2QC8A

Crystal structure of human glutamine synthetase in complex with adp and methionine sulfoximine phosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Glutamine synthetase
total genus 116
structure length 356
sequence length 356
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2qc8A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2qc8A02
2QC8A 2WHIA 2UU7A 2D3AA 3NG0A 2OJWA 2GLSA 4LNIA 4LNNA 2D3CA 2LGSA 4S17A 3ZXVA 2BVCA 4LNKA 1LGRA 1F52A 4LNOA 3ZXRA 3FKYA 4HPPA 4S0RA 2D3BA 4LNFA 2WGSA 1HTQA 4XYCA 4ACFA 1FPYA 1F1HA 4BAXA 1HTOA
chains in the Genus database with same CATH superfamily
3MC8A 1R7SA 2BPSA 2IZVB 3M63B 2CHZA 4LNIA 3HM3A 4BBNF 1WSPA 2PVOD 1R4MB 2ZNVC 1UGMA 1V8CA 3JQ3A 3N20C 4C7YA 2GBMA 2JRHA 4YTMB 4A90A 3I3TB 3RFZB 4C4VA 1T0QC 4OHJA 1J7CA 4ANXA 1FXIA 4A3PA 1LQBA 1I42A 4RH6A 4S0RA 4C56C 3RCZA 4LNFA 1V1PA 2B3AA 2WWZA 4Q2JA 4RM9A 4NPNA 4PYUA 2WXJA 4JIOU 3NRZA 3H6NA 4EZJA 1SF0A 1BUIC 1JWAD 1F2RC 5DPWA 3DBLI 1QILA 1QK1A 3OWEB 2AX5A 2X38A 2KMMA 2LJ5A 4DBGA 2XK5B 1WMHA 3T3OA 4MH0E 1KLUD 2RSUA 2KO3A 2OEDA 1WE6A 1LM8B 3PO0A 4A6QA 2C60A 4JGHB 3N1ZC 3W2DA 3IXSA 2E6XA 3ZKJC 4RF8A 5CHWA 4XX5A 3NHEB 5LLIA 3VTWA 4ZHOA 3ETRA 4ARIA 2KJRA 3O13A 2ZNVB 3J9CA 1G0WA 2IBIB 3P42A 3PSEB 5DPSA 4BVUC 4RMAA 3OJ4B 4OZAA 2KQ7A 3AV8A 1Q0WB 1CJEA 2W82A 3IG8A 2BB6A 3ECIA 3ZDMC 1LO5D 1FPYA 4G3XB 4II2B 1M15A 4A9AA 2BQQA 3WAMA 4YTPB 3EUB2 1C4PA 2ZW1A 4C7ZA 2C5LC 5D2MB 2KDFB 4LJPB 3AEFB 1ET9A 1UBIA 3UGBB 4ZRIA 2Y5BB 1WGGA 2PEAA 2L0TA 2KX0A 1N5XA 4MACA 2IO1B 2ON8A 3DHIC 1WH3A 4REZA 3RNGC 2DENB 2KK8A 1IGCA 1L5PA 2I38A 4W9HA 1JMLA 2A4ZA 2EMSA 4HCNB 2KMCA 1TIFA 1KOTA 4M00A 1KTKA 2L0FA 5AUIA 4GDLB 5EDSA 1SBBB 2NTTA 1RM6C 4GDLA 2WP9B 3AU5A 2N9XA 3AECB 1WR1A 2LHDA 4P7IA 2BYTA 4CQNA 1XCQL 3DRBA 1WJNA 4DDID 1MFWA 2LGDA 3KH0A 4WJQA 2M0XA 3APCA 1T0RC 1OEYJ 2WXPA 3Q3JA 4GSWA 4US8A 2MBHA 3PLVA 4FXCA 3L16A 2OOBB 1N6ZA 3Q8FA 3A9KB 4KDIC 1DOIA 1SSNA 1JRUA 1KRHA 1IGDA 2G4DB 2M19A 3CF6E 3IT4B 2LMCA 4GXBA 1TS5A 1XT9B 1EWCA 3ENEA 2BVCA 3CWIA 3I5JC 1WMHB 4W9DA 1J19A 3QQ8B 1P3QU 5E6JA 5AZHA 2I2YA 3DHHC 3EFUA 3CSFA 3B2GA 3SEBA 3N32A 4RGTA 4KSKC 3I57A 4FJYA 2MW5A 5J18A 3DBRI 4GIVA 4EZKA 4ANUA 1I4RA 5LNK1 1YN5A 3PZ7A 2NBWB 1P7EA 1UH6A 2ACZB 1UBQA 2REXA 2DZIA 4A55A 1CZPA 3DVNU 4WQOB 4ZRQA 