2QC8A

Crystal structure of human glutamine synthetase in complex with adp and methionine sulfoximine phosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 356
sequence length 356
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2qc8A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2qc8A02
4S0RA 4LNOA 2QC8A 4XYCA 1F52A 3NG0A 2D3AA 2UU7A 1F1HA 4LNNA 3ZXRA 1HTOA 2BVCA 1LGRA 2OJWA 2WHIA 4BAXA 3ZXVA 2WGSA 4LNKA 4LNFA 2D3BA 2D3CA 1FPYA 4HPPA 1HTQA 2GLSA 4ACFA 4S17A 4LNIA 2LGSA 3FKYA
chains in the Genus database with same CATH superfamily
1WJ4A 5I4DA 4DXGA 4GVZA 1E8WA 4KIKB 2HJ8A 2K39A 2YEPB 3VVWB 2MSED 3L2DA 1NENB 3H7PA 2ZCCA 3N9YC 2AYOB 2GRIA 1NBFC 3Q3NC 1JALA 3R66C 2GLSA 1PGBA 1EO6A 4GU2A 1H4RA 1ZUD2 3PHXB 1GNUA 4M8NA 1P3QU 3VTWA 2DNFA 1FFUA 4KZCA 2HTME 2NTTA 2Y5BB 2WDTB 2JZPA 1SGHA 3X23A 1VZ6A 1GG3A 2ZPYA 1TGZB 1R4MI 2XK5A 4TSSA 2FAZA 2MX2A 2JQRB 5BMHA 2MRPA 1F9JA 5AZHA 2NR2A 5LXHA 4GVYA 3FAHA 4REZA 1SIFA 1V49A 4BHLA 3ZGZA 4KZ0A 2KN4A 5AUIA 2JXTA 4PYZA 1SSNA 3ZO5B 3L2EB 3W5VB 1GC7A 1WMHB 1V97A 4ARCA 1HTQA 1HZ6A 1GUAB 1TZ1A 1WE6A 3M63B 3B08A 4USAA 1P7FA 2DZJA 2BB5A 3TEWA 1UUPA 3DBRI 2JYEA 1YQ3B 1ZDXA 2IO1B 4NJCA 3W5UB 1J8CA 2EMSA 2D3BA 3IBEA 2BGFA 3DDCB 1T0QC 3MJWA 2IGGA 2N1WA 1V5TA 4NPNA 2JWUA 2BW2A 4ITKA 1MG4A 5CHWA 3W9CB 4GIVA 4BOZB 2INPE 2N0SB 3MTNB 1BXTA 3P4RB 1V6EA 4LNFA 3O13A 3ZDMC 1FMAD 4ACFA 3DVGY 3Q2AC 4M00A 2L76A 4WWOA 2LASA 1WGGA 3S2AA 2WP9B 2QSDA 4YSXB 4HKQA 3VR8B 4JIOU 2D07B 2IGHA 4N59A 3P4PB 1YX5B 4YL8A 2E6XA 2EKIA 3IXSA 4MSQB 1IBXB 2N9LA 2IY1B 4N58A 4DHJD 1VRAB 3I57A 1E7UA 1FCLA 1H8CA 3ETRA 2B76B 3GOEA 2RGFA 2MA9B 2KZRA 3AE7B 4II2B 5D3DA 1JWBD 2KFKA 2J1QA 1LM8B 1TY0A 2BBCA 1TY2A 3HK0A 2LJIA 4LNOA 4BG4B 4XYCA 4TQ0A 5J9AA 4NQLB 1ZXIA 4IUMB 1V80A 3L17A 3A9KA 2EMTA 4FBJB 3TEYA 5IP4D 1VZ7A 2QMTA 4L1BA 2ZNVB 5BYSA 1V86A 4F8CB 4JGHB 2GBRA 4PYUA 2WGSA 1OGWA 3FILA 1VJKA 5J18A 3Q3OC 4M01A 2WNMA 1ACCA 3DQVA 4N6EB 1JWAD 4RF7A 3R7QA 3X0WA 3RI7C 5IAAC 3AH7A 4IWQA 4NQKE 2OEDA 3M10A 2D2QA 4WWNA 1V1OA 4GDKA 3LN7A 1TS3A 2FCMA 1E8YA 3HIZA 1VLBA 2ZVNA 2BYTA 5E6NA 1WR1A 1WFYA 2O2VB 2V0GA 4IC7B 3AE2B 2D32A 1VCBA 2RDHA 1EUVB 4DXAB 2HE7A 1TJEA 4BAXA 1SE2A 4EEWA 4DHZB 4XE0A 1KLUD 2XN9C 3UINB 4HDOA 3UI3A 1ZE3D 3TL5A 2XEWA 1YN5A 4GDLB 1OEYJ 4XDCA 2LI5A 2DZMA 2KC2A 2W54A 1QF6A 4D2KA 1YMHE 1LGRA 1Z2MA 4US8A 3VH3B 1KFYB 5TR5A 4LLGM 3ZNID 4CQNA 4EE2A 3LYYA 4RGOS 2IO3B 3V60A 1UD7A 3HHMA 2W55A 4YTNB 2J7QB 3A9JB 1QOBA 4BKSD 3OJ3A 1ZW7A 3P42A 1U4AA 2BKFA 3DVNU 2LJ5A 1TIFA 3N30A 1XEEA 1QK1A 2WX0A 1UBIA 4A6QA 2W3SA 1VDVA 2NPTA 4BBNC 2I2YA 2VH1A 4NJ6A 1OFFA 1V5OA 3U8ZA 2UYZB 5JHBA 2IBIB 1WX7A 1QOGA 3QC8B 4C7ZA 2FIFA 1PGXA 4ICVA 4YSYB 3AEBB 4YSZB 2H89B 3VDZA 1JRPA 2JU6X 2GWCA 3PVLA 1L4DB 2ACZB 4O1NA 4KIKA 2L0TA 5IKCM 3UQAA 2AQ3B 1SE3A 4ZRKA 1KJTA 3R2TA 1ZGUB 3D32A 1LFDA 1NI3A 2KYWA 4GLSC 3TSSA 3KUCB 3P2BA 1FM0D 3DBHI 3BWUD 1XXGA 5BYQA 2BWFA 2FCNA 2MBOA 3IVFA 3PTFC 3WA0A 3APFA 1R4MB 4FJZA 1XLQA 4S0RA 3DVGX 3MC0B 1D3ZA 1I4PA 2DYOA 1P9DU 3DWMA 5LNK1 1T0RC 4A20A 3OAWA 4NAMA 5JXVA 1DOYA 2KXJA 3IT6B 2D11A 3PT2B 1TKGA 4P1CC 1WRIA 2PTLA 2WQYB 1L4ZB 2WXGA 3RYTA 1YOVB 3AEEB 3NY5A 3ZRFA 5E6JA 3SFDB 2E3TA 2LHDA 2WDQB 5AZFA 1IPGA 1SF0A 2LZ6A 2LD9A 1LXDA 4JL9A 1GB4A 3DRBA 1WR6E 2KX0A 4MJSA 3DREA 1UZXB 3QA8A 4NZLB 5KHQA 1JQ4A 2WXKA 2LVOA 3RFZB 3DBRB 4W9FA 1WGHA 1SD0A 2PE9A 3JQ3A 1NEKB 4MEMA 1VR9A 3PV1A 3B2FA 4JQWC 4KGTA 4WAFA 4OVVA 1QLBB 2KVRA 3OLMD 4E74A 4RGTA 2KWCA 3H6NA 3TUOA 2O6VD 4RF9A 1MVKA 2L32A 2N7JA 4RGMA 2G4DB 1WXVA 3LB8C 3VUYA 4DDGD 3L4PA 3A1QB 4DHJB 1GJZA 4IOIE 2NMQA 4IWPA 3DBLI 2L52A 4HPMB 1HE8A 3T3NA 3ZTCA 5D3IB 2Z0DB 4G3XB 2WXMA 2JT4B 5CHFA 1AW7A 4LCDE 1LO5D 1P1AA 2J0JA 2KNBA 1ET9A 3AE1B 4II3B 1QILA 2KDBA 4DQOC 4MM3A 1E8XA 3JVZX 2KT7A 1GOZA 2LUEA 1YNTE 1QH4A 4AWJA 3BZDB 