4Z9MA

Crystal structure of human sarcomeric mitochondrial creatine kinase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
352
structure length
352
Chain Sequence
RLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human sarcomeric mitochondrial creatine kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Creatine kinase S-type, mitochondrial
total genus 115
structure length 352
sequence length 352
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4z9mA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4z9mA02
4ACFA 4GVZA 1CRKA 2GLSA 4LNOA 3JU5A 3L2EB 4BG4A 1F1HA 2J1QA 1I0EA 3DREA 3M10A 4LNFA 1HTOA 1VRPA 4HPPA 4LNKA 5J9AA 4LNIA 3B6RA 3ZXVA 4LNNA 3ZXRA 1QK1A 4BHLA 1QH4A 4AM1A 3JU6A 4S17A 1LGRA 4Q2RA 3JPZA 4RF9A 4Z9MA 4RF8A 2LGSA 1SD0A 2BVCA 4GVYA 4GW0A 1F52A 4RF7A 3L2EA 4BG4B 4RF6A 2WGSA 1P50A 1HTQA 4S0RA 1RL9A 3L2DA 4XYCA 1P52A 1BG0A 2WHIA 3NG0A 4GW2A 2CRKA 3DRBA 3JQ3A 1M15A 1G0WA 5J99A 1FPYA 1U6RA
chains in the Genus database with same CATH superfamily
2D3CA 2GLSA 4LNOA 3L2EB 4BG4A 2J1QA 1HTOA 4HPPA 4LNKA 5J9AA 4LNNA 3ZXRA 1QH4A 4AM1A 3JU6A 1LGRA 4Q2RA 3JPZA 4RF9A 4Z9MA 1SD0A 4GVYA 3LN6A 3L2EA 4BG4B 2WGSA 1P50A 3IG8A 4BAXA 3NG0A 1M15A 2GWCA 2QC8A 4GVZA 1CRKA 1VA6A 3DREA 3M10A 4LNFA 2GWDA 3LN7A 4BHLA 4S17A 1F52A 3IG5A 3LVWA 4S0RA 1RL9A 3JQ3A 1FPYA 1U6RA 3JU5A 3FKYA 1I0EA 4LNIA 1VRPA 1TT4A 2D3BA 3B6RA 1V4GA 2LGSA 2UU7A 2BVCA 4RF7A 1R8GA 4RF6A 1HTQA 2OJWA 4XYCA 1BG0A 2WHIA 3DRBA 4ACFA 3LVVA 1F1HA 3ZXVA 1QK1A 4RF8A 4GW0A 2D32A 2D33A 3NZTA 2D3AA 3L2DA 1P52A 4GW2A 2CRKA 1G0WA 5J99A
chains in the Genus database with same CATH topology
4ACFA 4GVZA 1CRKA 2GLSA 4LNOA 3JU5A 3L2EB 4BG4A 1F1HA 2J1QA 1I0EA 3DREA 3M10A 4LNFA 1HTOA 1VRPA 4HPPA 4LNKA 5J9AA 4LNIA 3B6RA 3ZXVA 4LNNA 3ZXRA 1QK1A 4BHLA 1QH4A 4AM1A 3JU6A 4S17A 1LGRA 4Q2RA 3JPZA 4RF9A 4Z9MA 4RF8A 2LGSA 1SD0A 2BVCA 4GVYA 4GW0A 1F52A 4RF7A 3L2EA 4BG4B 4RF6A 2WGSA 1P50A 1HTQA 4S0RA 1RL9A 3L2DA 4XYCA 1P52A 1BG0A 2WHIA 3NG0A 4GW2A 2CRKA 3DRBA 3JQ3A 1M15A 1G0WA 5J99A 1FPYA 1U6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACF A;  4GVZ A;  1CRK A;  2GLS A;  4LNO A;  3JU5 A;  3L2E B;  4BG4 