3TEWA 3DWMA 3ZRCA 2B76B 3VRAB 1C77A 3MC9A 3BVZA 2MP2A 1E6EB 1C3TA 1E5WA 1MVKA 1RFKA 2PMVA 4A8XC 4HPLB 2MBBB 2I1KA 2ZVNA 3WANA 2JQRB 1G6JA 3H1UA 1AWDA 3AEEB 2BKFA 4YSXB 4GW2A 4DHJD 2AYOB 1XXGA 1P7FA 4M8NA 1OTRB 2WX0A 1ZOYB 3V62A 3W9CB 3SFEB 2N7DA 4PYZA 4M8MA 4MGKE 4OZCA 5CTRC 2KDBA 5BYQA 3T3NA 2PLPA 4BG4B 2BBCA 4NQKE 3ZIMA 2LZ6A 2N4FA 5J99A 1B9RA 2GI9A 2N9KA 3VHTC 4K1RB 3MJ5A 3DVGY 3NG0A 1XEEA 3L0WB 2J1QA 5I4DA 2BYFA 3LVVA 5HG2A 4CHKA 3DWGC 2I1JA 5KHOA 1QOGA 1WGYA 3ML8A 1PYWD 2NCNA 1R8GA 4RF6A 1H8CA 2BYVE 1JALA 4IDIA 3ZNID 4HWIB 4RM8A 3A33B 1JQ4A 3OLMD 1A70A 1BMLC 2VZKD 3QJZA 4LCDE 4US9A 1V97A 4P1BC 2W54A 3ZNZB 4TMAB 3VUYA 4IC7B 4GGQA 3L17A 1ZUD2 4YWGG 2QILA 2KWDA 2KOXA 2FIFA 2QJLA 3E9SA 3BYYB 3PTFC 4Z9MA 3DBLB 3A1QB 1D3ZA 3D32A 3TEXA 3R3MA 2WU2B 4JLCA 4IWQA 2K6QA 2HTME 1FCLA 1I7HA 1QZEA 4YSZB 1SXTA 2HD5B 2MRPA 4W9IA 4HCPB 1NENB 3C19A 4GW0A 1LXDA 1FM0D 2KWCA 3VUXA 3QK0A 2G9HD 1XF5L 3AE5B 3NS8A 1FNUA 1XD3B 1KM7A 1PGAA 1QOAA 2K1FA 3KYCD 2FCSA 1ENFA 3AE2B 2AWTA 2K6DB 3M3JA 1FO4A 3PV1A 3PHXB 3NZTA 2L52A 4NAWB 3ALBA 1UUPA 3ZGZA 1PUTA 2D10A 1JCKB 2FCNA 3PHWB 1T5XD 4OVVA 3DOWA 3U52E 3U2SC 1D6EC 2XK5A 5L83A 4XWWA 2DZJA 1HEZE 3QCAA 1GB4A 2LJIA 1AN8A 3RMKC 1V4GA 3PZ8A 3L2EB 5HI1A 3QX1A 2KC2A 4KDLB 2IJ0A 3AI5A 1PGBA 1YD8U 1K8RB 2IYDB 2VRRB 4GN1A 4M01A 3ZTCA 3TIXA 3OG5A 1I4PA 1V86A 1ESFA 1HE8A 4BFRA 4KZ0A 2N9EB 1P50A 2KACA 3SFDB 2V4LA 1T3QA 3BY4B 1J0GA 4S17A 3L2DA 3VQIA 1KLVA 4HDOA 3JPZA 3ZRFA 3ZJVA 5D7GA 1P1AA 3Q3MC 1RLFA 3LDZE 4AS1A 2N9PC 1YQ4B 2JWUA 1FRRA 1UWMA 2JZ3B 4YXDB 3HIZA 2VH2A 5DPRA 4DHJB 3KW5B 3RNFC 1HZ6A 1F0ZA 5D6JB 1TZ1A 2JXXA 2K39A 2KFJA 3C8YA 4J6IA 4E3CA 2NVUI 4TV3A 2KFKA 4ACFA 4ICVA 2WNMA 1T6BX 1FCCC 1TBEA 2SEBD 3N30A 1S1QB 2EMTA 3SD5A 4LJOB 1DYQA 3GOEA 1C4AA 1HQRD 2M8SA 4RGOS 4ZYNA 1P98A 3IG3A 4MT5A 2WXFA 1QH4A 2KT7A 2AL6A 3E56A 2XNAC 4URKA 1E8YA 2ONQA 2V3SA 2D11A 1XCTL 1YJ1A 4GB9A 3P4RB 2GBJA 4FA6A 3A4RA 2IGDA 4RGNA 4WAAA 1QKZA 1LGRA 1D5XC 4AM1A 2G4SA 1MG8A 3DHGC 3L13A 3VXWA 4OVUA 3WA0A 2KDEB 2LASA 3TSSA 4K3BA 4FBJB 1I35A 3BVMA 2KYWA 2MLBA 4XGAB 3VTVA 2AEHA 3TEZA 1YQ3B 2QSDA 3EGRA 1ZP0B 3ZYYX 4XZ4A 1Z5SB 1E0ZA 3H8HA 4GVZA 3ZTDA 2KDMA 3N1YC 1N61A 1OQYA 1WZ0A 2KTRA 2ZPNA 2G1EA 3AH7A 3DQVA 3BYTB 3NJTA 2Z59B 4ZHPA 2BKRB 1NI2A 2GOWA 4HDQA 2DAFA 