4RF8A

Crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with adp
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
711
structure length
686
Chain Sequence
DPETAAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGHNSDMNPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKHTSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a double-domain phosphagen kinase reveals an asymmetric arrangement of the tandem domains.
pubmed doi rcsb
source organism Anthopleura japonica
molecule tags Transferase
molecule keywords Arginine kinase
total genus 241
structure length 686
sequence length 711
chains with identical sequence B
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf8A01
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4rf8A03
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf8A02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4rf8A04
1SD0A 1U6RA 3JU5A 4GVZA 3JU6A 3L2EA 1F52A 4RF9A 3DRBA 3JQ3A 4Q2RA 4RF7A 1F1HA 1FPYA 2J1QA 4GVYA 1G0WA 4GW2A 2WGSA 3NG0A 3B6RA 5J9AA 4LNNA 3ZXVA 4XYCA 4HPPA 1CRKA 4GW0A 1BG0A 4Z9MA 3ZXRA 3DREA 3L2DA 4LNOA 3L2EB 2GLSA 2CRKA 1P50A 4LNKA 4ACFA 1VRPA 4BG4B 4BHLA 2WHIA 1QH4A 4S0RA 5J99A 2BVCA 4S17A 1I0EA 1RL9A 3JPZA 4RF8A 2LGSA 3M10A 4LNFA 4RF6A 4AM1A 1HTQA 1M15A 1LGRA 1QK1A 4LNIA 4BG4A 1HTOA 1P52A
chains in the Genus database with same CATH superfamily
4GVZA 1U6RA 3JU6A 4RF7A 2GWDA 3JQ3A 3IG5A 4GW2A 2D3AA 2OJWA 4HPPA 2QC8A 1BG0A 3NZTA 3LN7A 2WHIA 1QH4A 1RL9A 4RF8A 4RF6A 3LVVA 1LGRA 4LNIA 1VA6A 2UU7A 1F52A 3DRBA 3FKYA 5J9AA 4XYCA 1CRKA 3L2DA 3L2EB 4BHLA 2D33A 2D3CA 2D3BA 1M15A 1TT4A 1QK1A 1HTOA 4BG4B 1P52A 3JU5A 3L2EA 4RF9A 4Q2RA 1FPYA 3LVWA 3IG8A 3NG0A 4LNNA 3ZXRA 3DREA 4LNOA 2CRKA 4ACFA 5J99A 4S17A 1I0EA 3M10A 4LNFA 1SD0A 1R8GA 1F1HA 2J1QA 2D32A 4GVYA 1G0WA 2WGSA 3B6RA 3ZXVA 4BAXA 4GW0A 4Z9MA 2GLSA 1P50A 4LNKA 1VRPA 2GWCA 1V4GA 4S0RA 3LN6A 2BVCA 3JPZA 2LGSA 4AM1A 1HTQA 4BG4A
chains in the Genus database with same CATH topology
1SD0A 1U6RA 3JU5A 4GVZA 3JU6A 3L2EA 1F52A 4RF9A 3DRBA 3JQ3A 4Q2RA 4RF7A 1F1HA 1FPYA 2J1QA 4GVYA 1G0WA 4GW2A 2WGSA 3NG0A 3B6RA 5J9AA 4LNNA 3ZXVA 4XYCA 4HPPA 1CRKA 4GW0A 1BG0A 4Z9MA 3ZXRA 3DREA 3L2DA 4LNOA 3L2EB 2GLSA 2CRKA 1P50A 4LNKA 4ACFA 1VRPA 4BG4B 4BHLA 2WHIA 1QH4A 4S0RA 5J99A 2BVCA 4S17A 1I0EA 1RL9A 3JPZA 4RF8A 2LGSA 3M10A 4LNFA 4RF6A 