4WIPA 4HXDA 5FR3A 5IOIA 1FFVA 1FRDA 2J0KA 2RD0A 4BG4A 1C4AA 1WXSA 1ET6A 2WYQA 4OHJA 4XDDA 1T0SC 2REXA 2KMCA 1YJIA 3A4RA 3GB1A 1M15A 1E8ZA 1A5RA 2AL6A 4MELA 4L23A 4YTPB 1C4PA 3UQBA 4K7UA 2ICIA 3Q8FA 2ZW1A 1N5WA 3NG0A 4F7ZA 1AARA 1I4QA 5BYRA 2MJEA 4BBNF 1A70A 4GW2A 5J17A 3JU5A 3EA6A 1NVID 1F0ZA 3ML9A 3ZQ4A 3P63A 3V61A 1FO4A 3BK1A 2MW5A 4EZLA 3NZTA 1D6EC 2NBWB 1G6JA 2V3NA 4M0WA 3L0WB 5AUKA 1WIAA 2EELA 4LJOB 4KX6B 3AEGB 1S3SG 1WXAA 1HA5A 2O2VA 1WGYA 5H92C 3WCQA 4RF0A 2IPKD 2R2QA 1WGDA 1IYFA 1DGJA 3OWEB 1IGCA 2L00B 3UIPB 1WYWB 1UELA 3NUHB 2QCZA 3AM9A 2DAFA 3M3JA 2WU2B 3V6EB 4FXCA 3NZUA 2V3SA 4KGRA 1SE4A 3RULA 2FNJB 2V3PA 3U7DA 1HQRD 1D5ZC 1EF5A 1JWSD 2R61A 2MEKA 4FA6A 2OOBB 2V1YA 1ESFA 2L0FA 1YQ4B 3JSVB 2KN5A 2LXCA 1SEBD 1I42A 2LRWA 3A9JA 4WQOB 3RMKC 1YX6B 4TKNA 3ZVVA 2M19A 1WSPA 3HUIA 3EHVA 4W9CA 2WXHA 4WJPA 2KJHB 4JWUC 2KK8A 1NYRA 1RWSA 4HPLB 4ICUA 3LVVA 2N7EA 1P98A 2PEAA 2L1AA 4XX5A 2M17A 3TCAA 4P1BC 2RMMA 1JWMD 4MH8A 4IW0A 1Q0WB 3VHTC 2BYVE 5EE3A 4GSWA 3AE9B 1ZP0B 2DLBA 4GW0A 4ARIA 3KLSX 3DBHB 2JPHA 1XO3A 4W9DA 2WX1A 1XLNA 4X57B 2LFIA 4GOCA 2JXXA 3SFEB 3DHHC 2G45B 3CF6E 1RLFA 2KKCA 2G4SA 3AE6B 3RD2A 3QX1A 3FC4A 3DVNV 1HEZE 3PLUA 2PVGC 3A33B 2QILA 1RFKA 3M62B 3K9OB 1YIWA 1ZXHA 1B1ZA 4AOFA 1RRBA 2PJHA 3JPZA 5JZEB 5CTRC 2D3AA 4FHKA 2DBYA 4YT0B 1UBQA 4HCNB 1UH6A 2V9HA 4K3BA 3U4EG 1V1PA 3ML8A 1IUEA 3WALA 1N60A 1KTKA 1QQRA 4FULA 3HM3A 3P1MA 4DHZE 3CSFA 1I4HA 5C3JB 3MHSD 3C8YA 3ZLZA 3QK0A 3NHEB 4BFRA 2MP2B 1QOFA 2GBKA 3P4QB 3TBLD 1F1HA 4KKIA 4C4VB 2PVOD 2RPVA 1RL9A 3ZIMA 2GI9A 3NS8A 4ZRQA 4MH0E 3NZSA 1L2NA 1FRRA 3GZNI 1KLGD 1WH3A 2HDEA 3SDLC 4W9GA 3GE8C 2G1EA 4WURA 5FR6A 2JF5A 3RUIB 2RDGA 2W9NA 4WJQA 1P52A 4P6VF 4DBGA 4FJVB 1WI0A 3Q69A 3AI5A 1I35A 3BK2A 2KMAA 2JX5A 5DCNA 2LUMA 2MBHA 4RF1A 4RNAA 3NVVA 5GXGB 2CU3A 5LLIA 1WYGA 3KH0A 1F77A 2LGSA 3A1QA 3DBLB 1VRPA 1EF1A 2BT6A 5IN7A 1V9JA 3U30A 3QJZA 1P7EA 4B0MA 3N3KB 1PQSA 3PPAA 2J0MA 3MHZA 2B3AA 1KRHA 3KWVA 2LVQA 2MBEA 3AEAB 3AN1A 3Q6BA 2KDEB 4NAWB 2WU5B 4LNKA 1KH0A 2KHWB 4M02A 4MGKE 2WXPA 1DOXA 4MSMB 1XLOA 4ZYSA 1PDXA 4FLHA 1IGDA 4IDIA 3NVZA 3KUZA 4R3DA 3W1SC 3QWZB 4IM2A 4B0EA 1XCTL 4JX1C 3IHPC 3UGBB 1NYQA 5G5HA 1WE7A 2L05A 3Q3JA 2HJ1A 1WRDB 4DXFA 2N1VA 4AUQC 3R3MA 1I4GA 4US9A 3ZRCA 2INCC 2BKRB 2XK5B 3DHIC 1QKZA 2ZVOA 5J99A 2DAJA 4OVZA 3AECB 3TJPA 4BZAA 3H1UA 2AL3A 2JWZA 2GBNA 1FEHA 3RNBC 4OZCA 2CJOA 2LHEA 3Q14C 1PUTA 2I1KA 1FIQA 4N9F4 2KJ6A 2LMCA 4XWWA 1EM7A 2N9EB 1WJ6A 2DYMA 2H88B 4HROA 1RYJA 2NCNA 5D7GA 5C2TB 3W1YA 3CIRB 4EOYA 4RF6A 1WM2A 5J2RA 3PRMB 4B9KA 2VZKD 3W1SA 1EU3A 1D5MC 3A4SC 1TYGB 1CK1A 4H2AA 1E7VA 1UNSA 1WJNA 1FXIA 2KDMA 4A3PA 4E3CA 4Z9MA 2WLBA 2D33A 2RR9A 4BOSC 5T8IA 2ZZPB 3V62A 1EWCA 2FUG1 4WJOA 3WAPA 4CO7A 1EU4A 3ENEA 1UGJA 2KJRA 1U6RA 1C4CA 1AYFA 2PKOA 2INNE 2N7DA 3PO0A 5KHOA 1WZ3A 1BMLC 1IP9A 2QIEB 3UF8A 2LRUA 2MBQA 2WXIA 5TSSA 1OQRA 3NVYA 2CHXA 5IO9A 4UDUC 2VH2A 3WIMA 5H8YE 3I5JC 3UIOB 1GPXA 1OTRB 3TMPB 1F2RI 2IZVB 3PRZA 4MACA 2XNAC 1HTOA 1DOIA 2LXAA 2MJ3A 4C56C 3VRAB 1TBEA 5BMIA 4DK5A 2DHZA 4W9IA 4HPPA 4RGNA 3AB5A 3RNAC 4E71A 3KW5B 2K9XA 2KAJA 1L6VA 3L2EA 2LWPA 3C19A 1WMHA 2CR5A 3PLVA 3IG5A 2IJ0A 1D5XC 2V4IB 2XBBC 1SBBB 4ZRIA 3SHQA 2AWTA 1F2RC 5FK9C 4KVGB 3H8HA 1TT5B 2JY6A 4KV2A 4L2YA 4A8XC 4IWOA 2KLCA 3LXFA 4XC2A 1Y56A 2IO2B 4IKGA 2MHJA 3AULA 4FHJA 2GMIC 1E0ZA 1UGMA 1YJJA 1V2YA 1XT9B 2K22A 1E10A 5DPTA 2J52A 3NJTA 4P7IA 4HJKA 1G0WA 3BY4B 4LTUA 5DPWA 4MT5A 4C00A 1NDDA 5G2NA 1MHXA 2K3UA 2MH7A 4ZYNA 2JRIB 2D3CA 2K0PA 3QCAA 4G11A 4W9EA 1MG8A 4LDTD 2CKHB 3RZWC 3FILB 1C9FA 4ASWC 2KTRB 3R2IA 1EWYC 3MFGA 1FNVA 2N9XA 2NBVB 4WAAA 2C9WB 1WWTA 3BVGA 3N1XC 3P4SB 3CSTA 2WS3B 4A55A 4TQ1A 4RMAA 2NS5A 4EZKA 1WF9A 4B6WA 2AQ1B 1WM3A 4GDKB 4OZBA 1IBXA 4K81A 1K8RB 5FKAC 2WXLA 1C76A 3URYA 1MPEA 4PS7A 2HTHA 1J19A 