3V05A 3W5UB 2WDQB 4PS3A 1VRAB 2Q5WD 3DBRB 4J3OD 4RNAA 4H2AA 2MHJA 1M4VA 2XBBC 2L76A 2N7EA 4HXDA 2OJWA 2WYQA 2IY1B 3JSVA 3VR9B 3QA8A 1EM7A 3BK1A 1YMHE 3QARA 1CK1A 1ET6A 2ZCBA 1WXAA 4EOYA 5JHBA 1JRPA 1Y8RC 3R66C 3AE1B 2LGXA 2CU1A 3NUHB 1SE3A 2PJHA 2BS3B 2WU5B 2NR2A 2GLSA 1WJ4A 2QIEB 1UF0A 2IO2B 2LEKA 1WFYA 4FHJA 3KUDB 2ZZPB 4K7UA 1T0SC 2GBNA 3V6EB 2AQ3B 4P1CC 1NDDA 4ANWA 4G11A 4FJZA 2KKCA 1D4BA 2JZPA 4XWTA 2XN9C 2K8HA 1L2NA 3UI3A 4GMVA 4C80A 2M1MA 2N1WA 3TMPB 1Z2MA 5LXHA 4LDTB 2PE9A 3JW0X 4P16A 2K3UA 2JRIB 1GAQB 5J9AA 1I4QA 3PGEA 4PT5A 3TCAA 3HVDA 1ZXIA 2NMQA 1QT9A 3T8MA 5FKAC 2QHOA 4HKZE 2FCQA 4E74A 4K7SA 2KQ4X 2ICIA 2O2VA 3Q3FA 2WXIA 3CMMB 3WALA 4AWJA 4MSMB 2CJOA 1V5TA 4NZLB 1NBFC 2KNBA 4AQ7A 2Z0EB 3B1LX 2DYMA 4K3CA 1WYGA 1TTNA 1L4ZB 2RGFA 2KLGA 4WWNA 2MP2B 3PS6A 4RGMA 3DVGX 4CO7A 3L10B 4LK0M 4IKGA 4O1NA 5JXVA 2IGGA 3DCGA 5G5HA 3L2EA 4KVGB 1YN4A 4JWSC 1J7AA 2BF8B 3VDZA 4L1BA 3I63C 3NS1A 4OW0A 1E7UA 2YEPF 2KVRA 3R7RA 2MBOA 2WXRA 2XEWA 3AE4B 3AE6B 4KGTA 3EHVA 3A4SC 2IDYA 3ZJTA 3V60A 2QC8A 4N58A 2DAJA 4KGRA 2UU7A 2AL3A 4W9GA 3MHZA 3U30A 1I4XA 1TKEA 3PZDA 3SR6A 4NNJB 5BMGA 1MPEA 2J42A 4BKSA 4G50A 2DYBA 3APFA 5IKCM 4YTNB 1YOVB 5HKHA 2W3SA 2CR5A 4BOSC 3RUIB 1STEA 2KWVB 3PRMB 1SE4A 3BIID 2MX2A 4N6EB 4NAWA 3P63A 1WX8A 4IWOA 1L0XB 1QF6A 3HM6X 3ABVB 3IAS1 1N63A 3V61A 5D94A 4RF1A 3B2FA 1FXAA 5T8IA 3RZWC 3GE8C 2ZJDA 2N7JA 1F77A 4B6WA 4XYCA 4R3DA 5FK9C 3MTNB 3RZFA 1WXSA 1WM2A 2J0MA 3K9OB 3B08A 5JZEB 2RDHA 4BKTA 4KIKB 2G3QB 1D5MC 4HVBA 3AE7B 2V3PA 4HJKA 3O65B 4ASWC 1ZE3D 1K53A 4PS7A 3GZNI 2PIAA 3Q3OC 3HUIA 1H4RA 1T0YA 5L95C 2V3NA 3C0RB 1NYQA 3MJWA 1QQRA 3URYA 3ZDTA 1U4AA 2LWPA 2R2OA 2BTEA 2J4XA 2RMMA 3R2IA 2ZCCA 5JH5C 1HZ5A 3AEGB 2VH1A 1KF6B 1L6VA 3PPAA 2DHZA 3RN9C 2QDFA 3NVVA 2PPHA 2OHFA 1D5ZC 2J0JA 2L7RA 4GLSC 1YJJA 1V49A 2KANA 3PT2B 4OVZA 4HPMB 4A20A 3NZUA 1EUVB 2JUOA 2GMIC 4KV2A 3LVWA 4I6NB 3AEDB 5TSSA 3MP9A 2M56B 2MJEA 1RAXA 1EWYC 3Q8AA 1GB1A 3BVGA 5C23A 2BWES 4N9F4 3RT3B 3RULA 2K8BA 1MHHE 2BW2A 2ZW0A 3AMZA 4TUUA 2RD0A 3OJ3A 2L00B 3M95A 3NVWA 1WXQA 2PW9A 3LJ3A 2RDBC 3N1XC 1TY0A 5IOIA 1RYJA 1C9FA 1FRDA 5E6OA 4ZYSA 1DOYA 4IUMB 3W5VB 4MEMA 1IUEA 4X57B 1ACCA 3NVYA 1TS3A 4HKQA 2O6VA 5JHAA 4KSLC 1FIQA 1OQQA 2O6VB 3HK0A 4WWPA 1E7PB 5BYSA 4W9EA 2KTFA 1R4MI 2WXGA 3W1YA 