3JU5A

Crystal structure of dimeric arginine kinase at 1.75-a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
369
structure length
363
Chain Sequence
ANLNQKKYPAKDDFPNFEGHKSLLSKYLTADMYAKLRDVATPSGYTLDRAIQNGVDNPDFHLGLLAGDEETYTVFADLFDPVIEEYHNGFKKTDNHKTDLDASKILDDVLDPAYVISSRVRTGRNIRGMALSPHVCRSERRAIEKMVSEALNSLAADLKGKYYSLMKMDEKTQQQLIDDHFLFDRPVSRHFTSGGMARDFPDGRGIWHNDKKNFLVWINEEDHTRIISMQMGGNMKEVFERFTRGLTEVEKHIKDKTGKEFMKNDHLGFVLTCPSNLGTGVRCSVHAKLPHMAKDKRFEEICTKMRLQKRGTSVGGVYDISNLDRLGSSEVEQVNCVIKGVKVLIEMEKKLEKGESIDDLVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a reciprocating mechanism of negative cooperativity in dimeric phosphagen kinase activity
pubmed doi rcsb
source organism Apostichopus japonicus
molecule tags Transferase
molecule keywords Arginine kinase
total genus 119
structure length 363
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3ju5A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3ju5A02
2GLSA 4LNOA 1P52A 1FPYA 1LGRA 4RF8A 4RF7A 1VRPA 4AM1A 1F1HA 4LNNA 3M10A 4S17A 4Q2RA 3JU5A 1G0WA 4GW2A 1HTOA 4ACFA 2WGSA 4BHLA 2LGSA 4XYCA 4BG4B 1HTQA 2J1QA 1BG0A 1U6RA 1F52A 1RL9A 3L2EB 4Z9MA 3DRBA 2WHIA 3B6RA 1SD0A 4GVZA 4RF9A 3DREA 4GW0A 1CRKA 4RF6A 3ZXRA 4LNIA 3JQ3A 1P50A 2CRKA 1M15A 5J99A 4S0RA 4GVYA 5J9AA 1QK1A 3L2EA 2BVCA 4BG4A 3NG0A 4HPPA 4LNKA 4LNFA 1I0EA 3JPZA 3JU6A 3ZXVA 1QH4A 3L2DA
chains in the Genus database with same CATH superfamily
1P52A 4RF7A 3LVVA 4Q2RA 1G0WA 4BHLA 4XYCA 1R8GA 1U6RA 2D33A 4RF6A 3ZXRA 2D3CA 3JQ3A 2OJWA 3LVWA 5J9AA 1QK1A 3L2EA 2BVCA 3JU6A 3L2DA 1FPYA 4RF8A 4AM1A 3JU5A 2D3BA 4GW2A 4ACFA 2J1QA 1F52A 1RL9A 3L2EB 4Z9MA 2WHIA 4RF9A 3DREA 4LNIA 1M15A 2D32A 3NG0A 1TT4A 4LNFA 1I0EA 1QH4A 3LN6A 4LNOA 1LGRA 4LNNA 1F1HA 3M10A 1VA6A 2LGSA 4BG4B 1HTQA 1SD0A 2GWDA 2D3AA 3NZTA 4BAXA 2CRKA 3LN7A 5J99A 4S0RA 4HPPA 4LNKA 3JPZA 3ZXVA 2GLSA 2QC8A 4S17A 1VRPA 2UU7A 1HTOA 2WGSA 3IG8A 1BG0A 2GWCA 3IG5A 3DRBA 3B6RA 4GVZA 1V4GA 4GW0A 1CRKA 1P50A 4GVYA 4BG4A 3FKYA
chains in the Genus database with same CATH topology
