4RF8A

Crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with adp
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
711
structure length
686
Chain Sequence
b'DPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine kinase
publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
total genus 241
structure length 686
sequence length 711
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf8A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf8A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf8A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf8A04
1QK1A 4ACFA 4Q2RA 4RF7A 3L2EA 4RF8A 3ZXRA 1P50A 3L2EB 3JPZA 1QH4A 4GVZA 4BG4A 4BG4B 1RL9A 3DRBA 4GVYA 4LNNA 1CRKA 1FPYA 2J1QA 2BVCA 4LNIA 1BG0A 2CRKA 4S17A 1I0EA 1SD0A 4S0RA 1HTOA 1LGRA 3JQ3A 3B6RA 1VRPA 2GLSA 3NG0A 3L2DA 4XYCA 5J99A 3M10A 4AM1A 4BHLA 4GW0A 1F52A 4RF6A 2LGSA 1P52A 1G0WA 4LNFA 1HTQA 2WHIA 1F1HA 4GW2A 3DREA 3JU5A 4HPPA 4RF9A 1U6RA 4Z9MA 3ZXVA 1M15A 4LNKA 3JU6A 5J9AA 4LNOA 2WGSA
chains in the Genus database with same CATH superfamily
3L2EA 1P50A 3LN6A 2QC8A 4LNNA 2CRKA 4S0RA 3JQ3A 4XYCA 5J99A 3M10A 4RF6A 2LGSA 1G0WA 2GWDA 1F1HA 4GW2A 2D33A 1U6RA 4Z9MA 3JU6A 5J9AA 3LVVA 4Q2RA 3ZXRA 4BG4B 1CRKA 1FPYA 4LNIA 4S17A 1I0EA 1SD0A 1HTOA 3NZTA 1TT4A 2D3BA 4LNKA 1QK1A 4ACFA 3L2EB 1QH4A 4GVZA 3DRBA 2J1QA 3LN7A 3FKYA 1BG0A 2UU7A 1LGRA 1R8GA 1VRPA 3NG0A 4AM1A 4BHLA 4GW0A 3IG8A 1P52A 2WHIA 3DREA 4RF9A 1M15A 2D32A 2WGSA 4RF7A 4RF8A 3JPZA 4BG4A 1V4GA 1RL9A 1VA6A 4GVYA 2BVCA 2GWCA 2OJWA 4BAXA 3B6RA 2GLSA 2D3AA 3L2DA 1F52A 4LNFA 1HTQA 3LVWA 4HPPA 3JU5A 2D3CA 3ZXVA 3IG5A 4LNOA
chains in the Genus database with same CATH topology
1QK1A 4ACFA 4Q2RA 4RF7A 3L2EA 4RF8A 3ZXRA 1P50A 3L2EB 3JPZA 1QH4A 4GVZA 4BG4A 4BG4B 1RL9A 3DRBA 4GVYA 4LNNA 1CRKA 1FPYA 2J1QA 2BVCA 4LNIA 1BG0A 2CRKA 4S17A 1I0EA 1SD0A 4S0RA 1HTOA 1LGRA 3JQ3A 3B6RA 1VRPA 2GLSA 3NG0A 3L2DA 4XYCA 5J99A 3M10A 4AM1A 4BHLA 4GW0A 1F52A 4RF6A 2LGSA 1P52A 1G0WA 4LNFA 1HTQA 2WHIA 1F1HA 4GW2A 3DREA 3JU5A 4HPPA 4RF9A 1U6RA 4Z9MA 3ZXVA 1M15A 4LNKA 3JU6A 5J9AA 4LNOA 2WGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK1 A;  4ACF A;  4Q2R A;  4RF7 A;  3L2E A;  