA 2WX0A 3QK0A 5G5HA 2INPE 4HKQA 1WXMA 2KZRA 1T6BX 1WGHA 3TEYA 2CJOA 1FFVA 2V3PA 4KSLC 1B9RA 5T8IA 2CJNA 2JRHA 1XQQA 1LM8B 3J9CA 3NVYA 4KGTA 4II2B 1KFYB 4KDIC 2KDEB 4WJPA 3W1YA 1P7FA 4WQOB 1L2NA 3L4PA 3QJZA 2MBOA 4OVVA 2WDTB 3WAPA 1M4VA 2WP9B 1FD6A 2JT4B 3K9PB 2ONQA 4BFRA 5D3IB 3T8MA 4P1CC 2MEKA 3PS6A 4I6NB 4GDLB 2KANA 2IDYA 3FILA 3KWVA 3JQ3A 1V8CA 1TKEA 4MSMB 2JWZA 3L2EB 4JL9A 1C1YB 4WWPA 1EF1A 1I4RA 1V5OA 4GN1A 2RPVA 3QCAA 3AXCA 4QAYA 2PVOD 3IAS1 3A1QB 3ZNGC 4BZAA 4C56C 4LJOB 1EO6A 4PS3A 2RDHA 3B2FA 3PLVA 4RF7A 2ICIA 3I57A 2FUHB 1TS4A 4K7SA 2HJ1A 1TBEA 2R61A 1TZ1A 4AWJA 3DHIC 1MHHE 4F1SA 1WXAA 3IXSA 2IO2B 3ZDMC 3SHQA 4GLSC 4HK2A 2BF8B 2FAZA 4C80A 5CTRC 1A5RA 4CO7A 1ZGUB 3JSVB 3U30A 3AE9B 5JXVA 3RYTA 1E8ZA 2MP2B 2J0KA 1FNUA 2JX5A 3N1YC 5I4DA 2PE6B 4W9KA 3VVWB 1OQYA 1T5XD 2Z0EB 1QQRA 4BKGA 2LRWA 4KDLB 4BOSC 4MSQB 4L2YA 4WJNA 1NYRA 3A9JB 4R3DA 1QOBA 1X1MA 2FBWB 2VH2A 3KYDD 3AH7A 4MM3B 2DAJA 2DENB 2MSED 2N7DA 2AQ2B 1XLQA 2KD0A 3URYA 2QHOA 3H6NA 4NAMA 2AX5A 3R3MA 3NZUA 1WWTA 5C3JB 2PTLA 4KKJA 3HVDA 4N6EB 1E8XA 3QAQA 1E90A 1PDXA 3KH0A 1N5WA 2WS3B 4BBNC 4II3B 4C7ZA 1E7UA 2G1EA 4MGKE 3I5JC 3EUB2 4GGQA 4C4VB 2PIAA 4ZOHC 2DAFA 4MH0E 2GBRA 4EEWA 1GNUA 4NQKE 1OEYJ 1FIQA 3UINB 1ZPSA 2C7NB 3GS2A 1F9JA 4A6QA 2LGXA 3Q3NC 2J4XA 2KOXA 4GVZA 5AZGA 2WDQB 1Q0WB 3PHXB 4A3PA 4FJYA 3L10B 1D5XC 1FNWA 4TQ1A 2NBVB 2ZNVC 3Q8CA 2WXGA 1P0RA 3IT6B 2RR9A 2FIFA 3N3KB 4HCPB 4AQ7A 4WQMA 2L00B 3ZXRA 2JPHA 4OZBA 2JF5A 4W9DA 1YN3A 1TKGA 2KQ7A 4XX5A 2IY1B 1ZDXA 3NVVA 2Y3AA 4JWUC 1SSNA 4O1NA 3KUDB 1OQRA 2WXPA 3ZQ4A 2O6VD 3VH3B 3AE2B 2HE7A 3S2AA 1P3QU 3L54A 4I6LB 3TJPA 1K53A 2KWCA 2Y5PA 1R7SA 4ANVA 4MJSA 4ITKA 1N62A 3DQVA 1QOGA 3VH4B 4KVGB 1GAQB 4JGHB 1L6VA 1C4AA 2DZIA 1ET9A 4EKUA 2JXTA 3A1QA 3KWLA 3MJWA 3DVNV 4RGMA 3RN9C 2MH7A 3BVMA 2KXJA 3PZ8A 2O2VA 1V5TA 1VLBA 1MVKA 2KVRA 3M63B 3JVZX 1E8YA 1YJJA 2NR2A 2BS4B 2BGFA 3DWMA 4A8XC 2WGSA 5D94A 4USAA 2MJEA 2W3SA 3ZJUA 4EE2A 2O6VA 4X57B 1F2RI 4M8MA 3SFDB 3L0WB 2G9HD 2BW2A 1SB3C 2BYVE 2JRIB 4LDTD 1YOVB 3AE7B 4KKIA 2BS2B 2LXAA 5HKHA 1V1OA 2KWUB 4LCDE 1WIAA 1HXYD 2BT6A 4GU2A 3H7SA 2LXCA 3N1XC 5J17A 2VZKD 1XO3A 3EHVA 4JIOU 1SJHD 2MQJA 1G6JA 2N9KA 5DCNA 2D32A 1WGGA 3ZRCA 3AE6B 2LEKA 1RYJA 4WJOA 2KLCA 1JWSD 3ENEA 3NZ3A 3PREA 3ZKJC 3MHZA 3ZO5B 1XD3B 4S17A 2L32A 4REZA 1QH4A 1FO4A 3KUZA 1KH0A 3EGRA 2I38A 2LWPA 4ZRJA 2KLGA 4AJWA 2FCSA 2LASA 4JX1C 5H92C 4YXDB 3NZTA 2CS4A 4C4VA 4OVUA 3H7PB 1GJZA 4FHJA 3H1UA 3WIMA 4XDCA 1TKYA 2M19A 4L23A 2PPHA 3LVVA 1U6RA 3B1LX 2KJHB 3JW0X 5JHAA 4MJSB 3W5UB 2G4DB 3Q69A 4XDDA 1HE8A 1ISNA 2NS5A 3B0AA 2A5UA 1I4XA 2J52A 1UBQA 4M0WA 3JU6A 3L17A 4XE0A 2V4LA 1VJKA 3CF6E 1TS5A 4NJ7A 3TL5A 4M0WB 4XYCA 4EFOA 4DHJB 1FCCC 1KM7A 3IG3A 2ASQA 3WALA 1S3SG 2MW5A 2PJHA 4YSZB 4HCNB 3H7PA 4WWMA 4XC2A 1YIWA 3TEXA 1SXTA 2W54A 1P9DU 1Y56A 3H9DA 2XBBC 4A55A 1TYGB 4YSYB 4MT5A 2N9EB 4FXCA 2DZJA 2CRKA 4RMAA 1WX9A 3ML9A 1WRDB 1SIFA 4HKZE 4NNJB 5IA7A 1D5MC 5J18A 4GSWA 1AN8A 2QILA 5L83A 1KRHA 4WIPA 2DNFA 3NRZA 4OZCA 3FKYA 3DDCB 1IGCA 5TSSA 3AM9A 5BO4B 2R2OA 1IGDA 3WA0A 1FM0D 2OEDA 5AEKB 1LXDA 4RNAA 3RUIB 4OVZA 1WGRA 3AMZA 4DXAB 4IUMB 4EOYA 4AP4C 4PYUA 1ZE3D 3ZNZB 3SDLC 2GBJA 4HLEA 3JU5A 2N9PC 4ASWC 1NYQA 2HD5B 4KZ0A 2ZW1A 5GXGB 2MBBB 2KVZA 2RPQA 2V0GA 2R2QA 3O65B 3V3XA 2LRUA 4FJZA 4RFBA 3MC9A 5D3DA 1TT5B 2UWQA 2PMVA 2Z8LA 4TV3A 3WAOA 1WJUA 2DYBA 1C76A 3W9CB 1C4CA 1JWAD 2ZZPB 3Q8AA 1DOXA 2K39A 2L1AA 4KX6B 4A3OA 2D33A 3RULA 2G4SA 4E74A 4XGAB 3PGEA 3LDZE 2MRPA 3PT2B 1TJEA 1SJED 4BKSD 4BOZB 1PGBA 2EELA 1YN5A 2EMTA 1FNVA 2N0SB 3VQIA 4UDUC 2ZCBA 4DWFA 3GB1A 4F7ZA 1V1PB 1WJ4A 3H8HA 3KW5B 2KMCA 3W5VB 2KJ6A 5FK9C 2WU5B 