4MDKE 4AJYB 4HEA1 1NEKB 4JQWC 2A5UA 3PVLA 3AEAB 4YSYB 2H88B 2ZPYA 2OJRA 4JE3B 2MCNB 2IO0B 4C4VB 2QEJC 1JWSD 3AXCA 3DREA 2J7QB 2KX3A 5EE1A 3ZUNA 5D3IB 1SJHD 1P9DU 1WJ6A 3X0WA 1UGJA 2CKHB 1JWMD 2HJ8A 4MGYE 1IPGA 4EUTA 3GB1A 2GWDA 3FAHA 2W9NA 4MJSB 1GC6A 2FAZA 2YEPB 4P6VF 1VZ6A 2Y5PA 2KDIA 3MC0B 1HXYD 2G45B 2DZMA 1N60A 3VH4B 2J52A 3L54A 1V1OA 3U7DA 4LNOA 2WXOA 3DDCB 3JU6A 2FIDA 3A1QA 3UIOB 2O6VD 2WDTB 1GC7A 1TGZB 3RYTA 3MHSD 4L2YA 1GUAB 5IA7A 1NVID 3IBEA 5AZFA 3S2AA 1WIAA 1JW9D 3UINB 2IO3B 4ZRKA 1S3SG 1XLNA 2PVGC 3BK2A 1VD2A 1I0EA 2WXKA 3ZQ4A 1WWTA 1ZDXA 1WF9A 1Q10A 3TUOA 3Q8EA 1QOFA 3EECA 1TKYA 4NJCA 3V6CB 1WX7A 3JU5A 2M0AA 3B6RA 2JZZA 1YIWA 2MH7A 1E7VA 4HRSA 3QWZB 2ASQA 3AE9B 1F52A 3APDA 2V4IB 2NTSA 4RF0A 1N5WA 1WM3A 1MI0A 4LLGM 2LHEA 3VVWB 2KZRA 1TY2A 1CMXB 4HK2A 1WY8A 2HDEA 3PREA 2D2QA 5H92C 3NZ3A 2UYZB 3NY5A 2RPQA 3SU8X 5J2RA 1XLPA 4B0EA 2QMTA 3VH3B 4CYEA 3FKYA 5D3DA 2MWSB 4W9JA 4DXFA 1EO6A 3OAWA 1Y56A 1SE9A 2KN5A 2LXAA 3ZNHB 1PQSA 1IYFA 2KJHB 5EE3A 1VJKA 2JWZA 4WJOA 3RNEC 2K22A 3N9YC 3CIRB 1ZPSA 3PLUA 3AM9A 1XLQA 4K7WA 2JYEA 2DNFA 4K81A 2JY6A 4NJ7A 1A5RA 2C9WB 1TZOA 4MELA 1IP9A 5TR5A 3N3KB 1P52A 1B1ZA 2CHXA 4KKIA 4WURA 3UQAA 1WGKA 1VDVA 3VTUA 3U8ZA 1RL9A 4IWPA 3RNCC 2D3BA 1V1PB 2BGFA 4NAMA 3L08A 1WX9A 3Q69A 5G5GA 1TKGA 1K51A 1SGHA 4IM0A 1GG3A 3GS2A 4WJPA 1TT5B 2O2VB 1J8CA 2D3CA 1SE2A 2JX5A 3R8BA 3A9KA 4HROA 4D2KA 5BMHA 1U6RA 1JROA 2PE6B 3RNAC 3Q8BA 2WLBA 1EF1A 1ROEA 2EKEC 5CHFA 1PDXA 2L83A 3VUWA 2WHIA 2D3GA 1EU3A 2LFIA 4XE0A 3WIMA 4E71A 4MSQB 4IM2A 2LRWA 5GMVA 1WR6E 4UDUC 2JYTA 2L32A 3U7ZA 3ONSA 2INNE 3SHQA 3GE3C 4B0MA 1V81A 3LB8C 5FR3A 1HTQA 3UF8A 1M94A 4A3OA 3ZJUA 4FULA 1Q5WB 2DX5B 5AUKA 1FNWA 4Q2RA 4WWMA 2NBUA 5J17A 4QAYA 4FLHA 1ZXHA 5BO4B 2NS5A 5H8YE 4B9KA 2CHWA 2LVPA 2WDRB 2YVCA 1C76A 2FNJB 3H7SA 3RNBC 3IT6B 2RPVA 5E6PA 1E90A 4WAFA 3A9JA 3MFGA 3RPFC 3ZO5B 1WGDA 1NI3A 2K25A 3T9LA 2NBVB 3DBHB 4II3B 1AARA 3AB5A 4EZLA 4LNNA 3RI7C 1DOXA 4OZBA 2PTLA 2LUEA 3TBLD 1JWUD 4MJSA 2INPE 5IP4D 2K5PA 3SDLC 2WXQA 4L23A 3P4PB 5IAAC 4DWFA 3CSTA 2KJ6A 3AU4A 5EE0A 2KXJA 1XLOA 1ZW7A 1TS4A 4DK5A 1F1HA 3NVZA 1YX5B 2KAJA 3FILB 3M10A 4LDTD 3DBHI 2QCZA 3X23A 3DVNV 1L0YB 4FJVB 1R4NB 1YN3A 2Z0DB 1R4NI 3M62B 4I6PA 1WYWB 3QC8B 2GWCA 1X1MA 1EF5A 4DDGD 1ZKHA 4BAXA 4PS8A 