3U7ZA 3QARA 2IY0B 2KC1A 2FIDA 4J3OD 2WXJA 2K6QA 5G55A 1GAQB 4WH4A 3VTVA 3ABVB 4Q2RA 3V05A 1V81A 1TS2A 3ZXRA 3RNEC 3I9V1 2M8SA 2D10A 3ECIA 2KACA 4B95A 2KVZA 4PK1A 3SU8X 2RSUA 2MP2A 1R4NI 5DPRA 3MJ5A 2YEPF 3E56A 4C4VA 1CQVA 2J53A 4DDID 1KF6B 3FKYA 4ZDVA 3MC9A 2QC8A 4EKUA 2L8JA 2PLPA 4URKA 3VUXA 1VZ8A 5HI1A 5LXIB 2HD5B 1KOTA 2UWQA 3KUDB 1T6BX 1UF0A 1TKEA 2AX5A 1E6EB 4XGAB 2BYFA 3L10B 1C3TA 1KM7A 1SE9A 2BPSA 4NNJB 4QAYA 2KLGA 2NPTB 1Q1OA 2K8BA 3DBSA 3IG3A 2KWDA 4OVUA 1T0YA 2YVCA 3LDZE 3PGEA 1Q10A 5HFYA 3RCZA 2QDFA 2Z59B 2N9PC 4KKJA 2ONQA 2RPQA 3TIXA 3ZXVA 1XLPA 2NBUA 3B1LX 3H7SA 4KDLB 4HLEA 2L3ZA 4NAWA 2C7NB 2J4XA 5EE9A 3DHGC 3PZ8A 2OJRA 2W82A 1R7SA 3LVWA 4G50A 1BT0A 2DYBA 3L08A 3U52E 5BO4B 4MGZE 1JMLA 4HK2A 3ZNGC 1OEYA 4IG7B 4IM3A 2QJLA 4GDLA 4FADA 4M8MA 5D94A 4FJYA 2M4NA 3RNGC 2JVCA 3AEDB 2SAKA 1VD2A 1GB1A 3BYTB 2VZKB 1XF5L 5L95C 1XD3B 3C0RB 3O65B 4BKTA 4DWFA 4HRSA 2C5LC 3HVZA 2C60A 3IG8A 3B0AA 3TEXA 4I6LB 3IT4B 3ALBA 2X8XX 3JU6A 2BS3B 2KWVB 3VTUA 1OQQA 1C78A 1WX8A 4AJYB 2R2OA 4W9LA 1RAXA 5CHVC 3T8MA 3Q3FA 3Q8CA 4ZOHC 1PYWD 3E9SA 2ZEQA 3R7RA 5AEKB 1FPYA 4WWMA 2LGYA 1E5WA 4MJSB 2J42A 3T3OA 4PT5A 1JROA 2LVPA 4AS1A 4OZAA 4ANVA 3AXCA 2A4ZA 4MDKE 1TZOA 1TTNA 4KSKC 3R8BA 2VRRB 3Q3MC 3H9DA 2BS2B 2MJDA 3NS1A 2GBJA 2KDFB 2KTFA 2M1MA 4HKZE 3SR6A 2MCNB 1I4XA 2IO0B 2KQ4X 1Z5SB 4CYEA 5BMGA 1XCQL 2AQ2B 2TSSA 2DZIA 2IDYA 2ZPNA 2JSVX 1STEA 2KDIA 3IAM1 1L6UA 3V3XA 4HWIB 5GMVA 5MPOA 4W9HA 1OQYA 4PS8A 1DYQA 3PSEB 2LGXA 1M4VA 1SXTA 3IAS1 4AP4C 3B6RA 2ASQA 4TMAB 2KFJA 1PGAA 2G9HD 2K1FA 1R8GA 4K3CA 4GXBA 3VR9B 1HXYD 5D6JB 2NTSA 2WXRA 2Y5PA 4HJGE 3SD5A 4LK0M 4FN2A 2K6DB 3RZFA 1CJEA 4MM3B 2G3QB 4F1SA 4ZHOA 1QOAA 2D3GA 3CWIA 3ZKJC 4ZRJA 1T3QA 1NI2A 2CHZA 3I63C 4LDTB 2O6VB 3N1ZC 3MC8A 4NJ7A 5L83A 1WZ0A 3BIID 4KDIC 2JRHA 1TT4A 2CU1A 4GGQA 4WWPA 4KSLC 2FE8A 2WXOA 3AEFB 1C79A 4HVBA 1V4GA 2ZJDA 1SB3C 3VFKA 1YD8U 3BYYB 1I4RA 4BKGA 5AZGA 1CZPA 3NVWA 2M0XA 2KTRA 1J0GA 1WXMA 3EFUA 4S17A 2PMVA 1SJED 4C80A 1TKYA 3W2DA 2SEBD 2WXFA 2IGDA 2Q5WD 4RM8A 4C7YA 2Z8LA 3ZYYX 2WDVB 3ZTDA 2YLMA 1ZOYB 1FCCC 2MQJA 4M0WB 2GB1A 2K8HA 3L16A 5JHAA 1C1YB 4XZ4A 3JYUA 2KMMA 1N5XA 2W3RA 3EC8A 1I0EA 3H7PB 3ZUNA 2BTEA 3AMZA 1I7HA 4IM0A 3Q8EA 2V4LA 3KVFB 5D2MB 2K5PA 3LJ3A 1RM6C 3RNCC 3RN9C 1N62A 3VRBB 3DPDA 2JZZA 2RDBC 4NY0A 1R4NB 2M56B 1JW9D 1PFDA 4HEA1 2BQQA 1S1QB 1CRKA 2QHOA 1MFWA 5EE0A 3KQ4A 4YTMB 3PREA 1FNUA 1TS5A 2A5UA 3ONSA 4W9JA 4JE3B 2CS4A 3NRZA 3K9PB 1ZDVA 1HZ5A 1L5PA 3NOBA 1YN3A 2D5GA 4XWTA 1WXQA 1E7PB 1GC6A 3N1YC 1BUIC 3DWGC 1QT9A 2INDC 3GE3C 2DZKA 3B2GA 3RNFC 2PPHA 1L0YB 4ZRPA 2KQSA 2GWDA 3APDA 3N32A 1Q5WB 2FUHB 2PE6B 3CMMB 1K52A 4RF8A 3J9CA 2FBWB 3B9JA 4ANXA 1J7CA 1YJ1A 3HVDA 4LJPB 3KYDD 5G5GA 4YXDB 2UU7A 3PZ7A 5E6OA 3VQIA 4YWGG 2N9KA 5C23A 2C7MB 2L83A 3KWLA 2DENB 3WAOA 3HM6X 4ZHPA 1E90A 2K25A 2QEJC 1Y8RC 1WGRA 1FNWA 4BKSA 1JCKB 2NVUI 3BVMA 1L0XB 3WAMA 4JWSC 3PHWB 3ZJUA 2CHWA 4G0NB 3Q8AA 3AE5B 3BVZA 3QAQA 1XQQA 1T5XD 2BS4B 3JSVA 3BINA 1L7YA 1JWUD 2JUOA 1N63A 2Y5CA 3IFWB 4WJNA 1JRUA 2KO3A 2KQ7A 3N20C 2GBMA 3HRDD 3DOWA 5E6PA 2KX3A 4W9KA 3ZDTA 4LNNA 3QQ8B 1UWXA 2X38A 4ANWA 2MLBA 2MWSB 2ZW0A 1J7AA 5HG2A 3AU5A 1SJHD 4CHKA 4K1RB 3ZW3A 2C7HA 2DWQA 4JLCA 1ZPSA 2Z0EB 2L7RA 2I1JA 1V1PB 4JPSA 4TV3A 1SIJA 4RM9A 5JH5C 2KFKB 1C77A 2KWUB 5IA7A 3APCA 4OW0A 3SEBA 3VXWA 1K53A 1TS4A 1QZEA 2OJWA 2N4FA 3ZJVA 4EUTA 4EZJA 4J6IA 3A9KB 4BVUC 1V8CA 1FD6A 3OJ4B 5EE1A 1BG0A 1AN8A 3AE4B 1AWDA 2KOXA 1ROEA 2DX5B 1D4BA 3L13A 1RFAA 4ANUA 1MI0A 3RT3B 3I3TB 4I6NB 1UWMA 4A9AA 2OHFA 2IYDB 2CRKA 1X1MA 1MHHE 1ZKHA 4K7SA 2I38A 3T9LA 1K51A 2AEHA 4PS3A 3JW0X 5HHDG 5C1ZA 2WXNA 3DCGA 4MGYE 2PIAA 2K8CA 1B9RA 3NZ3A 4P16A 3AE8B 3VH4B 4HDQA 2ZNVC 3AU4A 1P50A 4GMVA 2MBBB 2BVCA 3EECA 2KANA 2WWZA 3EGRA 3OG5A 2BB6A 4EFOA 3GP7A 4A3OA 2WHIA 2WDRB 1K50A 3ZJTA 