4KV2A 3GOEA 3NOBA 4HEA1 3VRAB 5AZHA 5HHDG 2LHDA 2K6DB 2JYTA 1WR1A 1CK1A 2IGGA 1TZOA 2GBNA 2NBUA 2LGIA 3B2GA 1VDVA 2BVCA 2K6QA 2LVOA 2FCQA 1QT9A 2Z0DB 1J19A 3PLUA 2WXOA 1VCBA 2N9XA 4YTMB 3ZNHB 1YD8U 3ZGZA 3BZDB 1GC7A 1OGWA 3LJ3A 4ZHPA 3NHEB 2JU6X 3C8YA 4IKGA 4HVBA 2WXLA 4RM8A 4RF9A 2KK8A 1YQ3B 1TY2A 2V3SA 3IG8A 2QEJC 2L3ZA 4GXBA 4M01A 1KLGD 1JCKB 4ZRIA 3LYYA 1TTNA 4KZCA 1XLOA 5BYSA 3ZVVA 3ZJTA 4ANWA 1IPGA 5AUKA 1LFDA 3B6RA 3BIID 1NVID 1IP9A 5IO9A 3VR9B 3N20C 2REXA 3TCAA 1FRDA 1STEA 2L0FA 2UU7A 2Q5WD 1K51A 3RPFC 1UGJA 3OWEB 4LNNA 1UH6A 4P7IA 2PEAA 2FUG1 3Q3OC 1R8GA 1WM3A 4JE3B 3LN7A 3PHWB 3P1MA 3I63C 1N63A 3TEWA 1P1AA 2MBHA 3MC8A 1PUTA 4ARIA 2KT7A 1JRPA 1F0ZA 1XLPA 1UWMA 2N7JA 3AECB 3SR6A 1C3TA 2BB5A 1VZ7A 3E9SA 1RRBA 2MP2A 4LLGM 2FIDA 1I4GA 2GRIA 2AEHA 2YEPF 4NJ6A 5EE3A 3VTUA 2BS3B 1T3QA 3I3TB 3GZNB 3QA8A 5KHQA 2KQSA 1GPXA 1JALA 2IO0B 2INDC 2KFKB 1VZ6A 4E71A 2D3AA 1V97A 3NUHB 1WXVA 4WWNA 4KGRA 4HPLB 1WSPA 1A70A 2ZVNA 4HROA 1YNTE 2X38A 3NVZA 3SU8X 1OFFA 2IO1B 4I6PA 1L4DB 1GC6A 2LGDA 3P2BA 2FNJB 2KYWA 2IJ0A 3SFEB 3TUOA 4BVUC 3NS1A 2ZPNA 4EZJA 2WXRA 3R2TA 4FA6A 2BYFA 5TR5A 2H89B 2OJWA 3AB5A 2XK5A 2KFJA 3DBLB 2KKCA 2KTRA 1N6ZA 2M8SA 4W9JA 3UI3A 1WX8A 2DZKA 2KC1A 3BVZA 2BKRB 4YWGG 1EU4A 4M8NA 4OHJA 2V9HA 4WAAA 4G0NB 3X23A 4IW0A 1NEKB 3BK2A 1EM7A 3TMPB 1Z5SB 1T0QC 2QMTA 4IWOA 2B3AA 3V6EB 2GMIC 3KYCD 2C9WB 2O6VB 3GZNI 1EWCA 3I9V1 3AEGB 2N7EA 2GBKA 5DPTA 1BUIC 5E6NA 4K1RB 4PK1A 3DCGA 2PE9A 4G11A 1SE9A 3Q3FA 1JWMD 1V49A 1SE3A 4NQLB 5C1ZA 2KACA 4B9KA 1Z2MA 2IO3B 1KOTA 3N30A 1QF6A 2O2VB 2MBEA 5G2NA 4FN2A 4K3BA 3X0WA 5CHFA 4EZKA 2NBWB 1YQBA 3FILB 4E3CA 3AE1B 4ZRKA 5BYRA 1L0VB 3VTWA 1V4GA 2WWZA 4S0RA 2KTFA 3IVFA 1WX7A 4W9GA 2BTEA 1QZEA 1ZXHA 1YX5B 1IUEA 1RAXA 1IYFA 1EUVB 4JQWC 1FFUA 3ZTDA 3P63A 4MM3A 3ZTCA 4IM0A 2MBQA 5EE9A 3SD5A 1J7BA 2D11A 2NTSA 1WXSA 2BBCA 1WXQA 2XN9C 2E6XA 5BMIA 1Q5WB 3AU5A 2J0MA 1WGYA 2LGYA 4ICVA 3DVGX 2AQ1B 3MTNB 2LUEA 5LLIA 2FCMA 2IBIB 1TS3A 2ZPYA 1DOIA 1UF0A 3QIJA 4P1BC 1ET6A 5J2RA 2DYMA 4FBJB 4FADA 1RL9A 2D3GA 4KIKB 2PVGC 2OOBB 2KHWB 3EA6A 4N9F4 4US8A 4YTNB 1VRAB 2W3RA 3PTFC 2JQRB 3N32A 1GUAB 4D2KA 2JXXA 2KX0A 1MG8A 2PW9A 3O13A 1QLBB 1JW9D 3AEAB 4URKA 3QWZB 3PZDA 3QX1A 5BMGA 1L0YB 4BHLA 1PGAA 4TKNA 4XWTA 2ZEQA 2D3CA 1EU3A 1YJ1A 4GIVA 2WXNA 1UZXB 1F77A 2KDBA 1JWBD 1I4PA 1XCTL 1CMXB 4WWOA 1Q10A 2NPTA 2MCNB 2DLBA 3JYUA 2G3QB 2NMQA 3U7ZA 1NBFC 3OAWA 2CU3A 2BYTA 3R7QA 1ZXIA 3DWGC 4BG4A 4NJCA 2LJIA 1E7VA 3APDA 5DPSA 5IP4D 2BB6A 4BG4B 2VH1A 3DBRB 2KX3A 4JPSA 3IFWB 3QHTA 1ZOYB 2RMMA 4GDKA 3ZUNA 5DPWA 4ANXA 3JSVA 3VUXA 3BYTB 3MFGA 1WM2A 1L6UA 3C0RB 1SEBD 2E3TA 4LNFA 1V1PA 1UUPA 1N61A 4GOCA 4FLHA 1CQVA 1V9JA 2WDRB 4NY0A 1VZ8A 2I1JA 1QOFA 5AUIA 2LZ6A 1V80A 3W1SA 1ROEA 4EZLA 2IY0B 4ZDVA 3RFZB 2WXIA 1VR9A 2LVPA 1WE7A 5FKAC 1I4QA 3APCA 3ALBA 2EKEC 3HM6X 4KIKA 2IGDA 1JMLA 4DXGA 3PSEB 3HK0A 4YT0B 3DHHC 3RNGC 4XWWA 1D6EC 1WYGA 2JVCA 1HTOA 3PRZA 2FE8A 3OJ4B 3UF8A 4PS7A 3V61A 4GW2A 3GE3C 3VAWA 1XXGA 2BYEA 2JSVX 2K0PA 3ETRA 4AOFA 1ZW7A 2KQ4X 1WY8A 4MGYE 4Q2JA 4MACA 2RDBC 2DHZA 4AJYB 4K7WA 1JRUA 4TSSA 5IKCM 4LNOA 3Q6BA 5H8YE 4JWSC 4ICUA 3QARA 4IM3A 5J9AA 4HPMB 3DBRI 1AWDA 2RD0A 4DXFA 3GP7A 1D4BA 1ZUD2 4KGSA 1WRIA 2LD9A 1G0WA 3P42A 1K8RB 2HTME 1M94A 3RZWC 2IYDB 2WXKA 1WZ0A 3PZ7A 2ZJDA 3U7DA 2KFKA 2GBMA 2GB1A 1WMHB 5E6PA 3ZLZA 2MJ3A 1QOAA 2QIEB 1WGDA 3L2DA 1BXTA 2D5GA 2KDIA 4MEMA 1PYWD 4FHKA 2KAJA 2QJLA 3KQ4A 2PKOA 3R2IA 3M95A 1ZKHA 2KN4A 3T3OA 1I0EA 3KUCB 2ACZB 1DGJA 2J42A 3ABVB 1QKZA 1YX6B 2K1FA 4RGNA 4NAWA 1LQBA 1T0YA 4PS8A 1T0SC 3EECA 2J53A 1DYQA 2INNE 2VZKB 2CHZA 4JLCA 4ZHOA 2L05A 2K5PA 2MA9B 3AE3B 3HVZA 3V05A 4PYZA 