2NPTB 4TQ1A 2AQ2B 2IPKD 3JVZX 3AE3B 3BZDB 3ZXVA 1KFYB 1VZ7A 2FCMA 3TJPA 1P0RA 4M0WB 4MM3A 2BT6A 1GPXA 2JPHA 2LVOA 1ZGUB 1GNUA 3WCQA 1OQRA 1FEHA 4TKNA 4W9KA 2IY0B 3KUCB 1LFDA 1E9MA 4WWOA 1V2YA 1JWBD 2ZVOA 2MQJA 2AQ1B 3TEYA 1L4DB 3KLSX 1FFUA 2C7MB 4IW0A 3RD2A 1K52A 1IBXB 3H7PA 4YT0B 3PRPB 4GVYA 4IOIE 4YL8A 2BWFA 1NYRA 4FN2A 4BKSD 2JSVX 2LGSA 4RF9A 2Z8LA 3Q2AC 1E10A 2J0KA 5KHQA 4JX1C 4PK1A 2KC1A 3V3XA 4HPPA 2L8JA 4NJ6A 1YX6B 4DXAB 3EA6A 4GDKA 3QAQA 3HRDD 4EEWA 1C79A 2FE8A 4AJWA 3JYUA 1V6EA 1BG0A 2EELA 3IFWB 4ITKA 3VAWA 3IAM1 2R61A 2JVCA 2KFKB 2FUG1 3FC4A 4NQLB 1KLGD 2N9LA 1QOBA 2JXTA 1TS2A 1Q1OA 1SIJA 1TYGB 2WDVB 1PGXA 1ZDVA 2V0GA 1E8ZA 3VFKA 2JF5A 1C78A 2FBWB 4USAA 4EE2A 4JPSA 3HVZA 1WGRA 4KIKA 1ISNA 4RF7A 4ZRJA 3DBSA 5C1ZA 3EFCA 2LRUA 3AULA 3ML9A 3PRZA 1SIFA 3ZXRA 1K50A 2DYOA 2JT4B 5CX3A 3P4QB 3KVFB 4ZDVA 2K8CA 1V80A 2VZKB 1V9JA 4BZAA 1WE7A 5HHDG 3ZLZA 4TSSA 4MGZE 4XDCA 2KVZA 2DLBA 2WXNA 1QLBB 1OFFA 2MBEA 2LGYA 2D32A 2BS4B 5IO9A 3AN1A 4MGIE 2CRKA 3U4EG 3WAOA 4JL9A 3JSVB 1FXTB 2CS4A 2V1YA 5HFYA 1WXVA 3K9PB 1BXTA 2Y3AA 4DHZB 3NOBA 5G2NA 1WXMA 2KMAA 1VLBA 4DQOC 5C2TB 1GOZA 1SEBD 5LXIB 1C4CA 1L7YA 1BT0A 3VR8B 1FMAD 2DWQA 3P2BA 3EC8A 2E3TA 4IG7B 2LVQA 2KTRB 2LI5A 4GOCA 2BB5A 4RFBA 2D5GA 2DZKA 3H9DA 1YJIA 3HHMA 1AW7A 1L6UA 4BBNC 3LYYA 1WRDB 3L4PA 1RRBA 2GBRA 3Q14C 2INDC 3UQBA 4EKUA 3LN6A 2PKOA 4ANVA 1UZXB 1YNTE 3KWLA 3IHPC 1VRPA 2KD0A 2KLCA 3Q3NC 4NY0A 2K9XA 4M02A 2LGIA 1PFDA 1SJED 4AUQC 2MEKA 4KX6B 1WI0A 5AEKB 2LD9A 2WXMA 4GU2A 2C7HA 4F8CB 1SB3C 3KYDD 1C1YB 2M17A 2MA9B 4WQMA 2BYEA 1MJDA 4F7ZA 3W1SC 1F9JA 2IGHA 2YLMA 2JU6X 4DXGA 1RWSA 2MBQA 2C7NB 3P1MA 4XC2A 2BS2B 4XDDA 5E6NA 1WJUA 2WS3B 3IVFA 2UWQA 1UELA 5AZGA 2L1AA 5C3JB 2INCC 5FR6A 3LXFA 5EE9A 4BG4A 4FADA 4KZCA 1MG4A 4KGSA 1CRKA 2J53A 4AP4C 4W9LA 3IG5A 4LTUA 2W55A 4C00A 2MJ3A 3KUZA 4BKGA 1I4HA 4WH4A 1XQQA 4FHKA 4G0NB 1CQVA 4BHLA 3H7PB 3UIPB 1IBXA 4HJGE 4M0WA 2KN4A 4MM3B 5IN7A 1VA6A 3BWUD 4ARCA 2WGSA 4IM3A 2KQSA 2KWUB 2HTHA 4I6LB 2FUHB 4WIPA 4F1SA 2D33A 4B95A 2V9HA 1N62A 3Q6BA 1L0VB 3TL5A 1UNSA 3QIJA 5CHVC 2HJ1A 1V5OA 3GP7A 2KHWB 2N0SB 4W9CA 2EKIA 3R2TA 5BYRA 1SD0A 1F2RI 2GB1A 1RFAA 1FFVA 2H89B 3BINA 3AEBB 3AE8B 3ZNGC 4TQ0A 1WRIA 2NPTA 4LNKA 5MPOA 3ZVVA 1FNVA 1GJZA 2M4NA 1E8XA 1J7BA 4ZOHC 4W9FA 1AYFA 1OEYA 