1WJUA 3QHTA 4AJWA 2ZCBA 3PZDA 3EFCA 3PRPB 1E9MA 4AM1A 1L0VB 2LGIA 1KLVA 1ENFA 2CJNA 1M94A 3GS2A 3L54A 2M0AA 1P0RA 3WANA 4RCOA 2JYTA 2BWES 3QIJA 2KD0A 3U2SC 1FXAA 4KGSA 1WY8A 2LEKA 2PW9A 1YQBA 4GB9A 3RPFC 4MGIE 1N61A 2BYEA 2O6VA 3GZNB 5CX3A 3VAWA 2FCQA 4AQ7A 2JZ3B 4K7WA 3M95A 3EUB2 4I6PA 4HCPB 1VA6A 1N6ZA 5HKHA 3V6CB 1YN4A 2BF8B 3ZNZB 3AV8A 3ZNHB 3LN6A 3AE3B 1WX9A 4LNIA 2EKEC 4RH6A 4WQMA 5EDSA 4TUUA 1CMXB 3MP9A 1F52A 2Y3AA 1ISNA 2LGDA 3TEZA 2GOWA 4Q2JA 1J7BA 4RFBA 4GN1A 3Q8BA 1LQBA 5DPSA 3VUWA 1FXTB 1WGKA 3KYCD 2WXQA 2ON8A 4A90A 1MJDA 3PS6A 2FCSA
chains in the Genus database with same CATH topology
3NZTA 4S0RA 4LNOA 2QC8A 4XYCA 1F52A 3NG0A 2D3AA 2UU7A 1V4GA 2D32A 3IG5A 1F1HA 4LNNA 3ZXRA 1HTOA 2BVCA 3LVWA 1LGRA 3LVVA 2GWDA 2OJWA 1R8GA 1VA6A 2WHIA 2GWCA 4BAXA 3ZXVA 2D33A 2WGSA 3LN7A 4LNKA 4LNFA 2D3BA 1TT4A 2D3CA 1FPYA 4HPPA 1HTQA 2GLSA 3LN6A 4ACFA 4S17A 4LNIA 3IG8A 2LGSA 3FKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0R A;  4LNO A;  2QC8 A;  4XYC A;  1F52 A;  3NG0 A;  2D3A A;  2UU7 A;  1F1H A;  4LNN A;  3ZXR A;  1HTO A;  2BVC A;  1LGR A;  2OJW A;  2WHI A;  4BAX A;  3ZXV A;  2WGS A;  4LNK A;  4LNF A;  2D3B A;  2D3C A;  1FPY A;  4HPP A;  1HTQ A;  2GLS A;  4ACF A;  4S17 A;  4LNI A;  2LGS A;  3FKY A; 
#chains in the Genus database with same CATH topology
 1WJ4 A;  5I4D A;  4DXG A;  4GVZ A;  1E8W A;  4KIK B;  2HJ8 A;  2K39 A;  2YEP B;  3VVW B;  2MSE D;  3L2D A;  1NEN B;  3H7P A;  2ZCC A;  3N9Y C;  2AYO B;  2GRI A;  1NBF C;  3Q3N C;  1JAL A;  3R66 C;  2GLS A;  1PGB A;  1EO6 A;  4GU2 A;  1H4R A;  1ZUD 2;  3PHX B;  1GNU A;  4M8N A;  1P3Q U;  3VTW A;  2DNF A;  1FFU A;  4KZC A;  2HTM E;  2NTT A;  2Y5B B;  2WDT B;  2JZP A;  1SGH A;  3X23 A;  1VZ6 A;  1GG3 A;  2ZPY A;  1TGZ B;  1R4M I;  2XK5 A;  4TSS A;  2FAZ A;  2MX2 A;  2JQR B;  5BMH A;  2MRP A;  1F9J A;  5AZH A;  2NR2 A;  5LXH A;  4GVY A;  3FAH A;  4REZ A;  1SIF A;  1V49 A;  4BHL A;  3ZGZ A;  4KZ0 A;  2KN4 A;  5AUI A;  2JXT A;  4PYZ A;  1SSN A;  3ZO5 B;  3L2E B;  3W5V B;  1GC7 A;  1WMH B;  1V97 A;  4ARC A;  1HTQ A;  1HZ6 A;  1GUA B;  1TZ1 A;  1WE6 A;  3M63 B;  3B08 A;  4USA A;  1P7F A;  2DZJ A;  2BB5 A;  3TEW A;  1UUP A;  3DBR I;  2JYE A;  1YQ3 B;  1ZDX A;  2IO1 B;  4NJC A;  3W5U B;  1J8C A;  2EMS A;  2D3B A;  3IBE A;  2BGF A;  3DDC B;  1T0Q C;  3MJW A;  2IGG A;  2N1W A;  1V5T A;  4NPN A;  2JWU A;  2BW2 A;  4ITK A;  1MG4 A;  5CHW A;  3W9C B;  4GIV A;  4BOZ B;  2INP E;  2N0S B;  3MTN B;  1BXT A;  3P4R B;  1V6E A;  4LNF A;  3O13 A;  3ZDM C;  1FMA D;  4ACF A;  3DVG Y;  3Q2A C;  4M00 A;  2L76 A;  4WWO A;  2LAS A;  1WGG A;  3S2A A;  2WP9 B;  2QSD A;  4YSX B;  4HKQ A;  3VR8 B;  4JIO U;  2D07 B;  2IGH A;  4N59 A;  3P4P B;  1YX5 B;  4YL8 A;  2E6X A;  2EKI A;  3IXS A;  4MSQ B;  1IBX B;  2N9L A;  2IY1 B;  4N58 A;  4DHJ D;  1VRA B;  3I57 A;  1E7U A;  1FCL A;  1H8C A;  3ETR A;  2B76 B;  3GOE A;  2RGF A;  2MA9 B;  2KZR A;  3AE7 B;  4II2 B;  5D3D A;  1JWB D;  2KFK A;  2J1Q A;  1LM8 B;  1TY0 A;  2BBC A;  1TY2 A;  3HK0 A;  2LJI A;  4LNO A;  4BG4 B;  4XYC A;  4TQ0 A;  5J9A A;  4NQL B;  1ZXI A;  4IUM B;  1V80 A;  3L17 A;  3A9K A;  2EMT A;  4FBJ B;  3TEY A;  5IP4 D;  1VZ7 A;  2QMT A;  4L1B A;  2ZNV B;  5BYS A;  1V86 A;  4F8C B;  4JGH B;  2GBR A;  4PYU A;  2WGS A;  1OGW A;  3FIL A;  1VJK A;  5J18 A;  3Q3O C;  4M01 A;  2WNM A;  1ACC A;  3DQV A;  4N6E B;  1JWA D;  4RF7 A;  3R7Q A;  3X0W A;  3RI7 C;  5IAA C;  3AH7 A;  4IWQ A;  4NQK E;  2OED A;  3M10 A;  2D2Q A;  4WWN A;  1V1O A;  4GDK A;  3LN7 A;  1TS3 A;  2FCM A;  1E8Y A;  3HIZ A;  1VLB A;  2ZVN A;  2BYT A;  5E6N A;  1WR1 A;  1WFY A;  2O2V B;  2V0G A;  4IC7 B;  3AE2 B;  2D32 A;  1VCB A;  2RDH A;  1EUV B;  4DXA B;  2HE7 A;  1TJE A;  4BAX A;  1SE2 A;  4EEW A;  4DHZ B;  4XE0 A;  