4ZRPA 2JY6A 3CMMB 2K8HA 3VXWA 4AM1A 1N5XA 1ZP0B 1SE4A 3KVFB 2LJ5A 2WDVB 2V1YA 3QQ8B 1WMHA 1GOZA 4NZLB 2D2QA 2V4IB 3APFA 1Q1OA 2CU1A 2CHWA 3ECIA 5IOIA 1HZ5A 1HZ6A 3IG5A 1XEEA 2MJDA 1F52A 1E6EB 3VRBB 2K8CA 4N59A 2DYOA 2JZPA 3JPZA 1ZDVA 4DHJD 5BYQA 1J0GA 3UQBA 3AE5B 3RNEC 2YVCA 3AE8B 3AU4A 3WCQA 5LXHA 2WQYB 1C78A 1TS2A 2IGHA 1WYWB 3SEBA 2FCNA 4GDLA 1C4PA 2HJ8A 3L13A 3Q8FA 2D07B 2UYZB 4FULA 4DDID 3OG5A 3RZFA 2LGSA 3CSTA 1UD7A 3ONSA 3B08A 1TIFA 1WJNA 4G3XB 3DBHI 2XEWA 3PRMB 2YEPB 2KMMA 4OZAA 2EMSA 3OJ3A 4W9IA 2M0AA 3QC8B 3ZYYX 3DRBA 2KWVB 1BT0A 1SBBB 2DWQA 5E6OA 2M0XA 3BVGA 2CR5A 1WI0A 3TSSA 2JYEA 2NVUI 4WH4A 3AULA 1NDDA 1UNSA 2MLBA 3MP9A 3Q8BA 2MWSB 2N1WA 4ARCA 3PPAA 1WH3A 5AZFA 4DQOC 2AWTA 3EC8A 2C60A 1KLVA 2N9LA 2AQ3B 4J3OD 4M02A 2L8JA 2JZ3B 4YTPB 1HQRD 3AE4B 4RH6A 3IT4B 1U4AA 5JHBA 4HRSA 4BKSA 4GW0A 4ZYSA 4W9EA 2NCNA 1SD0A 2M4NA 3DBSA 1WR6E 3RD2A 3U4EG 4RF0A 1LO5D 2KWDA 3HIZA 1NENB 2LHEA 3DVGY 3KLSX 4HPPA 3A33B 4ACFA 3RCZA 2BPSA 1M15A 1J7CA 3UIOB 2GWCA 4DHZB 3AEBB 1FRRA 3DREA 1DOYA 4WAFA 3VUWA 1V6EA 4Z9MA 4WJQA 5EE0A 3M3JA 1MPEA 2ZVOA 2WHIA 4HWIB 2WXQA 2BWES 2KNBA 2JWUA 3AI5A 4RF1A 1OTRB 3RNFC 3DHGC 1C77A 5LXIB 3VR8B 1J7AA 3W1SC 5LNK1 3LN6A 4ZYNA 3U8ZA 3BWUD 2LVQA 1AARA 4H2AA 3DBHB 3CWIA 1LGRA 2M17A 3P4QB 4RGOS 4BBNF 5D6JB 3V60A 5JH5C 4GMVA 1VRPA 3B9JA 2DX5B 2Y5BB 3ML8A 3DBLI 1TT4A 4MGIE 1H4RA 1PQSA 2YLMA 2IPKD 4AUQC 4RF6A 2WU2B 4IC7B 4DHZE 2AL3A 4Q2RA 1T0RC 2ZNVB 3BK1A 3BY4B 5FR6A 4YSXB 5EE1A 3P4RB 2INCC 2ZCCA 3DOWA 2RGFA 3AN1A 2LFIA 1WE6A 1RFKA 2K8BA 3V6CB 1D3ZA 4HDOA 5IN7A 2HTHA 1HTQA 2W82A 3DPDA 3VTVA 1CZPA 1MG4A 4GDKB 5IAAC 5HFYA 3PVLA 2D10A 1UGMA 1D5ZC 1UBIA 3RNBC 3EFUA 2G45B 3PO0A 1SGHA 4MH8A 3VHTC 3RI7C 3ZNID 4L1BA 1N60A 2PLPA 1YN4A 4OW0A 2NTTA 4HJGE 1I4HA 2NPTB 2XNAC 2Z59B 2BWFA 2J1QA 4P16A 3HUIA 4K3CA 1F2RC 4B0EA 3Q3JA 3GE8C 3A4SC 3R66C 2L0TA 5MPOA 3M10A 2LI5A 1MI0A 1E5WA 1F1HA 1P7EA 2J0JA 4HJKA 2K9XA 3AEEB 4BAXA 4GB9A 1ENFA 2ON8A 2C7HA 1V81A 2VRRB 1P98A 3L08A 1EWYC 1FMAD 2KDMA 4IWPA 4RGTA 5CX3A 3MHSD 2GI9A 3FC4A 1RFAA 3LVWA 3VFKA 5CHWA 3ZDTA 2L7RA 3L2EA 2AYOB 2K3UA 3CSFA 4DBGA 2WNMA 4W9LA 1E10A 1VA6A 3UGBB 2SEBD 3UQAA 2KTRB 2W9NA 4A90A 2QDFA 1CRKA 3EFCA 2XK5B 1K50A 4LNKA 2MX2A 1R4NI 1ACCA 4MDKE 1E8WA 3ZIMA 2M56B 4A9AA 4IG7B 1QILA 2RDGA 2QC8A 4B0MA 4DDGD 1TY0A 4CHKA 3MJ5A 2L83A 3MC0B 5HG2A 2B76B 4PT5A 5D7GA 4DK5A 4LDTB 1P52A 2GOWA 1L5PA 5FR3A 3Q14C 1KF6B 1WFYA 1EF5A 1NI2A 3OLMD 1OEYA 1B1ZA 3M62B 2IZVB 4TMAB 3P4PB 5C23A 3PRPB 2L76A 2LUMA 1HA5A 4LTUA 1ESFA 3A4RA 3TIXA 5G55A 3RNCC 4HDQA 1GG3A 4IM2A 1V2YA 5D2MB 2OHFA 4AS1A 4K81A 2MHJA 3IHPC 4B6WA 1SIJA
chains in the Genus database with same CATH topology
1QK1A 1SD0A 4Q2RA 2QC8A 4AM1A 4GVYA 1F52A 4XYCA 1RL9A 2J1QA 4Z9MA 4S17A 1QH4A 1BG0A 1P50A 4S0RA 4LNOA 3DRBA 4BG4A 1LGRA 2UU7A 3JPZA 1FPYA 2BVCA 2WHIA 3JU5A 4LNIA 4BHLA 3FKYA 1HTOA 1P52A 3L2DA 5J99A 4LNNA 2D3CA 1U6RA 1CRKA 1VRPA 2LGSA 3M10A 4GW2A 4RF6A 2D3AA 4HPPA 4LNFA 3ZXVA 3JU6A 3ZXRA 5J9AA 3NG0A 4ACFA 3B6RA 4LNKA 1M15A 2CRKA 4BG4B 2D3BA 1F1HA 3JQ3A 2GLSA 1HTQA 4RF8A 2WGSA 4GVZA 3L2EA 4GW0A 3DREA 4RF9A 1G0WA 4RF7A 2OJWA 1I0EA 4BAXA 3L2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK1 A;  1SD0 A;  4Q2R A;  2QC8 A;  4AM1 A;  4GVY A;  1F52 A;  4XYC A;  1RL9 A;  2J1Q A;  4Z9M A;  4S17 A;  1QH4 A;  1BG0 A;  1P50 A;  4S0R A;  4LNO A;  3DRB A;  4BG4 A;  1LGR A;  2UU7 A;  3JPZ A;  1FPY A;  2BVC A;  2WHI A;  3JU5 A;  4LNI A;  4BHL A;  3FKY A;  1HTO A;  1P52 A;  3L2D A;  5J99 A;  4LNN A;  2D3C A;  1U6R A;  1CRK A;  1VRP A;  2LGS A;  3M10 A;  4GW2 A;  4RF6 A;  2D3A A;  4HPP A;  4LNF A;  3ZXV A;  3JU6 A;  3ZXR A;  5J9A A;  3NG0 A;  4ACF A;  3B6R A;  4LNK A;  1M15 A;  2CRK A;  4BG4 B;  2D3B A;  1F1H A;  3JQ3 A;  2GLS A;  1HTQ A;  4RF8 A;  2WGS A;  4GVZ A;  3L2E A;  4GW0 A;  3DRE A;  4RF9 A;  1G0W A;  4RF7 A;  2OJW A;  1I0E A;  4BAX A;  3L2E B; 