3GZNB 5G55A 2GRIA 5GXGB 4N59A 1HTOA 1FD6A 3KWVA 2D3AA 1HA5A 3B0AA 2HE7A 3FILA 4EFOA 1EU4A 2RR9A 1XO3A 4DHZE 2SAKA 2N1VA 2WQYB 3KQ4A 2X8XX 2LUMA 2MSED 4WJNA 1KH0A 1UWXA 4HLEA 4AOFA 1OGWA 5BMIA 5DPTA 4JWUC 1DGJA 1MHXA 2L05A 3W1SA 2WXHA 1WZ3A 4ICUA 3DPDA 1I4GA 3I9V1 4RCOA 1VCBA 2MJDA 4MH8A 2WX1A 3A9JB 4KKJA 2DBYA 1E8WA 3QHTA 2R2QA 1UD7A 3VRBB 2W3RA 3B9JA 3NZSA 4BOZB 1VZ8A 2CU3A 3LN7A 1TT4A 2Y5CA 1VR9A 2K0PA 1WGHA 2TSSA 2CJNA 2D07B 2ZEQA 3WAPA 1KJTA 3R7QA 3P4SB 2GBKA 4GDKB 3Q8CA 1YQBA 2L3ZA 2WXLA 5DCNA 1TJEA 2RDGA 3ZW3A 2LXCA 4ZRPA
chains in the Genus database with same CATH topology
2QC8A 2WHIA 3LN7A 2UU7A 1V4GA 2D3AA 2D33A 1TT4A 3NZTA 3NG0A 2OJWA 2GLSA 4LNIA 3LVWA 3LVVA 4LNNA 2D3CA 2LGSA 4S17A 3ZXVA 2BVCA 4LNKA 1LGRA 1F52A 4LNOA 3ZXRA 3FKYA 4HPPA 4S0RA 1VA6A 2D3BA 4LNFA 3IG5A 2D32A 2WGSA 1R8GA 1HTQA 4XYCA 2GWDA 2GWCA 3IG8A 4ACFA 1FPYA 1F1HA 4BAXA 1HTOA 3LN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC8 A;  2WHI A;  2UU7 A;  2D3A A;  3NG0 A;  2OJW A;  2GLS A;  4LNI A;  4LNN A;  2D3C A;  2LGS A;  4S17 A;  3ZXV A;  2BVC A;  4LNK A;  1LGR A;  1F52 A;  4LNO A;  3ZXR A;  3FKY A;  4HPP A;  4S0R A;  2D3B A;  4LNF A;  2WGS A;  1HTQ A;  4XYC A;  4ACF A;  1FPY A;  1F1H A;  4BAX A;  1HTO A; 
#chains in the Genus database with same CATH topology
 3MC8 A;  1R7S A;  2BPS A;  2IZV B;  3M63 B;  2CHZ A;  4LNI A;  3HM3 A;  4BBN F;  1WSP A;  2PVO D;  1R4M B;  2ZNV C;  1UGM A;  1V8C A;  3JQ3 A;  3N20 C;  4C7Y A;  2GBM A;  2JRH A;  4YTM B;  4A90 A;  3I3T B;  3RFZ B;  4C4V A;  1T0Q C;  4OHJ A;  1J7C A;  4ANX A;  1FXI A;  4A3P A;  1LQB A;  1I42 A;  4RH6 A;  4S0R A;  4C56 C;  3RCZ A;  4LNF A;  1V1P A;  2B3A A;  2WWZ A;  4Q2J A;  4RM9 A;  4NPN A;  4PYU A;  2WXJ A;  4JIO U;  3NRZ A;  3H6N A;  4EZJ A;  1SF0 A;  1BUI C;  1JWA D;  1F2R C;  5DPW A;  3DBL I;  1QIL A;  1QK1 A;  3OWE B;  2AX5 A;  2X38 A;  2KMM A;  2LJ5 A;  4DBG A;  2XK5 B;  1WMH A;  3T3O A;  4MH0 E;  1KLU D;  2RSU A;  2KO3 A;  2OED A;  1WE6 A;  1LM8 B;  3PO0 A;  4A6Q A;  2C60 A;  4JGH B;  3N1Z C;  3W2D A;  3IXS A;  2E6X A;  3ZKJ C;  4RF8 A;  5CHW A;  4XX5 A;  3NHE B;  5LLI A;  3VTW A;  4ZHO A;  3ETR A;  4ARI A;  2KJR A;  3O13 A;  2ZNV B;  3J9C A;  1G0W A;  2IBI B;  3P42 A;  3PSE B;  5DPS A;  4BVU C;  4RMA A;  