1KLU D;  2XN9 C;  3UIN B;  4HDO A;  3UI3 A;  1ZE3 D;  3TL5 A;  2XEW A;  1YN5 A;  4GDL B;  1OEY J;  4XDC A;  2LI5 A;  2DZM A;  2KC2 A;  2W54 A;  1QF6 A;  4D2K A;  1YMH E;  1LGR A;  1Z2M A;  4US8 A;  3VH3 B;  1KFY B;  5TR5 A;  4LLG M;  3ZNI D;  4CQN A;  4EE2 A;  3LYY A;  4RGO S;  2IO3 B;  3V60 A;  1UD7 A;  3HHM A;  2W55 A;  4YTN B;  2J7Q B;  3A9J B;  1QOB A;  4BKS D;  3OJ3 A;  1ZW7 A;  3P42 A;  1U4A A;  2BKF A;  3DVN U;  2LJ5 A;  1TIF A;  3N30 A;  1XEE A;  1QK1 A;  2WX0 A;  1UBI A;  4A6Q A;  2W3S A;  1VDV A;  2NPT A;  4BBN C;  2I2Y A;  2VH1 A;  4NJ6 A;  1OFF A;  1V5O A;  3U8Z A;  2UYZ B;  5JHB A;  2IBI B;  1WX7 A;  1QOG A;  3QC8 B;  4C7Z A;  2FIF A;  1PGX A;  4ICV A;  4YSY B;  3AEB B;  4YSZ B;  2H89 B;  3VDZ A;  1JRP A;  2JU6 X;  2GWC A;  3PVL A;  1L4D B;  2ACZ B;  4O1N A;  4KIK A;  2L0T A;  5IKC M;  3UQA A;  2AQ3 B;  1SE3 A;  4ZRK A;  1KJT A;  3R2T A;  1ZGU B;  3D32 A;  1LFD A;  1NI3 A;  2KYW A;  4GLS C;  3TSS A;  3KUC B;  3P2B A;  1FM0 D;  3DBH I;  3BWU D;  1XXG A;  5BYQ A;  2BWF A;  2FCN A;  2MBO A;  3IVF A;  3PTF C;  3WA0 A;  3APF A;  1R4M B;  4FJZ A;  1XLQ A;  4S0R A;  3DVG X;  3MC0 B;  1D3Z A;  1I4P A;  2DYO A;  1P9D U;  3DWM A;  5LNK 1;  1T0R C;  4A20 A;  3OAW A;  4NAM A;  5JXV A;  1DOY A;  2KXJ A;  3IT6 B;  2D11 A;  3PT2 B;  1TKG A;  4P1C C;  1WRI A;  2PTL A;  2WQY B;  1L4Z B;  2WXG A;  3RYT A;  1YOV B;  3AEE B;  3NY5 A;  3ZRF A;  5E6J A;  3SFD B;  2E3T A;  2LHD A;  2WDQ B;  5AZF A;  1IPG A;  1SF0 A;  2LZ6 A;  2LD9 A;  1LXD A;  4JL9 A;  1GB4 A;  3DRB A;  1WR6 E;  2KX0 A;  4MJS A;  3DRE A;  1UZX B;  3QA8 A;  4NZL B;  5KHQ A;  1JQ4 A;  2WXK A;  2LVO A;  3RFZ B;  3DBR B;  4W9F A;  1WGH A;  1SD0 A;  2PE9 A;  3JQ3 A;  1NEK B;  4MEM A;  1VR9 A;  3PV1 A;  3B2F A;  4JQW C;  4KGT A;  4WAF A;  4OVV A;  1QLB B;  2KVR A;  3OLM D;  4E74 A;  4RGT A;  2KWC A;  3H6N A;  3TUO A;  2O6V D;  4RF9 A;  1MVK A;  2L32 A;  2N7J A;  4RGM A;  2G4D B;  1WXV A;  3LB8 C;  3VUY A;  4DDG D;  3L4P A;  3A1Q B;  4DHJ B;  1GJZ A;  4IOI E;  2NMQ A;  4IWP A;  3DBL I;  2L52 A;  4HPM B;  1HE8 A;  3T3N A;  3ZTC A;  5D3I B;  2Z0D B;  4G3X B;  2WXM A;  2JT4 B;  5CHF A;  1AW7 A;  4LCD E;  1LO5 D;  1P1A A;  2J0J A;  2KNB A;  1ET9 A;  3AE1 B;  4II3 B;  1QIL A;  2KDB A;  4DQO C;  4MM3 A;  1E8X A;  3JVZ X;  2KT7 A;  1GOZ A;  2LUE A;  1YNT E;  1QH4 A;  4AWJ A;  3BZD B;  4WIP A;  4HXD A;  5FR3 A;  5IOI A;  1FFV A;  1FRD A;  2J0K A;  2RD0 A;  4BG4 A;  1C4A A;  1WXS A;  1ET6 A;  2WYQ A;  4OHJ A;  4XDD A;  1T0S C;  2REX A;  2KMC A;  1YJI A;  3A4R A;  3GB1 A;  1M15 A;  1E8Z A;  1A5R A;  2AL6 A;  4MEL A;  4L23 A;  4YTP B;  1C4P A;  3UQB A;  4K7U A;  2ICI A;  3Q8F A;  2ZW1 A;  1N5W A;  3NG0 A;  4F7Z A;  1AAR A;  1I4Q A;  5BYR A;  2MJE A;  4BBN F;  1A70 A;  4GW2 A;  5J17 A;  3JU5 A;  3EA6 A;  1NVI D;  1F0Z A;  3ML9 A;  3ZQ4 A;  3P63 A;  3V61 A;  1FO4 A;  3BK1 A;  2MW5 A;  4EZL A;  3NZT A;  1D6E C;  2NBW B;  1G6J A;  2V3N A;  4M0W A;  3L0W B;  5AUK A;  1WIA A;  2EEL A;  4LJO B;  4KX6 B;  3AEG B;  1S3S G;  1WXA A;  1HA5 A;  2O2V A;  1WGY A;  5H92 C;  3WCQ A;  4RF0 A;  2IPK D;  2R2Q A;  1WGD A;  1IYF A;  1DGJ A;  3OWE B;  1IGC A;  2L00 B;  3UIP B;  1WYW B;  1UEL A;  3NUH B;  2QCZ A;  3AM9 A;  2DAF A;  3M3J A;  2WU2 B;  3V6E B;  4FXC A;  3NZU A;  2V3S A;  4KGR A;  1SE4 A;  3RUL A;  2FNJ B;  2V3P A;  3U7D A;  1HQR D;  1D5Z C;  1EF5 A;  1JWS D;  2R61 A;  2MEK A;  4FA6 A;  2OOB B;  2V1Y A;  1ESF A;  2L0F A;  1YQ4 B;  3JSV B;  2KN5 A;  2LXC A;  1SEB D;  1I42 A;  2LRW A;  3A9J A;  4WQO B;  3RMK C;  1YX6 B;  4TKN A;  3ZVV A;  2M19 A;  1WSP A;  3HUI A;  3EHV A;  4W9C A;  2WXH A;  4WJP A;  2KJH B;  4JWU C;  2KK8 A;  1NYR A;  1RWS A;  4HPL B;  4ICU A;  3LVV A;  2N7E A;  1P98 A;  2PEA A;  2L1A A;  4XX5 A;  2M17 A;  3TCA