A;  1F1H A;  2J1Q A;  1I0E A;  3DRE A;  3M10 A;  4LNF A;  1HTO A;  1VRP A;  4HPP A;  4LNK A;  5J9A A;  4LNI A;  3B6R A;  3ZXV A;  4LNN A;  3ZXR A;  1QK1 A;  4BHL A;  1QH4 A;  4AM1 A;  3JU6 A;  4S17 A;  1LGR A;  4Q2R A;  3JPZ A;  4RF9 A;  4Z9M A;  4RF8 A;  2LGS A;  1SD0 A;  2BVC A;  4GVY A;  4GW0 A;  1F52 A;  4RF7 A;  3L2E A;  4BG4 B;  4RF6 A;  2WGS A;  1P50 A;  1HTQ A;  4S0R A;  1RL9 A;  3L2D A;  4XYC A;  1P52 A;  1BG0 A;  2WHI A;  3NG0 A;  4GW2 A;  2CRK A;  3DRB A;  3JQ3 A;  1M15 A;  1G0W A;  5J99 A;  1FPY A;  1U6R A; 
#chains in the Genus database with same CATH topology
 2D3C A;  2GLS A;  4LNO A;  3L2E B;  4BG4 A;  2J1Q A;  1HTO A;  4HPP A;  4LNK A;  5J9A A;  4LNN A;  3ZXR A;  1QH4 A;  4AM1 A;  3JU6 A;  1LGR A;  4Q2R A;  3JPZ A;  4RF9 A;  4Z9M A;  1SD0 A;  4GVY A;  3LN6 A;  3L2E A;  4BG4 B;  2WGS A;  1P50 A;  3IG8 A;  4BAX A;  3NG0 A;  1M15 A;  2GWC A;  2QC8 A;  4GVZ A;  1CRK A;  1VA6 A;  3DRE A;  3M10 A;  4LNF A;  2GWD A;  3LN7 A;  4BHL A;  4S17 A;  1F52 A;  3IG5 A;  3LVW A;  4S0R A;  1RL9 A;  3JQ3 A;  1FPY A;  1U6R A;  3JU5 A;  3FKY A;  1I0E A;  4LNI A;  1VRP A;  1TT4 A;  2D3B A;  3B6R A;  1V4G A;  2LGS A;  2UU7 A;  2BVC A;  4RF7 A;  1R8G A;  4RF6 A;  1HTQ A;  2OJW A;  4XYC A;  1BG0 A;  2WHI A;  3DRB A;  4ACF A;  3LVV A;  1F1H A;  3ZXV A;  1QK1 A;  4RF8 A;  4GW0 A;  2D32 A;  2D33 A;  3NZT A;  2D3A A;  3L2D A;  1P52 A;  4GW2 A;  2CRK A;  1G0W A;  5J99 A; 
#chains in the Genus database with same CATH homology
 4ACF A;  4GVZ A;  1CRK A;  2GLS A;  4LNO A;  3JU5 A;  3L2E B;  4BG4 A;  1F1H A;  2J1Q A;  1I0E A;  3DRE A;  3M10 A;  4LNF A;  1HTO A;  1VRP A;  4HPP A;  4LNK A;  5J9A A;  4LNI A;  3B6R A;  3ZXV A;  4LNN A;  3ZXR A;  1QK1 A;  4BHL A;  1QH4 A;  4AM1 A;  3JU6 A;  4S17 A;  1LGR A;  4Q2R A;  3JPZ A;  4RF9 A;  4Z9M A;  4RF8 A;  2LGS A;  1SD0 A;  2BVC A;  4GVY A;  4GW0 A;  1F52 A;  4RF7 A;  3L2E A;  4BG4 B;  4RF6 A;  2WGS A;  1P50 A;  1HTQ A;  4S0R A;  1RL9 A;  3L2D A;  4XYC A;  1P52 A;  1BG0 A;  2WHI A;  3NG0 A;  4GW2 A;  2CRK A;  3DRB A;  3JQ3 A;  1M15 A;  1G0W A;  5J99 A;  1FPY A;  1U6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...