4AM1A 1HTQA 1M15A 1LGRA 1QK1A 4LNIA 4BG4A 1HTOA 1P52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD0 A;  1U6R A;  3JU5 A;  4GVZ A;  3JU6 A;  3L2E A;  1F52 A;  4RF9 A;  3DRB A;  3JQ3 A;  4Q2R A;  4RF7 A;  1F1H A;  1FPY A;  2J1Q A;  4GVY A;  1G0W A;  4GW2 A;  2WGS A;  3NG0 A;  3B6R A;  5J9A A;  4LNN A;  3ZXV A;  4XYC A;  4HPP A;  1CRK A;  4GW0 A;  1BG0 A;  4Z9M A;  3ZXR A;  3DRE A;  3L2D A;  4LNO A;  3L2E B;  2GLS A;  2CRK A;  1P50 A;  4LNK A;  4ACF A;  1VRP A;  4BG4 B;  4BHL A;  2WHI A;  1QH4 A;  4S0R A;  5J99 A;  2BVC A;  4S17 A;  1I0E A;  1RL9 A;  3JPZ A;  4RF8 A;  2LGS A;  3M10 A;  4LNF A;  4RF6 A;  4AM1 A;  1HTQ A;  1M15 A;  1LGR A;  1QK1 A;  4LNI A;  4BG4 A;  1HTO A;  1P52 A; 
#chains in the Genus database with same CATH topology
 4GVZ A;  1U6R A;  3JU6 A;  4RF7 A;  2GWD A;  3JQ3 A;  3IG5 A;  4GW2 A;  2D3A A;  2OJW A;  4HPP A;  2QC8 A;  1BG0 A;  3NZT A;  3LN7 A;  2WHI A;  1QH4 A;  1RL9 A;  4RF8 A;  4RF6 A;  3LVV A;  1LGR A;  4LNI A;  1VA6 A;  2UU7 A;  1F52 A;  3DRB A;  3FKY A;  5J9A A;  4XYC A;  1CRK A;  3L2D A;  3L2E B;  4BHL A;  2D33 A;  2D3C A;  2D3B A;  1M15 A;  1TT4 A;  1QK1 A;  1HTO A;  4BG4 B;  1P52 A;  3JU5 A;  3L2E A;  4RF9 A;  4Q2R A;  1FPY A;  3LVW A;  3IG8 A;  3NG0 A;  4LNN A;  3ZXR A;  3DRE A;  4LNO A;  2CRK A;  4ACF A;  5J99 A;  4S17 A;  1I0E A;  3M10 A;  4LNF A;  1SD0 A;  1R8G A;  1F1H A;  2J1Q A;  2D32 A;  4GVY A;  1G0W A;  2WGS A;  3B6R A;  3ZXV A;  4BAX A;  4GW0 A;  4Z9M A;  2GLS A;  1P50 A;  4LNK A;  1VRP A;  2GWC A;  1V4G A;  4S0R A;  3LN6 A;  2BVC A;  3JPZ A;  2LGS A;  4AM1 A;  1HTQ A;  4BG4 A; 
#chains in the Genus database with same CATH homology
 1SD0 A;  1U6R A;  3JU5 A;  4GVZ A;  3JU6 A;  3L2E A;  1F52 A;  4RF9 A;  3DRB A;  3JQ3 A;  4Q2R A;  4RF7 A;  1F1H A;  1FPY A;  2J1Q A;  4GVY A;  1G0W A;  4GW2 A;  2WGS A;  3NG0 A;  3B6R A;  5J9A A;  4LNN A;  3ZXV A;  4XYC A;  4HPP A;  1CRK A;  4GW0 A;  1BG0 A;  4Z9M A;  3ZXR A;  3DRE A;  3L2D A;  4LNO A;  3L2E B;  2GLS A;  2CRK A;  1P50 A;  4LNK A;  4ACF A;  1VRP A;  4BG4 B;  4BHL A;  2WHI A;  1QH4 A;  4S0R A;  5J99 A;  2BVC A;  4S17 A;  1I0E A;  1RL9 A;  3JPZ A;  4RF8 A;  2LGS A;  3M10 A;  4LNF A;  4RF6 A;  4AM1 A;  1HTQ A;  1M15 A;  1LGR A;  1QK1 A;  4LNI A;  4BG4 A;  1HTO A;  1P52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...