A;  4P1B C;  2RMM A;  1JWM D;  4MH8 A;  4IW0 A;  1Q0W B;  3VHT C;  2BYV E;  5EE3 A;  4GSW A;  3AE9 B;  1ZP0 B;  2DLB A;  4GW0 A;  4ARI A;  3KLS X;  3DBH B;  2JPH A;  1XO3 A;  4W9D A;  2WX1 A;  1XLN A;  4X57 B;  2LFI A;  4GOC A;  2JXX A;  3SFE B;  3DHH C;  2G45 B;  3CF6 E;  1RLF A;  2KKC A;  2G4S A;  3AE6 B;  3RD2 A;  3QX1 A;  3FC4 A;  3DVN V;  1HEZ E;  3PLU A;  2PVG C;  3A33 B;  2QIL A;  1RFK A;  3M62 B;  3K9O B;  1YIW A;  1ZXH A;  1B1Z A;  4AOF A;  1RRB A;  2PJH A;  3JPZ A;  5JZE B;  5CTR C;  2D3A A;  4FHK A;  2DBY A;  4YT0 B;  1UBQ A;  4HCN B;  1UH6 A;  2V9H A;  4K3B A;  3U4E G;  1V1P A;  3ML8 A;  1IUE A;  3WAL A;  1N60 A;  1KTK A;  1QQR A;  4FUL A;  3HM3 A;  3P1M A;  4DHZ E;  3CSF A;  1I4H A;  5C3J B;  3MHS D;  3C8Y A;  3ZLZ A;  3QK0 A;  3NHE B;  4BFR A;  2MP2 B;  1QOF A;  2GBK A;  3P4Q B;  3TBL D;  1F1H A;  4KKI A;  4C4V B;  2PVO D;  2RPV A;  1RL9 A;  3ZIM A;  2GI9 A;  3NS8 A;  4ZRQ A;  4MH0 E;  3NZS A;  1L2N A;  1FRR A;  3GZN I;  1KLG D;  1WH3 A;  2HDE A;  3SDL C;  4W9G A;  3GE8 C;  2G1E A;  4WUR A;  5FR6 A;  2JF5 A;  3RUI B;  2RDG A;  2W9N A;  4WJQ A;  1P52 A;  4P6V F;  4DBG A;  4FJV B;  1WI0 A;  3Q69 A;  3AI5 A;  1I35 A;  3BK2 A;  2KMA A;  2JX5 A;  5DCN A;  2LUM A;  2MBH A;  4RF1 A;  4RNA A;  3NVV A;  5GXG B;  2CU3 A;  5LLI A;  1WYG A;  3KH0 A;  1F77 A;  2LGS A;  3A1Q A;  3DBL B;  1VRP A;  1EF1 A;  2BT6 A;  5IN7 A;  1V9J A;  3U30 A;  3QJZ A;  1P7E A;  4B0M A;  3N3K B;  1PQS A;  3PPA A;  2J0M A;  3MHZ A;  2B3A A;  1KRH A;  3KWV A;  2LVQ A;  2MBE A;  3AEA B;  3AN1 A;  3Q6B A;  2KDE B;  4NAW B;  2WU5 B;  4LNK A;  1KH0 A;  2KHW B;  4M02 A;  4MGK E;  2WXP A;  1DOX A;  4MSM B;  1XLO A;  4ZYS A;  1PDX A;  4FLH A;  1IGD A;  4IDI A;  3NVZ A;  3KUZ A;  4R3D A;  3W1S C;  3QWZ B;  4IM2 A;  4B0E A;  1XCT L;  4JX1 C;  3IHP C;  3UGB B;  1NYQ A;  5G5H A;  1WE7 A;  2L05 A;  3Q3J A;  2HJ1 A;  1WRD B;  4DXF A;  2N1V A;  4AUQ C;  3R3M A;  1I4G A;  4US9 A;  3ZRC A;  2INC C;  2BKR B;  2XK5 B;  3DHI C;  1QKZ A;  2ZVO A;  5J99 A;  2DAJ A;  4OVZ A;  3AEC B;  3TJP A;  4BZA A;  3H1U A;  2AL3 A;  2JWZ A;  2GBN A;  1FEH A;  3RNB C;  4OZC A;  2CJO A;  2LHE A;  3Q14 C;  1PUT A;  2I1K A;  1FIQ A;  4N9F 4;  2KJ6 A;  2LMC A;  4XWW A;  1EM7 A;  2N9E B;  1WJ6 A;  2DYM A;  2H88 B;  4HRO A;  1RYJ A;  2NCN A;  5D7G A;  5C2T B;  3W1Y A;  3CIR B;  4EOY A;  4RF6 A;  1WM2 A;  5J2R A;  3PRM B;  4B9K A;  2VZK D;  3W1S A;  1EU3 A;  1D5M C;  3A4S C;  1TYG B;  1CK1 A;  4H2A A;  1E7V A;  1UNS A;  1WJN A;  1FXI A;  2KDM A;  4A3P A;  4E3C A;  4Z9M A;  2WLB A;  2D33 A;  2RR9 A;  4BOS C;  5T8I A;  2ZZP B;  3V62 A;  1EWC A;  2FUG 1;  4WJO A;  3WAP A;  4CO7 A;  1EU4 A;  3ENE A;  1UGJ A;  2KJR A;  1U6R A;  1C4C A;  1AYF A;  2PKO A;  2INN E;  2N7D A;  3PO0 A;  5KHO A;  1WZ3 A;  1BML C;  1IP9 A;  2QIE B;  3UF8 A;  2LRU A;  2MBQ A;  2WXI A;  5TSS A;  1OQR A;  3NVY A;  2CHX A;  5IO9 A;  4UDU C;  2VH2 A;  3WIM A;  5H8Y E;  3I5J C;  3UIO B;  1GPX A;  1OTR B;  3TMP B;  1F2R I;  2IZV B;  3PRZ A;  4MAC A;  2XNA C;  1HTO A;  1DOI A;  2LXA A;  2MJ3 A;  4C56 C;  3VRA B;  1TBE A;  5BMI A;  4DK5 A;  2DHZ A;  4W9I A;  4HPP A;  4RGN A;  3AB5 A;  3RNA C;  4E71 A;  3KW5 B;  2K9X A;  2KAJ A;  1L6V A;  3L2E A;  2LWP A;  3C19 A;  1WMH A;  2CR5 A;  3PLV A;  3IG5 A;  2IJ0 A;  1D5X C;  2V4I B;  2XBB C;  1SBB B;  4ZRI A;  3SHQ A;  2AWT A;  1F2R C;  5FK9 C;  4KVG B;  3H8H A;  1TT5 B;  2JY6 A;  4KV2 A;  4L2Y A;  4A8X C;  4IWO A;  2KLC A;  3LXF A;  4XC2 A;  1Y56 A;  2IO2 B;  4IKG A;  2MHJ A;  3AUL A;  4FHJ A;  2GMI C;  1E0Z A;  1UGM A;  1YJJ A;  1V2Y A;  1XT9 B;  2K22 A;  1E10 A;  5DPT A;  2J52 A;  3NJT A;  4P7I A;  4HJK A;  1G0W A;  3BY4 B;  4LTU A;  5DPW A;  4MT5 A;  4C00 A;  1NDD A;  5G2N A;  1MHX A;  2K3U A;  2MH7 A;  4ZYN A;  