#chains in the Genus database with same CATH topology
 1C79 A;  3D32 A;  2WLB A;  1KJT A;  5G5G A;  1RWS A;  3Q3M C;  3NZS A;  2CKH B;  2K25 A;  4W9H A;  4NAW B;  5JZE B;  3WAN A;  4TQ0 A;  2QSD A;  4G50 A;  2W55 A;  3Q2A C;  1YJI A;  1YQ4 B;  2C7M B;  2TSS A;  2WXM A;  1J8C A;  2LMC A;  5KHO A;  3A9K B;  4EUT A;  2OJR A;  4LNI A;  5C2T B;  1TGZ B;  5J99 A;  1SE2 A;  3R8B A;  3LB8 C;  1FEH A;  2K22 A;  1BML C;  1MFW A;  1JQ4 A;  3N9Y C;  1I35 A;  3K9O B;  4W9C A;  4YL8 A;  4ANU A;  5HI1 A;  1IBX B;  1RM6 C;  4P6V F;  1BG0 A;  3AEF B;  3HHM A;  5L95 C;  4IWQ A;  1FXI A;  1JRO A;  4C00 A;  1Y8R C;  2X8X X;  5E6J A;  4XZ4 A;  2EKI A;  2KN5 A;  3A9J A;  3DVN U;  3VDZ A;  4RF8 A;  3RT3 B;  3RNA C;  4TUU A;  1R4M I;  1SF0 A;  3UIP B;  4BKT A;  2KJR A;  1UWX A;  5BMH A;  2BKF A;  1I42 A;  1MHX A;  4MEL A;  1FXT B;  2N1V A;  2WXJ A;  2L52 A;  2CHX A;  3TEZ A;  3NY5 A;  2WX1 A;  4IOI E;  2AL6 A;  4NPN A;  2M1M A;  3U52 E;  3PV1 A;  2JZZ A;  3E56 A;  1KTK A;  1JWU D;  1HEZ E;  1K52 A;  2WYQ A;  4F8C B;  1FXA A;  4LK0 M;  2C5L C;  4CYE A;  3P4S B;  2KO3 A;  2I2Y A;  1S1Q B;  2A4Z A;  1VD2 A;  3RMK C;  1E9M A;  3ZJV A;  2DZM A;  1AW7 A;  1I7H A;  1OQQ A;  1KLU D;  3U2S C;  3T3N A;  1PFD A;  3AED B;  1NI3 A;  4KSK C;  3C19 A;  1R4M B;  1YMH E;  4CQN A;  4K7U A;  2BQQ A;  3HM3 A;  3Q8E A;  4M00 A;  2RSU A;  3ZRF A;  2WXH A;  3IBE A;  2WXF A;  2I1K A;  3ZXV A;  2J7Q B;  3NG0 A;  1PGX A;  3NJT A;  2JUO A;  1E7P B;  1WGK A;  3LXF A;  1IBX A;  4LJP B;  3BIN A;  2N4F A;  3AV8 A;  3CIR B;  4IDI A;  4N58 A;  3R7R A;  4ZRQ A;  4GVY A;  1WZ3 A;  3WAM A;  1GB1 A;  2QCZ A;  4J6I A;  4MGZ E;  4RM9 A;  1RLF A;  4A20 A;  2H88 B;  2KDF B;  3W2D A;  3FAH A;  5CHV C;  3A9K A;  3VUY A;  2D3B A;  2Y5C A;  1L0X B;  2ZW0 A;  4WUR A;  4FJV B;  4W9F A;  3ZW3 A;  1L7Y A;  3TBL D;  1P50 A;  2V3N A;  1FPY A;  1MJD A;  2GWD A;  4RCO A;  3NS8 A;  2KC2 A;  1AYF A;  2GLS A;  2SAK A;  3L16 A;  1XCQ L;  1E0Z A;  1WF9 A;  3V62 A;  2DBY A;  1C9F A;  1QK1 A;  1R4N B;  1GB4 A;  5DPR A;  1XF5 L;  3HRD D;  1WJ6 A;  1XT9 B;  4B95 A;  3NVW A;  2HDE A;  1UEL A;  3IAM 1;  5GMV A;  1FCL A;  1L4Z B;  4C7Y A;  2KMA A;  5EDS A;  3BYY B;  1CJE A;  4HXD A;  1H8C A;  1XLN A;  1V86 A;  4US9 A;  3N1Z C;  3T9L A;  2WX0 A;  3QK0 A;  5G5H A;  2INP E;  4HKQ A;  1WXM A;  2KZR A;  1T6B X;  1WGH A;  3TEY A;  2CJO A;  1FFV A;  2V3P A;  4KSL C;  1B9R A;  5T8I A;  2CJN A;  2JRH A;  1XQQ A;  1LM8 B;  3J9C A;  3NVY A;  4KGT A;  4II2 B;  1KFY B;  4KDI C;  2KDE B;  4WJP A;  3W1Y A;  1P7F A;  4WQO B;  1L2N A;  3L4P A;  3QJZ A;  2MBO A;  4OVV A;  2WDT B;  3WAP A;  1M4V A;  2WP9 B;  1FD6 A;  2JT4 B;  3K9P B;  2ONQ A;  4BFR A;  5D3I B;  3T8M A;  4P1C C;  2MEK A;  3PS6 A;  4I6N B;  4GDL B;  2KAN A;  2IDY A;  3FIL A;  3KWV A;  3JQ3 A;  1V8C A;  1TKE A;  4MSM B;  2JWZ A;  3L2E B;  4JL9 A;  1C1Y B;  4WWP A;  1EF1 A;  1I4R A;  1V5O A;  4GN1 A;  2RPV A;  3QCA A;  3AXC A;  4QAY A;  2PVO D;  3IAS 1;  3A1Q B;  3ZNG C;  4BZA A;  4C56 C;  4LJO B;  1EO6 A;  4PS3 A;  2RDH A;  3B2F A;  3PLV A;  4RF7 A;  2ICI A;  3I57 A;  2FUH B;  1TS4 A;  4K7S A;  2HJ1 A;  1TBE A;  2R61 A;  1TZ1 A;  4AWJ A;  3DHI C;  1MHH E;  4F1S A;  1WXA A;  3IXS A;  2IO2 B;  3ZDM C;  3SHQ A;  4GLS C;  4HK2 A;  2BF8 B;  2FAZ A;  4C80 A;  5CTR C;  1A5R A;  4CO7 A;  1ZGU B;  3JSV B;  3U30 A;  3AE9 B;  