2GLSA 4LNOA 1P52A 1FPYA 1LGRA 4RF8A 4RF7A 1VRPA 4AM1A 1F1HA 4LNNA 3M10A 4S17A 4Q2RA 3JU5A 1G0WA 4GW2A 1HTOA 4ACFA 2WGSA 4BHLA 2LGSA 4XYCA 4BG4B 1HTQA 2J1QA 1BG0A 1U6RA 1F52A 1RL9A 3L2EB 4Z9MA 3DRBA 2WHIA 3B6RA 1SD0A 4GVZA 4RF9A 3DREA 4GW0A 1CRKA 4RF6A 3ZXRA 4LNIA 3JQ3A 1P50A 2CRKA 1M15A 5J99A 4S0RA 4GVYA 5J9AA 1QK1A 3L2EA 2BVCA 4BG4A 3NG0A 4HPPA 4LNKA 4LNFA 1I0EA 3JPZA 3JU6A 3ZXVA 1QH4A 3L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLS A;  4LNO A;  1P52 A;  1FPY A;  1LGR A;  4RF8 A;  4RF7 A;  1VRP A;  4AM1 A;  1F1H A;  4LNN A;  3M10 A;  4S17 A;  4Q2R A;  3JU5 A;  1G0W A;  4GW2 A;  1HTO A;  4ACF A;  2WGS A;  4BHL A;  2LGS A;  4XYC A;  4BG4 B;  1HTQ A;  2J1Q A;  1BG0 A;  1U6R A;  1F52 A;  1RL9 A;  3L2E B;  4Z9M A;  3DRB A;  2WHI A;  3B6R A;  1SD0 A;  4GVZ A;  4RF9 A;  3DRE A;  4GW0 A;  1CRK A;  4RF6 A;  3ZXR A;  4LNI A;  3JQ3 A;  1P50 A;  2CRK A;  1M15 A;  5J99 A;  4S0R A;  4GVY A;  5J9A A;  1QK1 A;  3L2E A;  2BVC A;  4BG4 A;  3NG0 A;  4HPP A;  4LNK A;  4LNF A;  1I0E A;  3JPZ A;  3JU6 A;  3ZXV A;  1QH4 A;  3L2D A; 
#chains in the Genus database with same CATH topology
 1P52 A;  4RF7 A;  3LVV A;  4Q2R A;  1G0W A;  4BHL A;  4XYC A;  1R8G A;  1U6R A;  2D33 A;  4RF6 A;  3ZXR A;  2D3C A;  3JQ3 A;  2OJW A;  3LVW A;  5J9A A;  1QK1 A;  3L2E A;  2BVC A;  3JU6 A;  3L2D A;  1FPY A;  4RF8 A;  4AM1 A;  3JU5 A;  2D3B A;  4GW2 A;  4ACF A;  2J1Q A;  1F52 A;  1RL9 A;  3L2E B;  4Z9M A;  2WHI A;  4RF9 A;  3DRE A;  4LNI A;  1M15 A;  2D32 A;  3NG0 A;  1TT4 A;  4LNF A;  1I0E A;  1QH4 A;  3LN6 A;  4LNO A;  1LGR A;  4LNN A;  1F1H A;  3M10 A;  1VA6 A;  2LGS A;  4BG4 B;  1HTQ A;  1SD0 A;  2GWD A;  2D3A A;  3NZT A;  4BAX A;  2CRK A;  3LN7 A;  5J99 A;  4S0R A;  4HPP A;  4LNK A;  3JPZ A;  3ZXV A;  2GLS A;  2QC8 A;  4S17 A;  1VRP A;  2UU7 A;  1HTO A;  2WGS A;  3IG8 A;  1BG0 A;  2GWC A;  3IG5 A;  3DRB A;  3B6R A;  4GVZ A;  1V4G A;  4GW0 A;  1CRK A;  1P50 A;  4GVY A;  4BG4 A;  3FKY A; 
#chains in the Genus database with same CATH homology
 2GLS A;  4LNO A;  1P52 A;  1FPY A;  1LGR A;  4RF8 A;  4RF7 A;  1VRP A;  4AM1 A;  1F1H A;  4LNN A;  3M10 A;  4S17 A;  4Q2R A;  3JU5 A;  1G0W A;  4GW2 A;  1HTO A;  4ACF A;  2WGS A;  4BHL A;  2LGS A;  4XYC A;  4BG4 B;  1HTQ A;  2J1Q A;  1BG0 A;  1U6R A;  1F52 A;  1RL9 A;  3L2E B;  4Z9M A;  3DRB A;  2WHI A;  3B6R A;  1SD0 A;  4GVZ A;  4RF9 A;  3DRE A;  4GW0 A;  1CRK A;  4RF6 A;  3ZXR A;  4LNI A;  3JQ3 A;  1P50 A;  2CRK A;  1M15 A;  5J99 A;  4S0R A;  4GVY A;  5J9A A;  1QK1 A;  3L2E A;  2BVC A;  4BG4 A;  3NG0 A;  4HPP A;  4LNK A;  4LNF A;  1I0E A;  3JPZ A;  3JU6 A;  3ZXV A;  1QH4 A;  3L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...