2JRI B;  2D3C A;  2K0P A;  3QCA A;  4G11 A;  4W9E A;  1MG8 A;  4LDT D;  2CKH B;  3RZW C;  3FIL B;  1C9F A;  4ASW C;  2KTR B;  3R2I A;  1EWY C;  3MFG A;  1FNV A;  2N9X A;  2NBV B;  4WAA A;  2C9W B;  1WWT A;  3BVG A;  3N1X C;  3P4S B;  3CST A;  2WS3 B;  4A55 A;  4TQ1 A;  4RMA A;  2NS5 A;  4EZK A;  1WF9 A;  4B6W A;  2AQ1 B;  1WM3 A;  4GDK B;  4OZB A;  1IBX A;  4K81 A;  1K8R B;  5FKA C;  2WXL A;  1C76 A;  3URY A;  1MPE A;  4PS7 A;  2HTH A;  1J19 A;  3U7Z A;  3QAR A;  2IY0 B;  2KC1 A;  2FID A;  4J3O D;  2WXJ A;  2K6Q A;  5G55 A;  1GAQ B;  4WH4 A;  3VTV A;  3ABV B;  4Q2R A;  3V05 A;  1V81 A;  1TS2 A;  3ZXR A;  3RNE C;  3I9V 1;  2M8S A;  2D10 A;  3ECI A;  2KAC A;  4B95 A;  2KVZ A;  4PK1 A;  3SU8 X;  2RSU A;  2MP2 A;  1R4N I;  5DPR A;  3MJ5 A;  2YEP F;  3E56 A;  4C4V A;  1CQV A;  2J53 A;  4DDI D;  1KF6 B;  3FKY A;  4ZDV A;  3MC9 A;  2QC8 A;  4EKU A;  2L8J A;  2PLP A;  4URK A;  3VUX A;  1VZ8 A;  5HI1 A;  5LXI B;  2HD5 B;  1KOT A;  2UWQ A;  3KUD B;  1T6B X;  1UF0 A;  1TKE A;  2AX5 A;  1E6E B;  4XGA B;  2BYF A;  3L10 B;  1C3T A;  1KM7 A;  1SE9 A;  2BPS A;  4NNJ B;  4QAY A;  2KLG A;  2NPT B;  1Q1O A;  2K8B A;  3DBS A;  3IG3 A;  2KWD A;  4OVU A;  1T0Y A;  2YVC A;  3LDZ E;  3PGE A;  1Q10 A;  5HFY A;  3RCZ A;  2QDF A;  2Z59 B;  2N9P C;  4KKJ A;  2ONQ A;  2RPQ A;  3TIX A;  3ZXV A;  1XLP A;  2NBU A;  3B1L X;  3H7S A;  4KDL B;  4HLE A;  2L3Z A;  4NAW A;  2C7N B;  2J4X A;  5EE9 A;  3DHG C;  3PZ8 A;  2OJR A;  2W82 A;  1R7S A;  3LVW A;  4G50 A;  1BT0 A;  2DYB A;  3L08 A;  3U52 E;  5BO4 B;  4MGZ E;  1JML A;  4HK2 A;  3ZNG C;  1OEY A;  4IG7 B;  4IM3 A;  2QJL A;  4GDL A;  4FAD A;  4M8M A;  5D94 A;  4FJY A;  2M4N A;  3RNG C;  2JVC A;  3AED B;  2SAK A;  1VD2 A;  1GB1 A;  3BYT B;  2VZK B;  1XF5 L;  5L95 C;  1XD3 B;  3C0R B;  3O65 B;  4BKT A;  4DWF A;  4HRS A;  2C5L C;  3HVZ A;  2C60 A;  3IG8 A;  3B0A A;  3TEX A;  4I6L B;  3IT4 B;  3ALB A;  2X8X X;  3JU6 A;  2BS3 B;  2KWV B;  3VTU A;  1OQQ A;  1C78 A;  1WX8 A;  4AJY B;  2R2O A;  4W9L A;  1RAX A;  5CHV C;  3T8M A;  3Q3F A;  3Q8C A;  4ZOH C;  1PYW D;  3E9S A;  2ZEQ A;  3R7R A;  5AEK B;  1FPY A;  4WWM A;  2LGY A;  1E5W A;  4MJS B;  2J42 A;  3T3O A;  4PT5 A;  1JRO A;  2LVP A;  4AS1 A;  4OZA A;  4ANV A;  3AXC A;  2A4Z A;  4MDK E;  1TZO A;  1TTN A;  4KSK C;  3R8B A;  2VRR B;  3Q3M C;  3H9D A;  2BS2 B;  2MJD A;  3NS1 A;  2GBJ A;  2KDF B;  2KTF A;  2M1M A;  4HKZ E;  3SR6 A;  2MCN B;  1I4X A;  2IO0 B;  2KQ4 X;  1Z5S B;  4CYE A;  5BMG A;  1XCQ L;  2AQ2 B;  2TSS A;  2DZI A;  2IDY A;  2ZPN A;  2JSV X;  1STE A;  2KDI A;  3IAM 1;  1L6U A;  3V3X A;  4HWI B;  5GMV A;  5MPO A;  4W9H A;  1OQY A;  4PS8 A;  1DYQ A;  3PSE B;  2LGX A;  1M4V A;  1SXT A;  3IAS 1;  4AP4 C;  3B6R A;  2ASQ A;  4TMA B;  2KFJ A;  1PGA A;  2G9H D;  2K1F A;  1R8G A;  4K3C A;  4GXB A;  3VR9 B;  1HXY D;  5D6J B;  2NTS A;  2WXR A;  2Y5P A;  4HJG E;  3SD5 A;  4LK0 M;  4FN2 A;  2K6D B;  3RZF A;  1CJE A;  4MM3 B;  2G3Q B;  4F1S A;  4ZHO A;  1QOA A;  2D3G A;  3CWI A;  3ZKJ C;  4ZRJ A;  1T3Q A;  1NI2 A;  2CHZ A;  3I63 C;  4LDT B;  2O6V B;  3N1Z C;  3MC8 A;  4NJ7 A;  5L83 A;  1WZ0 A;  3BII D;  4KDI C;  2JRH A;  1TT4 A;  2CU1 A;  4GGQ A;  4WWP A;  4KSL C;  2FE8 A;  2WXO A;  3AEF B;  1C79 A;  4HVB A;  1V4G A;  2ZJD A;  1SB3 C;  3VFK A;  1YD8 U;  3BYY B;  1I4R A;  4BKG A;  5AZG A;  1CZP A;  3NVW A;  2M0X A;  2KTR A;  1J0G A;  1WXM A;  3EFU A;  4S17 A;  2PMV A;  1SJE D;  4C80 A;  1TKY A;  3W2D A;  2SEB D;  2WXF A;  2IGD A;  2Q5W D;  4RM8 A;  4C7Y A;  2Z8L A;  3ZYY X;  2WDV B;  3ZTD A;  2YLM A;  1ZOY B;  1FCC C;  2MQJ A;  4M0W B;  2GB1 A;  2K8H A;  3L16 A;  5JHA A;  1C1Y B;  4XZ4 A;  3JYU A;  2KMM A;  1N5X A;  2W3R A;  3EC8 A;  1I0E A;  3H7P B;  3ZUN A;  2BTE A;  3AMZ A;  1I7H A;  4IM0 A;  3Q8E