3DRBA

Crystal structure of human brain-type creatine kinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
376
Chain Sequence
SHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Creatine kinase B-type
total genus 128
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3drbA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3drbA02
4RF9A 4BG4B 3NG0A 1FPYA 2CRKA 5J99A 3ZXRA 3ZXVA 1CRKA 3JQ3A 4Q2RA 4BG4A 2BVCA 1U6RA 1P50A 3JPZA 2WGSA 4LNKA 3L2EA 2WHIA 1RL9A 1P52A 4LNOA 4RF8A 1I0EA 4GVZA 2LGSA 2GLSA 3JU5A 3DRBA 1QH4A 4BHLA 4ACFA 1HTQA 1LGRA 4Z9MA 1G0WA 4RF7A 4AM1A 5J9AA 1F1HA 4LNIA 4HPPA 4S17A 4S0RA 1BG0A 3JU6A 3L2DA 2J1QA 3B6RA 4GVYA 1QK1A 4LNFA 3M10A 4GW2A 4LNNA 1VRPA 3L2EB 4XYCA 1SD0A 4GW0A 1HTOA 1F52A 4RF6A 3DREA 1M15A
chains in the Genus database with same CATH superfamily
1CRKA 3LN6A 4Q2RA 3JPZA 2WHIA 2GWDA 2D32A 4GVZA 2LGSA 3JU5A 3DRBA 4ACFA 3IG5A 1BG0A 2D3AA 2J1QA 1QK1A 3M10A 1VRPA 2OJWA 4XYCA 4GW0A 1HTOA 4BG4B 3NG0A 1FPYA 5J99A 2D33A 3ZXVA 4LNKA 3L2EA 1RL9A 4LNOA 3FKYA 2GLSA 1LGRA 4Z9MA 4AM1A 1F1HA 1V4GA 4LNIA 3JU6A 3L2DA 4LNFA 4GW2A 3L2EB 1SD0A 2WGSA 4RF9A 2CRKA 3IG8A 3JQ3A 3LVVA 1P50A 1TT4A 1P52A 2D3CA 4BAXA 1QH4A 4BHLA 1HTQA 4RF7A 4S0RA 4HPPA 4S17A 3LVWA 3B6RA 4LNNA 1VA6A 5J9AA 4RF6A 3DREA 2GWCA 3LN7A 2D3BA 3ZXRA 2BVCA 4BG4A 1U6RA 3NZTA 4RF8A 1I0EA 2QC8A 1G0WA 1R8GA 2UU7A 4GVYA 1F52A 1M15A
chains in the Genus database with same CATH topology
4RF9A 4BG4B 3NG0A 1FPYA 2CRKA 5J99A 3ZXRA 3ZXVA 1CRKA 3JQ3A 4Q2RA 4BG4A 2BVCA 1U6RA 1P50A 3JPZA 2WGSA 4LNKA 3L2EA 2WHIA 1RL9A 1P52A 4LNOA 4RF8A 1I0EA 4GVZA 2LGSA 2GLSA 3JU5A 3DRBA 1QH4A 4BHLA 4ACFA 1HTQA 1LGRA 4Z9MA 1G0WA 4RF7A 4AM1A 5J9AA 1F1HA 4LNIA 4HPPA 4S17A 4S0RA 1BG0A 3JU6A 3L2DA 2J1QA 3B6RA 4GVYA 1QK1A 4LNFA 3M10A 4GW2A 4LNNA 1VRPA 3L2EB 4XYCA 1SD0A 4GW0A 1HTOA 1F52A 4RF6A 3DREA 1M15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF9 A;  4BG4 B;  3NG0 A;  1FPY A;  2CRK A;  5J99 A;  3ZXR A;  3ZXV A;  1CRK A;  3JQ3 A;  4Q2R A;  4BG4 A;  2BVC A;  1U6R A;  1P50 A;  3JPZ A;  2WGS A;  4LNK A;  