5JXV A;  3RYT A;  1E8Z A;  2MP2 B;  2J0K A;  1FNU A;  2JX5 A;  3N1Y C;  5I4D A;  2PE6 B;  4W9K A;  3VVW B;  1OQY A;  1T5X D;  2Z0E B;  1QQR A;  4BKG A;  2LRW A;  4KDL B;  4BOS C;  4MSQ B;  4L2Y A;  4WJN A;  1NYR A;  3A9J B;  4R3D A;  1QOB A;  1X1M A;  2FBW B;  2VH2 A;  3KYD D;  3AH7 A;  4MM3 B;  2DAJ A;  2DEN B;  2MSE D;  2N7D A;  2AQ2 B;  1XLQ A;  2KD0 A;  3URY A;  2QHO A;  3H6N A;  4NAM A;  2AX5 A;  3R3M A;  3NZU A;  1WWT A;  5C3J B;  2PTL A;  4KKJ A;  3HVD A;  4N6E B;  1E8X A;  3QAQ A;  1E90 A;  1PDX A;  3KH0 A;  1N5W A;  2WS3 B;  4BBN C;  4II3 B;  4C7Z A;  1E7U A;  2G1E A;  4MGK E;  3I5J C;  3EUB 2;  4GGQ A;  4C4V B;  2PIA A;  4ZOH C;  2DAF A;  4MH0 E;  2GBR A;  4EEW A;  1GNU A;  4NQK E;  1OEY J;  1FIQ A;  3UIN B;  1ZPS A;  2C7N B;  3GS2 A;  1F9J A;  4A6Q A;  2LGX A;  3Q3N C;  2J4X A;  2KOX A;  4GVZ A;  5AZG A;  2WDQ B;  1Q0W B;  3PHX B;  4A3P A;  4FJY A;  3L10 B;  1D5X C;  1FNW A;  4TQ1 A;  2NBV B;  2ZNV C;  3Q8C A;  2WXG A;  1P0R A;  3IT6 B;  2RR9 A;  2FIF A;  3N3K B;  4HCP B;  4AQ7 A;  4WQM A;  2L00 B;  3ZXR A;  2JPH A;  4OZB A;  2JF5 A;  4W9D A;  1YN3 A;  1TKG A;  2KQ7 A;  4XX5 A;  2IY1 B;  1ZDX A;  3NVV A;  2Y3A A;  4JWU C;  1SSN A;  4O1N A;  3KUD B;  1OQR A;  2WXP A;  3ZQ4 A;  2O6V D;  3VH3 B;  3AE2 B;  2HE7 A;  3S2A A;  1P3Q U;  3L54 A;  4I6L B;  3TJP A;  1K53 A;  2KWC A;  2Y5P A;  1R7S A;  4ANV A;  4MJS A;  4ITK A;  1N62 A;  3DQV A;  1QOG A;  3VH4 B;  4KVG B;  1GAQ B;  4JGH B;  1L6V A;  1C4A A;  2DZI A;  1ET9 A;  4EKU A;  2JXT A;  3A1Q A;  3KWL A;  3MJW A;  3DVN V;  4RGM A;  3RN9 C;  2MH7 A;  3BVM A;  2KXJ A;  3PZ8 A;  2O2V A;  1V5T A;  1VLB A;  1MVK A;  2KVR A;  3M63 B;  3JVZ X;  1E8Y A;  1YJJ A;  2NR2 A;  2BS4 B;  2BGF A;  3DWM A;  4A8X C;  2WGS A;  5D94 A;  4USA A;  2MJE A;  2W3S A;  3ZJU A;  4EE2 A;  2O6V A;  4X57 B;  1F2R I;  4M8M A;  3SFD B;  3L0W B;  2G9H D;  2BW2 A;  1SB3 C;  2BYV E;  2JRI B;  4LDT D;  1YOV B;  3AE7 B;  4KKI A;  2BS2 B;  2LXA A;  5HKH A;  1V1O A;  2KWU B;  4LCD E;  1WIA A;  1HXY D;  2BT6 A;  4GU2 A;  3H7S A;  2LXC A;  3N1X C;  5J17 A;  2VZK D;  1XO3 A;  3EHV A;  4JIO U;  1SJH D;  2MQJ A;  1G6J A;  2N9K A;  5DCN A;  2D32 A;  1WGG A;  3ZRC A;  3AE6 B;  2LEK A;  1RYJ A;  4WJO A;  2KLC A;  1JWS D;  3ENE A;  3NZ3 A;  3PRE A;  3ZKJ C;  3MHZ A;  3ZO5 B;  1XD3 B;  4S17 A;  2L32 A;  4REZ A;  1QH4 A;  1FO4 A;  3KUZ A;  1KH0 A;  3EGR A;  2I38 A;  2LWP A;  4ZRJ A;  2KLG A;  4AJW A;  2FCS A;  2LAS A;  4JX1 C;  5H92 C;  4YXD B;  3NZT A;  2CS4 A;  4C4V A;  4OVU A;  3H7P B;  1GJZ A;  4FHJ A;  3H1U A;  3WIM A;  4XDC A;  1TKY A;  2M19 A;  4L23 A;  2PPH A;  3LVV A;  1U6R A;  3B1L X;  2KJH B;  3JW0 X;  5JHA A;  4MJS B;  3W5U B;  2G4D B;  3Q69 A;  4XDD A;  1HE8 A;  1ISN A;  2NS5 A;  3B0A A;  2A5U A;  1I4X A;  2J52 A;  1UBQ A;  4M0W A;  3JU6 A;  3L17 A;  4XE0 A;  2V4L A;  1VJK A;  3CF6 E;  1TS5 A;  4NJ7 A;  3TL5 A;  4M0W B;  4XYC A;  4EFO A;  4DHJ B;  1FCC C;  1KM7 A;  3IG3 A;  2ASQ A;  3WAL A;  1S3S G;  2MW5 A;  2PJH A;  4YSZ B;  4HCN B;  3H7P A;  4WWM A;  4XC2 A;  1YIW A;  3TEX A;  1SXT A;  2W54 A;  1P9D U;  1Y56 A;  3H9D A;  2XBB C;  4A55 A;  1TYG B;  4YSY B;  4MT5 A;  2N9E B;  4FXC A;  2DZJ A;  2CRK A;  4RMA A;  1WX9 A;  3ML9 A;  1WRD B;  1SIF A;  4HKZ E;  4NNJ B;  5IA7 A;  1D5M C;  5J18 A;  4GSW A;  1AN8 A;  2QIL A;  5L83 A;  1KRH A;  4WIP A;  2DNF A;  3NRZ A;  4OZC A;  3FKY A;  3DDC B;  1IGC A;  5TSS A;  3AM9 A;  5BO4 B;  2R2O A;  1IGD A;  3WA0 A;  1FM0 D;  2OED A;  5AEK B;  1LXD A;  4RNA A;  3RUI B;  4OVZ A;  1WGR A;  3AMZ A;  4DXA B;  4IUM B;  4EOY A;  4AP4 C;  4PYU A;  1ZE3 D;  3ZNZ B;  