A;  2V4L A;  3KVF B;  5D2M B;  2K5P A;  3LJ3 A;  1RM6 C;  3RNC C;  3RN9 C;  1N62 A;  3VRB B;  3DPD A;  2JZZ A;  2RDB C;  4NY0 A;  1R4N B;  2M56 B;  1JW9 D;  1PFD A;  4HEA 1;  2BQQ A;  1S1Q B;  1CRK A;  2QHO A;  1MFW A;  5EE0 A;  3KQ4 A;  4YTM B;  3PRE A;  1FNU A;  1TS5 A;  2A5U A;  3ONS A;  4W9J A;  4JE3 B;  2CS4 A;  3NRZ A;  3K9P B;  1ZDV A;  1HZ5 A;  1L5P A;  3NOB A;  1YN3 A;  2D5G A;  4XWT A;  1WXQ A;  1E7P B;  1GC6 A;  3N1Y C;  1BUI C;  3DWG C;  1QT9 A;  2IND C;  3GE3 C;  2DZK A;  3B2G A;  3RNF C;  2PPH A;  1L0Y B;  4ZRP A;  2KQS A;  2GWD A;  3APD A;  3N32 A;  1Q5W B;  2FUH B;  2PE6 B;  3CMM B;  1K52 A;  4RF8 A;  3J9C A;  2FBW B;  3B9J A;  4ANX A;  1J7C A;  1YJ1 A;  3HVD A;  4LJP B;  3KYD D;  5G5G A;  4YXD B;  2UU7 A;  3PZ7 A;  5E6O A;  3VQI A;  4YWG G;  2N9K A;  5C23 A;  2C7M B;  2L83 A;  3KWL A;  2DEN B;  3WAO A;  3HM6 X;  4ZHP A;  1E90 A;  2K25 A;  2QEJ C;  1Y8R C;  1WGR A;  1FNW A;  4BKS A;  1JCK B;  2NVU I;  3BVM A;  1L0X B;  3WAM A;  4JWS C;  3PHW B;  3ZJU A;  2CHW A;  4G0N B;  3Q8A A;  3AE5 B;  3BVZ A;  3QAQ A;  1XQQ A;  1T5X D;  2BS4 B;  3JSV A;  3BIN A;  1L7Y A;  1JWU D;  2JUO A;  1N63 A;  2Y5C A;  3IFW B;  4WJN A;  1JRU A;  2KO3 A;  2KQ7 A;  3N20 C;  2GBM A;  3HRD D;  3DOW A;  5E6P A;  2KX3 A;  4W9K A;  3ZDT A;  4LNN A;  3QQ8 B;  1UWX A;  2X38 A;  4ANW A;  2MLB A;  2MWS B;  2ZW0 A;  1J7A A;  5HG2 A;  3AU5 A;  1SJH D;  4CHK A;  4K1R B;  3ZW3 A;  2C7H A;  2DWQ A;  4JLC A;  1ZPS A;  2Z0E B;  2L7R A;  2I1J A;  1V1P B;  4JPS A;  4TV3 A;  1SIJ A;  4RM9 A;  5JH5 C;  2KFK B;  1C77 A;  2KWU B;  5IA7 A;  3APC A;  4OW0 A;  3SEB A;  3VXW A;  1K53 A;  1TS4 A;  1QZE A;  2OJW A;  2N4F A;  3ZJV A;  4EUT A;  4EZJ A;  4J6I A;  3A9K B;  4BVU C;  1V8C A;  1FD6 A;  3OJ4 B;  5EE1 A;  1BG0 A;  1AN8 A;  3AE4 B;  1AWD A;  2KOX A;  1ROE A;  2DX5 B;  1D4B A;  3L13 A;  1RFA A;  4ANU A;  1MI0 A;  3RT3 B;  3I3T B;  4I6N B;  1UWM A;  4A9A A;  2OHF A;  2IYD B;  2CRK A;  1X1M A;  1MHH E;  1ZKH A;  4K7S A;  2I38 A;  3T9L A;  1K51 A;  2AEH A;  4PS3 A;  3JW0 X;  5HHD G;  5C1Z A;  2WXN A;  3DCG A;  4MGY E;  2PIA A;  2K8C A;  1B9R A;  3NZ3 A;  4P16 A;  3AE8 B;  3VH4 B;  4HDQ A;  2ZNV C;  3AU4 A;  1P50 A;  4GMV A;  2MBB B;  2BVC A;  3EEC A;  2KAN A;  2WWZ A;  3EGR A;  3OG5 A;  2BB6 A;  4EFO A;  3GP7 A;  4A3O A;  2WHI A;  2WDR B;  1K50 A;  3ZJT A;  1WJU A;  3QHT A;  4AJW A;  2ZCB A;  3PZD A;  3EFC A;  3PRP B;  1E9M A;  4AM1 A;  1L0V B;  2LGI A;  1KLV A;  1ENF A;  2CJN A;  1M94 A;  3GS2 A;  3L54 A;  2M0A A;  1P0R A;  3WAN A;  4RCO A;  2JYT A;  2BWE S;  3QIJ A;  2KD0 A;  3U2S C;  1FXA A;  4KGS A;  1WY8 A;  2LEK A;  2PW9 A;  1YQB A;  4GB9 A;  3RPF C;  4MGI E;  1N61 A;  2BYE A;  2O6V A;  3GZN B;  5CX3 A;  3VAW A;  2FCQ A;  4AQ7 A;  2JZ3 B;  4K7W A;  3M95 A;  3EUB 2;  4I6P A;  4HCP B;  1VA6 A;  1N6Z A;  5HKH A;  3V6C B;  1YN4 A;  2BF8 B;  3ZNZ B;  3AV8 A;  3ZNH B;  3LN6 A;  3AE3 B;  1WX9 A;  4LNI A;  2EKE C;  4RH6 A;  4WQM A;  5EDS A;  4TUU A;  1CMX B;  3MP9 A;  1F52 A;  2Y3A A;  1ISN A;  2LGD A;  3TEZ A;  2GOW A;  4Q2J A;  1J7B A;  4RFB A;  4GN1 A;  3Q8B A;  1LQB A;  5DPS A;  3VUW A;  1FXT B;  1WGK A;  3KYC D;  2WXQ A;  2ON8 A;  4A90 A;  1MJD A;  3PS6 A;  2FCS A; 
#chains in the Genus database with same CATH homology
 3NZT A;  4S0R A;  4LNO A;  2QC8 A;  4XYC A;  1F52 A;  3NG0 A;  2D3A A;  2UU7 A;  1V4G A;  2D32 A;  3IG5 A;  1F1H A;  4LNN A;  3ZXR A;  1HTO A;  2BVC A;  3LVW A;  1LGR A;  3LVV A;  2GWD A;  2OJW A;  1R8G A;  1VA6 A;  2WHI A;  2GWC A;  4BAX A;  3ZXV A;  2D33 A;  2WGS A;  3LN7 A;  4LNK A;  4LNF A;  2D3B A;  1TT4 A;  2D3C A;  1FPY A;  4HPP A;  1HTQ A;  2GLS A;  3LN6 A;  4ACF A;  4S17 A;  4LNI A;  3IG8 A;  2LGS A;  3FKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...