3OJ4 B;  4OZA A;  2KQ7 A;  3AV8 A;  1Q0W B;  1CJE A;  2W82 A;  3IG8 A;  2BB6 A;  3ECI A;  3ZDM C;  1LO5 D;  1FPY A;  4G3X B;  4II2 B;  1M15 A;  4A9A A;  2BQQ A;  3WAM A;  4YTP B;  3EUB 2;  1C4P A;  2ZW1 A;  4C7Z A;  2C5L C;  5D2M B;  2KDF B;  4LJP B;  3AEF B;  1ET9 A;  1UBI A;  3UGB B;  4ZRI A;  2Y5B B;  1WGG A;  2PEA A;  2L0T A;  2KX0 A;  1N5X A;  4MAC A;  2IO1 B;  2ON8 A;  3DHI C;  1WH3 A;  4REZ A;  3RNG C;  2DEN B;  2KK8 A;  1IGC A;  1L5P A;  2I38 A;  4W9H A;  1JML A;  2A4Z A;  2EMS A;  4HCN B;  2KMC A;  1TIF A;  1KOT A;  4M00 A;  1KTK A;  2L0F A;  5AUI A;  4GDL B;  5EDS A;  1SBB B;  2NTT A;  1RM6 C;  4GDL A;  2WP9 B;  3AU5 A;  2N9X A;  3AEC B;  1WR1 A;  2LHD A;  4P7I A;  2BYT A;  4CQN A;  1XCQ L;  3DRB A;  1WJN A;  4DDI D;  1MFW A;  2LGD A;  3KH0 A;  4WJQ A;  2M0X A;  3APC A;  1T0R C;  1OEY J;  2WXP A;  3Q3J A;  4GSW A;  4US8 A;  2MBH A;  3PLV A;  4FXC A;  3L16 A;  2OOB B;  1N6Z A;  3Q8F A;  3A9K B;  4KDI C;  1DOI A;  1SSN A;  1JRU A;  1KRH A;  1IGD A;  2G4D B;  2M19 A;  3CF6 E;  3IT4 B;  2LMC A;  4GXB A;  1TS5 A;  1XT9 B;  1EWC A;  3ENE A;  2BVC A;  3CWI A;  3I5J C;  1WMH B;  4W9D A;  1J19 A;  3QQ8 B;  1P3Q U;  5E6J A;  5AZH A;  2I2Y A;  3DHH C;  3EFU A;  3CSF A;  3B2G A;  3SEB A;  3N32 A;  4RGT A;  4KSK C;  3I57 A;  4FJY A;  2MW5 A;  5J18 A;  3DBR I;  4GIV A;  4EZK A;  4ANU A;  1I4R A;  5LNK 1;  1YN5 A;  3PZ7 A;  2NBW B;  1P7E A;  1UH6 A;  2ACZ B;  1UBQ A;  2REX A;  2DZI A;  4A55 A;  1CZP A;  3DVN U;  4WQO B;  4ZRQ A;  3TEW A;  3DWM A;  3ZRC A;  2B76 B;  3VRA B;  1C77 A;  3MC9 A;  3BVZ A;  2MP2 A;  1E6E B;  1C3T A;  1E5W A;  1MVK A;  1RFK A;  2PMV A;  4A8X C;  4HPL B;  2MBB B;  2I1K A;  2ZVN A;  3WAN A;  2JQR B;  1G6J A;  3H1U A;  1AWD A;  3AEE B;  2BKF A;  4YSX B;  4GW2 A;  4DHJ D;  2AYO B;  1XXG A;  1P7F A;  4M8N A;  1OTR B;  2WX0 A;  1ZOY B;  3V62 A;  3W9C B;  3SFE B;  2N7D A;  4PYZ A;  4M8M A;  4MGK E;  4OZC A;  5CTR C;  2KDB A;  5BYQ A;  3T3N A;  2PLP A;  4BG4 B;  2BBC A;  4NQK E;  3ZIM A;  2LZ6 A;  2N4F A;  5J99 A;  1B9R A;  2GI9 A;  2N9K A;  3VHT C;  4K1R B;  3MJ5 A;  3DVG Y;  3NG0 A;  1XEE A;  3L0W B;  2J1Q A;  5I4D A;  2BYF A;  3LVV A;  5HG2 A;  4CHK A;  3DWG C;  2I1J A;  5KHO A;  1QOG A;  1WGY A;  3ML8 A;  1PYW D;  2NCN A;  1R8G A;  