3SDL C;  2GBJ A;  4HLE A;  3JU5 A;  2N9P C;  4ASW C;  1NYQ A;  2HD5 B;  4KZ0 A;  2ZW1 A;  5GXG B;  2MBB B;  2KVZ A;  2RPQ A;  2V0G A;  2R2Q A;  3O65 B;  3V3X A;  2LRU A;  4FJZ A;  4RFB A;  3MC9 A;  5D3D A;  1TT5 B;  2UWQ A;  2PMV A;  2Z8L A;  4TV3 A;  3WAO A;  1WJU A;  2DYB A;  1C76 A;  3W9C B;  1C4C A;  1JWA D;  2ZZP B;  3Q8A A;  1DOX A;  2K39 A;  2L1A A;  4KX6 B;  4A3O A;  2D33 A;  3RUL A;  2G4S A;  4E74 A;  4XGA B;  3PGE A;  3LDZ E;  2MRP A;  3PT2 B;  1TJE A;  1SJE D;  4BKS D;  4BOZ B;  1PGB A;  2EEL A;  1YN5 A;  2EMT A;  1FNV A;  2N0S B;  3VQI A;  4UDU C;  2ZCB A;  4DWF A;  3GB1 A;  4F7Z A;  1V1P B;  1WJ4 A;  3H8H A;  3KW5 B;  2KMC A;  3W5V B;  2KJ6 A;  5FK9 C;  2WU5 B;  4KV2 A;  3GOE A;  3NOB A;  4HEA 1;  3VRA B;  5AZH A;  5HHD G;  2LHD A;  2K6D B;  2JYT A;  1WR1 A;  1CK1 A;  2IGG A;  1TZO A;  2GBN A;  2NBU A;  2LGI A;  3B2G A;  1VDV A;  2BVC A;  2K6Q A;  2LVO A;  2FCQ A;  1QT9 A;  2Z0D B;  1J19 A;  3PLU A;  2WXO A;  1VCB A;  2N9X A;  4YTM B;  3ZNH B;  1YD8 U;  3ZGZ A;  3BZD B;  1GC7 A;  1OGW A;  3LJ3 A;  4ZHP A;  3NHE B;  2JU6 X;  3C8Y A;  4IKG A;  4HVB A;  2WXL A;  4RM8 A;  4RF9 A;  2KK8 A;  1YQ3 B;  1TY2 A;  2V3S A;  3IG8 A;  2QEJ C;  2L3Z A;  4GXB A;  4M01 A;  1KLG D;  1JCK B;  4ZRI A;  3LYY A;  1TTN A;  4KZC A;  1XLO A;  5BYS A;  3ZVV A;  3ZJT A;  4ANW A;  1IPG A;  5AUK A;  1LFD A;  3B6R A;  3BII D;  1NVI D;  1IP9 A;  5IO9 A;  3VR9 B;  3N20 C;  2REX A;  3TCA A;  1FRD A;  1STE A;  2L0F A;  2UU7 A;  2Q5W D;  1K51 A;  3RPF C;  1UGJ A;  3OWE B;  4LNN A;  1UH6 A;  4P7I A;  2PEA A;  2FUG 1;  3Q3O C;  1R8G A;  1WM3 A;  4JE3 B;  3LN7 A;  3PHW B;  3P1M A;  3I63 C;  1N63 A;  3TEW A;  1P1A A;  2MBH A;  3MC8 A;  1PUT A;  4ARI A;  2KT7 A;  1JRP A;  1F0Z A;  1XLP A;  1UWM A;  2N7J A;  3AEC B;  3SR6 A;  1C3T A;  2BB5 A;  1VZ7 A;  3E9S A;  1RRB A;  2MP2 A;  4LLG M;  2FID A;  1I4G A;  2GRI A;  2AEH A;  2YEP F;  4NJ6 A;  5EE3 A;  3VTU A;  2BS3 B;  1T3Q A;  3I3T B;  3GZN B;  3QA8 A;  5KHQ A;  2KQS A;  1GPX A;  1JAL A;  2IO0 B;  2IND C;  2KFK B;  1VZ6 A;  4E71 A;  2D3A A;  1V97 A;  3NUH B;  1WXV A;  4WWN A;  4KGR A;  4HPL B;  1WSP A;  1A70 A;  2ZVN A;  4HRO A;  1YNT E;  2X38 A;  3NVZ A;  3SU8 X;  1OFF A;  2IO1 B;  4I6P A;  1L4D B;  1GC6 A;  2LGD A;  3P2B A;  2FNJ B;  2KYW A;  2IJ0 A;  3SFE B;  3TUO A;  4BVU C;  3NS1 A;  2ZPN A;  4EZJ A;  2WXR A;  3R2T A;  4FA6 A;  2BYF A;  5TR5 A;  2H89 B;  2OJW A;  3AB5 A;  2XK5 A;  2KFJ A;  3DBL B;  2KKC A;  2KTR A;  1N6Z A;  2M8S A;  4W9J A;  3UI3 A;  1WX8 A;  2DZK A;  2KC1 A;  3BVZ A;  2BKR B;  4YWG G;  1EU4 A;  4M8N A;  4OHJ A;  2V9H A;  4WAA A;  4G0N B;  3X23 A;  4IW0 A;  1NEK B;  3BK2 A;  1EM7 A;  3TMP B;  1Z5S B;  1T0Q C;  2QMT A;  4IWO A;  2B3A A;  3V6E B;  2GMI C;  3KYC D;  2C9W B;  2O6V B;  3GZN I;  1EWC A;  3I9V 1;  3AEG B;  2N7E A;  2GBK A;  5DPT A;  1BUI C;  5E6N A;  4K1R B;  4PK1 A;  3DCG A;  2PE9 A;  4G11 A;  1SE9 A;  3Q3F A;  1JWM D;  1V49 A;  1SE3 A;  4NQL B;  5C1Z A;  2KAC A;  4B9K A;  1Z2M A;  2IO3 B;  1KOT A;  3N30 A;  1QF6 A;  2O2V B;  2MBE A;  5G2N A;  4FN2 A;  4K3B A;  3X0W A;  5CHF A;  4EZK A;  2NBW B;  1YQB A;  3FIL B;  4E3C A;  3AE1 B;  4ZRK A;  5BYR A;  1L0V B;  3VTW A;  1V4G A;  2WWZ A;  4S0R A;  2KTF A;  3IVF A;  1WX7 A;  4W9G A;  2BTE A;  1QZE A;  1ZXH A;  1YX5 B;  1IUE A;  1RAX A;  1IYF A;  1EUV B;  4JQW C;  1FFU A;  3ZTD A;  3P63 A;  4MM3 A;  3ZTC A;  4IM0 A;  2MBQ A;  5EE9 A;  3SD5 A;  1J7B A;  2D11 A;  2NTS A;  1WXS A;  2BBC A;  1WXQ A;  2XN9 C;  2E6X A;  5BMI A;  1Q5W B;  3AU5 A;  2J0M A;  1WGY A;  2LGY A;  4ICV A;  3DVG X;  2AQ1 B;  3MTN B;  2LUE A;  