3L2E A;  2WHI A;  1RL9 A;  1P52 A;  4LNO A;  4RF8 A;  1I0E A;  4GVZ A;  2LGS A;  2GLS A;  3JU5 A;  3DRB A;  1QH4 A;  4BHL A;  4ACF A;  1HTQ A;  1LGR A;  4Z9M A;  1G0W A;  4RF7 A;  4AM1 A;  5J9A A;  1F1H A;  4LNI A;  4HPP A;  4S17 A;  4S0R A;  1BG0 A;  3JU6 A;  3L2D A;  2J1Q A;  3B6R A;  4GVY A;  1QK1 A;  4LNF A;  3M10 A;  4GW2 A;  4LNN A;  1VRP A;  3L2E B;  4XYC A;  1SD0 A;  4GW0 A;  1HTO A;  1F52 A;  4RF6 A;  3DRE A;  1M15 A; 
#chains in the Genus database with same CATH topology
 1CRK A;  3LN6 A;  4Q2R A;  3JPZ A;  2WHI A;  2GWD A;  2D32 A;  4GVZ A;  2LGS A;  3JU5 A;  3DRB A;  4ACF A;  3IG5 A;  1BG0 A;  2D3A A;  2J1Q A;  1QK1 A;  3M10 A;  1VRP A;  2OJW A;  4XYC A;  4GW0 A;  1HTO A;  4BG4 B;  3NG0 A;  1FPY A;  5J99 A;  2D33 A;  3ZXV A;  4LNK A;  3L2E A;  1RL9 A;  4LNO A;  3FKY A;  2GLS A;  1LGR A;  4Z9M A;  4AM1 A;  1F1H A;  1V4G A;  4LNI A;  3JU6 A;  3L2D A;  4LNF A;  4GW2 A;  3L2E B;  1SD0 A;  2WGS A;  4RF9 A;  2CRK A;  3IG8 A;  3JQ3 A;  3LVV A;  1P50 A;  1TT4 A;  1P52 A;  2D3C A;  4BAX A;  1QH4 A;  4BHL A;  1HTQ A;  4RF7 A;  4S0R A;  4HPP A;  4S17 A;  3LVW A;  3B6R A;  4LNN A;  1VA6 A;  5J9A A;  4RF6 A;  3DRE A;  2GWC A;  3LN7 A;  2D3B A;  3ZXR A;  2BVC A;  4BG4 A;  1U6R A;  3NZT A;  4RF8 A;  1I0E A;  2QC8 A;  1G0W A;  1R8G A;  2UU7 A;  4GVY A;  1F52 A;  1M15 A; 
#chains in the Genus database with same CATH homology
 4RF9 A;  4BG4 B;  3NG0 A;  1FPY A;  2CRK A;  5J99 A;  3ZXR A;  3ZXV A;  1CRK A;  3JQ3 A;  4Q2R A;  4BG4 A;  2BVC A;  1U6R A;  1P50 A;  3JPZ A;  2WGS A;  4LNK A;  3L2E A;  2WHI A;  1RL9 A;  1P52 A;  4LNO A;  4RF8 A;  1I0E A;  4GVZ A;  2LGS A;  2GLS A;  3JU5 A;  3DRB A;  1QH4 A;  4BHL A;  4ACF A;  1HTQ A;  1LGR A;  4Z9M A;  1G0W A;  4RF7 A;  4AM1 A;  5J9A A;  1F1H A;  4LNI A;  4HPP A;  4S17 A;  4S0R A;  1BG0 A;  3JU6 A;  3L2D A;  2J1Q A;  3B6R A;  4GVY A;  1QK1 A;  4LNF A;  3M10 A;  4GW2 A;  4LNN A;  1VRP A;  3L2E B;  4XYC A;  1SD0 A;  4GW0 A;  1HTO A;  1F52 A;  4RF6 A;  3DRE A;  1M15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...