4RF8 A;  3ZXR A;  1P50 A;  3L2E B;  3JPZ A;  1QH4 A;  4GVZ A;  4BG4 A;  4BG4 B;  1RL9 A;  3DRB A;  4GVY A;  4LNN A;  1CRK A;  1FPY A;  2J1Q A;  2BVC A;  4LNI A;  1BG0 A;  2CRK A;  4S17 A;  1I0E A;  1SD0 A;  4S0R A;  1HTO A;  1LGR A;  3JQ3 A;  3B6R A;  1VRP A;  2GLS A;  3NG0 A;  3L2D A;  4XYC A;  5J99 A;  3M10 A;  4AM1 A;  4BHL A;  4GW0 A;  1F52 A;  4RF6 A;  2LGS A;  1P52 A;  1G0W A;  4LNF A;  1HTQ A;  2WHI A;  1F1H A;  4GW2 A;  3DRE A;  3JU5 A;  4HPP A;  4RF9 A;  1U6R A;  4Z9M A;  3ZXV A;  1M15 A;  4LNK A;  3JU6 A;  5J9A A;  4LNO A;  2WGS A; 
#chains in the Genus database with same CATH topology
 3L2E A;  1P50 A;  3LN6 A;  2QC8 A;  4LNN A;  2CRK A;  4S0R A;  3JQ3 A;  4XYC A;  5J99 A;  3M10 A;  4RF6 A;  2LGS A;  1G0W A;  2GWD A;  1F1H A;  4GW2 A;  2D33 A;  1U6R A;  4Z9M A;  3JU6 A;  5J9A A;  3LVV A;  4Q2R A;  3ZXR A;  4BG4 B;  1CRK A;  1FPY A;  4LNI A;  4S17 A;  1I0E A;  1SD0 A;  1HTO A;  3NZT A;  1TT4 A;  2D3B A;  4LNK A;  1QK1 A;  4ACF A;  3L2E B;  1QH4 A;  4GVZ A;  3DRB A;  2J1Q A;  3LN7 A;  3FKY A;  1BG0 A;  2UU7 A;  1LGR A;  1R8G A;  1VRP A;  3NG0 A;  4AM1 A;  4BHL A;  4GW0 A;  3IG8 A;  1P52 A;  2WHI A;  3DRE A;  4RF9 A;  1M15 A;  2D32 A;  2WGS A;  4RF7 A;  4RF8 A;  3JPZ A;  4BG4 A;  1V4G A;  1RL9 A;  1VA6 A;  4GVY A;  2BVC A;  2GWC A;  2OJW A;  4BAX A;  3B6R A;  2GLS A;  2D3A A;  3L2D A;  1F52 A;  4LNF A;  1HTQ A;  3LVW A;  4HPP A;  3JU5 A;  2D3C A;  3ZXV A;  3IG5 A;  4LNO A; 
#chains in the Genus database with same CATH homology
 1QK1 A;  4ACF A;  4Q2R A;  4RF7 A;  3L2E A;  4RF8 A;  3ZXR A;  1P50 A;  3L2E B;  3JPZ A;  1QH4 A;  4GVZ A;  4BG4 A;  4BG4 B;  1RL9 A;  3DRB A;  4GVY A;  4LNN A;  1CRK A;  1FPY A;  2J1Q A;  2BVC A;  4LNI A;  1BG0 A;  2CRK A;  4S17 A;  1I0E A;  1SD0 A;  4S0R A;  1HTO A;  1LGR A;  3JQ3 A;  3B6R A;  1VRP A;  2GLS A;  3NG0 A;  3L2D A;  4XYC A;  5J99 A;  3M10 A;  4AM1 A;  4BHL A;  4GW0 A;  1F52 A;  4RF6 A;  2LGS A;  1P52 A;  1G0W A;  4LNF A;  1HTQ A;  2WHI A;  1F1H A;  4GW2 A;  3DRE A;  3JU5 A;  4HPP A;  4RF9 A;  1U6R A;  4Z9M A;  3ZXV A;  1M15 A;  4LNK A;  3JU6 A;  5J9A A;  4LNO A;  2WGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...