5LLI A;  2FCM A;  2IBI B;  1TS3 A;  2ZPY A;  1DOI A;  1UF0 A;  3QIJ A;  4P1B C;  1ET6 A;  5J2R A;  2DYM A;  4FBJ B;  4FAD A;  1RL9 A;  2D3G A;  4KIK B;  2PVG C;  2OOB B;  2KHW B;  3EA6 A;  4N9F 4;  4US8 A;  4YTN B;  1VRA B;  2W3R A;  3PTF C;  2JQR B;  3N32 A;  1GUA B;  4D2K A;  2JXX A;  2KX0 A;  1MG8 A;  2PW9 A;  3O13 A;  1QLB B;  1JW9 D;  3AEA B;  4URK A;  3QWZ B;  3PZD A;  3QX1 A;  5BMG A;  1L0Y B;  4BHL A;  1PGA A;  4TKN A;  4XWT A;  2ZEQ A;  2D3C A;  1EU3 A;  1YJ1 A;  4GIV A;  2WXN A;  1UZX B;  1F77 A;  2KDB A;  1JWB D;  1I4P A;  1XCT L;  1CMX B;  4WWO A;  1Q10 A;  2NPT A;  2MCN B;  2DLB A;  3JYU A;  2G3Q B;  2NMQ A;  3U7Z A;  1NBF C;  3OAW A;  2CU3 A;  2BYT A;  3R7Q A;  1ZXI A;  3DWG C;  4BG4 A;  4NJC A;  2LJI A;  1E7V A;  3APD A;  5DPS A;  5IP4 D;  2BB6 A;  4BG4 B;  2VH1 A;  3DBR B;  2KX3 A;  4JPS A;  3IFW B;  3QHT A;  1ZOY B;  2RMM A;  4GDK A;  3ZUN A;  5DPW A;  4ANX A;  3JSV A;  3VUX A;  3BYT B;  3MFG A;  1WM2 A;  1L6U A;  3C0R B;  1SEB D;  2E3T A;  4LNF A;  1V1P A;  1UUP A;  1N61 A;  4GOC A;  4FLH A;  1CQV A;  1V9J A;  2WDR B;  4NY0 A;  1VZ8 A;  2I1J A;  1QOF A;  5AUI A;  2LZ6 A;  1V80 A;  3W1S A;  1ROE A;  4EZL A;  2IY0 B;  4ZDV A;  3RFZ B;  2WXI A;  1VR9 A;  2LVP A;  1WE7 A;  5FKA C;  1I4Q A;  3APC A;  3ALB A;  2EKE C;  3HM6 X;  4KIK A;  2IGD A;  1JML A;  4DXG A;  3PSE B;  3HK0 A;  4YT0 B;  3DHH C;  3RNG C;  4XWW A;  1D6E C;  1WYG A;  2JVC A;  1HTO A;  3PRZ A;  2FE8 A;  3OJ4 B;  3UF8 A;  4PS7 A;  3V61 A;  4GW2 A;  3GE3 C;  3VAW A;  1XXG A;  2BYE A;  2JSV X;  2K0P A;  3ETR A;  4AOF A;  1ZW7 A;  2KQ4 X;  1WY8 A;  4MGY E;  4Q2J A;  4MAC A;  2RDB C;  2DHZ A;  4AJY B;  4K7W A;  1JRU A;  4TSS A;  5IKC M;  4LNO A;  3Q6B A;  5H8Y E;  4JWS C;  4ICU A;  3QAR A;  4IM3 A;  5J9A A;  4HPM B;  3DBR I;  1AWD A;  2RD0 A;  4DXF A;  3GP7 A;  1D4B A;  1ZUD 2;  4KGS A;  1WRI A;  2LD9 A;  1G0W A;  3P42 A;  1K8R B;  2HTM E;  1M94 A;  3RZW C;  2IYD B;  2WXK A;  1WZ0 A;  3PZ7 A;  2ZJD A;  3U7D A;  2KFK A;  2GBM A;  2GB1 A;  1WMH B;  5E6P A;  3ZLZ A;  2MJ3 A;  1QOA A;  2QIE B;  1WGD A;  3L2D A;  1BXT A;  2D5G A;  2KDI A;  4MEM A;  1PYW D;  4FHK A;  2KAJ A;  2QJL A;  3KQ4 A;  2PKO A;  3R2I A;  3M95 A;  1ZKH A;  2KN4 A;  3T3O A;  1I0E A;  3KUC B;  2ACZ B;  1DGJ A;  2J42 A;  3ABV B;  1QKZ A;  1YX6 B;  2K1F A;  4RGN A;  4NAW A;  1LQB A;  1T0Y A;  4PS8 A;  1T0S C;  3EEC A;  2J53 A;  1DYQ A;  2INN E;  2VZK B;  2CHZ A;  4JLC A;  4ZHO A;  2L05 A;  2K5P A;  2MA9 B;  3AE3 B;  3HVZ A;  3V05 A;  4PYZ A;  4ZRP A;  2JY6 A;  3CMM B;  2K8H A;  3VXW A;  4AM1 A;  1N5X A;  1ZP0 B;  1SE4 A;  3KVF B;  2LJ5 A;  2WDV B;  2V1Y A;  3QQ8 B;  1WMH A;  1GOZ A;  4NZL B;  2D2Q A;  2V4I B;  3APF A;  1Q1O A;  2CU1 A;  2CHW A;  3ECI A;  5IOI A;  1HZ5 A;  1HZ6 A;  3IG5 A;  1XEE A;  2MJD A;  1F52 A;  1E6E B;  3VRB B;  2K8C A;  4N59 A;  2DYO A;  2JZP A;  3JPZ A;  1ZDV A;  4DHJ D;  5BYQ A;  1J0G A;  3UQB A;  3AE5 B;  3RNE C;  2YVC A;  3AE8 B;  3AU4 A;  3WCQ A;  5LXH A;  2WQY B;  1C78 A;  1TS2 A;  2IGH A;  1WYW B;  3SEB A;  2FCN A;  4GDL A;  1C4P A;  2HJ8 A;  3L13 A;  3Q8F A;  2D07 B;  2UYZ B;  4FUL A;  4DDI D;  3OG5 A;  3RZF A;  2LGS A;  3CST A;  1UD7 A;  3ONS A;  3B08 A;  1TIF A;  1WJN A;  4G3X B;  3DBH I;  2XEW A;  3PRM B;  2YEP B;  2KMM A;  4OZA A;  2EMS A;  3OJ3 A;  4W9I A;  2M0A A;  3QC8 B;  3ZYY X;  3DRB A;  2KWV B;  1BT0 A;  1SBB B;  2DWQ A;  5E6O A;  2M0X A;  3BVG A;  2CR5 A;  1WI0 A;  3TSS A;  2JYE A;  2NVU I;  4WH4 A;  3AUL A;  1NDD A;  1UNS A;  2MLB A;  3MP9 A;  3Q8B A;  2MWS B;  2N1W A;  4ARC A;  3PPA A;  1WH3 A;  5AZF A;  4DQO C;  2AWT A;  3EC8 A;  2C60 A;  1KLV A;  2N9L A;  2AQ3 B;  4J3O D;  4M02 A;  2L8J A;  2JZ3 B;  4YTP B;  1HQR D;  3AE4 B;  4RH6 A;  3IT4 B;  1U4A A;  5JHB A;  4HRS A;  4BKS A;  4GW0 A;  4ZYS A;  4W9E A;  2NCN A;  1SD0 A;  2M4N A;  3DBS A;  1WR6 E;  3RD2 A;  3U4E G;  4RF0 A;  1LO5 D;  2KWD A;  3HIZ A;  1NEN B;  2LHE A;  3DVG Y;  3KLS X;  4HPP A;  3A33 B;  4ACF A;  3RCZ A;  2BPS A;  1M15 A;  1J7C A;  3UIO B;  2GWC A;  4DHZ B;  3AEB B;  1FRR A;  3DRE A;  1DOY A;  4WAF A;  3VUW A;  1V6E A;  4Z9M A;  4WJQ A;  5EE0 A;  3M3J A;  1MPE A;  2ZVO A;  2WHI A;  4HWI B;  2WXQ A;  2BWE S;  2KNB A;  2JWU A;  3AI5 A;  4RF1 A;  1OTR B;  3RNF C;  3DHG C;  1C77 A;  5LXI B;  3VR8 B;  1J7A A;  3W1S C;  5LNK 1;  3LN6 A;  4ZYN A;  3U8Z A;  3BWU D;  2LVQ A;  1AAR A;  4H2A A;  3DBH B;  3CWI A;  1LGR A;  2M17 A;  3P4Q B;  4RGO S;  4BBN F;  5D6J B;  3V60 A;  5JH5 C;  4GMV A;  1VRP A;  3B9J A;  2DX5 B;  2Y5B B;  3ML8 A;  3DBL I;  1TT4 A;  4MGI E;  1H4R A;  1PQS A;  2YLM A;  2IPK D;  4AUQ C;  4RF6 A;  2WU2 B;  4IC7 B;  4DHZ E;  2AL3 A;  4Q2R A;  1T0R C;  2ZNV B;  3BK1 A;  3BY4 B;  5FR6 A;  4YSX B;  5EE1 A;  3P4R B;  2INC C;  2ZCC A;  3DOW A;  2RGF A;  3AN1 A;  2LFI A;  1WE6 A;  1RFK A;  2K8B A;  3V6C B;  1D3Z A;  4HDO A;  5IN7 A;  2HTH A;  1HTQ A;  2W82 A;  3DPD A;  3VTV A;  1CZP A;  1MG4 A;  4GDK B;  5IAA C;  5HFY A;  3PVL A;  2D10 A;  1UGM A;  1D5Z C;  1UBI A;  3RNB C;  3EFU A;  2G45 B;  3PO0 A;  1SGH A;  4MH8 A;  3VHT C;  3RI7 C;  3ZNI D;  4L1B A;  1N60 A;  2PLP A;  1YN4 A;  4OW0 A;  2NTT A;  4HJG E;  1I4H A;  2NPT B;  2XNA C;  2Z59 B;  2BWF A;  2J1Q A;  4P16 A;  3HUI A;  4K3C A;  1F2R C;  4B0E A;  3Q3J A;  3GE8 C;  3A4S C;  3R66 C;  2L0T A;  5MPO A;  3M10 A;  2LI5 A;  1MI0 A;  1E5W A;  1F1H A;  1P7E A;  2J0J A;  4HJK A;  2K9X A;  3AEE B;  4BAX A;  4GB9 A;  1ENF A;  2ON8 A;  2C7H A;  1V81 A;  2VRR B;  1P98 A;  3L08 A;  1EWY C;  1FMA D;  2KDM A;  4IWP A;  4RGT A;  5CX3 A;  3MHS D;  2GI9 A;  3FC4 A;  1RFA A;  3LVW A;  3VFK A;  5CHW A;  3ZDT A;  2L7R A;  3L2E A;  2AYO B;  2K3U A;  3CSF A;  4DBG A;  2WNM A;  4W9L A;  1E10 A;  1VA6 A;  3UGB B;  2SEB D;  3UQA A;  2KTR B;  2W9N A;  4A90 A;  2QDF A;  1CRK A;  3EFC A;  2XK5 B;  1K50 A;  4LNK A;  2MX2 A;  1R4N I;  1ACC A;  4MDK E;  1E8W A;  3ZIM A;  2M56 B;  4A9A A;  4IG7 B;  1QIL A;  2RDG A;  2QC8 A;  4B0M A;  4DDG D;  1TY0 A;  4CHK A;  3MJ5 A;  2L83 A;  3MC0 B;  5HG2 A;  2B76 B;  4PT5 A;  5D7G A;  4DK5 A;  4LDT B;  1P52 A;  2GOW A;  1L5P A;  5FR3 A;  3Q14 C;  1KF6 B;  1WFY A;  1EF5 A;  1NI2 A;  3OLM D;  1OEY A;  1B1Z A;  3M62 B;  2IZV B;  4TMA B;  3P4P B;  5C23 A;  3PRP B;  2L76 A;  2LUM A;  1HA5 A;  4LTU A;  1ESF A;  3A4R A;  3TIX A;  5G55 A;  3RNC C;  4HDQ A;  1GG3 A;  4IM2 A;  1V2Y A;  5D2M B;  2OHF A;  4AS1 A;  4K81 A;  2MHJ A;  3IHP C;  4B6W A;  1SIJ A; 
#chains in the Genus database with same CATH homology
 1QK1 A;  1SD0 A;  4Q2R A;  2QC8 A;  4AM1 A;  4GVY A;  1F52 A;  4XYC A;  1RL9 A;  2J1Q A;  4Z9M A;  4S17 A;  1QH4 A;  1BG0 A;  1P50 A;  4S0R A;  4LNO A;  3DRB A;  4BG4 A;  1LGR A;  2UU7 A;  3JPZ A;  1FPY A;  2BVC A;  2WHI A;  3JU5 A;  4LNI A;  4BHL A;  3FKY A;  1HTO A;  1P52 A;  3L2D A;  5J99 A;  4LNN A;  2D3C A;  1U6R A;  1CRK A;  1VRP A;  2LGS A;  3M10 A;  4GW2 A;  4RF6 A;  2D3A A;  4HPP A;  4LNF A;  3ZXV A;  3JU6 A;  3ZXR A;  5J9A A;  3NG0 A;  4ACF A;  3B6R A;  4LNK A;  1M15 A;  2CRK A;  4BG4 B;  2D3B A;  1F1H A;  3JQ3 A;  2GLS A;  1HTQ A;  4RF8 A;  2WGS A;  4GVZ A;  3L2E A;  4GW0 A;  3DRE A;  4RF9 A;  1G0W A;  4RF7 A;  2OJW A;  1I0E A;  4BAX A;  3L2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...