4RF6 A;  1H8C A;  2BYV E;  1JAL A;  4IDI A;  3ZNI D;  4HWI B;  4RM8 A;  3A33 B;  1JQ4 A;  3OLM D;  1A70 A;  1BML C;  2VZK D;  3QJZ A;  4LCD E;  4US9 A;  1V97 A;  4P1B C;  2W54 A;  3ZNZ B;  4TMA B;  3VUY A;  4IC7 B;  4GGQ A;  3L17 A;  1ZUD 2;  4YWG G;  2QIL A;  2KWD A;  2KOX A;  2FIF A;  2QJL A;  3E9S A;  3BYY B;  3PTF C;  4Z9M A;  3DBL B;  3A1Q B;  1D3Z A;  3D32 A;  3TEX A;  3R3M A;  2WU2 B;  4JLC A;  4IWQ A;  2K6Q A;  2HTM E;  1FCL A;  1I7H A;  1QZE A;  4YSZ B;  1SXT A;  2HD5 B;  2MRP A;  4W9I A;  4HCP B;  1NEN B;  3C19 A;  4GW0 A;  1LXD A;  1FM0 D;  2KWC A;  3VUX A;  3QK0 A;  2G9H D;  1XF5 L;  3AE5 B;  3NS8 A;  1FNU A;  1XD3 B;  1KM7 A;  1PGA A;  1QOA A;  2K1F A;  3KYC D;  2FCS A;  1ENF A;  3AE2 B;  2AWT A;  2K6D B;  3M3J A;  1FO4 A;  3PV1 A;  3PHX B;  3NZT A;  2L52 A;  4NAW B;  3ALB A;  1UUP A;  3ZGZ A;  1PUT A;  2D10 A;  1JCK B;  2FCN A;  3PHW B;  1T5X D;  4OVV A;  3DOW A;  3U52 E;  3U2S C;  1D6E C;  2XK5 A;  5L83 A;  4XWW A;  2DZJ A;  1HEZ E;  3QCA A;  1GB4 A;  2LJI A;  1AN8 A;  3RMK C;  1V4G A;  3PZ8 A;  3L2E B;  5HI1 A;  3QX1 A;  2KC2 A;  4KDL B;  2IJ0 A;  3AI5 A;  1PGB A;  1YD8 U;  1K8R B;  2IYD B;  2VRR B;  4GN1 A;  4M01 A;  3ZTC A;  3TIX A;  3OG5 A;  1I4P A;  1V86 A;  1ESF A;  1HE8 A;  4BFR A;  4KZ0 A;  2N9E B;  1P50 A;  2KAC A;  3SFD B;  2V4L A;  1T3Q A;  3BY4 B;  1J0G A;  4S17 A;  3L2D A;  3VQI A;  1KLV A;  4HDO A;  3JPZ A;  3ZRF A;  3ZJV A;  5D7G A;  1P1A A;  3Q3M C;  1RLF A;  3LDZ E;  4AS1 A;  2N9P C;  1YQ4 B;  2JWU A;  1FRR A;  1UWM A;  2JZ3 B;  4YXD B;  3HIZ A;  2VH2 A;  5DPR A;  4DHJ B;  3KW5 B;  3RNF C;  1HZ6 A;  1F0Z A;  5D6J B;  1TZ1 A;  2JXX A;  2K39 A;  2KFJ A;  3C8Y A;  4J6I A;  4E3C A;  2NVU I;  4TV3 A;  2KFK A;  4ACF A;  4ICV A;  2WNM A;  1T6B X;  1FCC C;  1TBE A;  2SEB D;  3N30 A;  1S1Q B;  2EMT A;  3SD5 A;  4LJO B;  1DYQ A;  3GOE A;  1C4A A;  1HQR D;  2M8S A;  4RGO S;  4ZYN A;  1P98 A;  3IG3 A;  4MT5 A;  2WXF A;  1QH4 A;  2KT7 A;  2AL6 A;  3E56 A;  2XNA C;  4URK A;  1E8Y A;  2ONQ A;  2V3S A;  2D11 A;  1XCT L;  1YJ1 A;  4GB9 A;  3P4R B;  2GBJ A;  4FA6 A;  3A4R A;  2IGD A;  4RGN A;  4WAA A;  1QKZ A;  1LGR A;  1D5X C;  4AM1 A;  2G4S A;  1MG8 A;  3DHG C;  3L13 A;  3VXW A;  4OVU A;  3WA0 A;  2KDE B;  2LAS A;  3TSS A;  4K3B A;  4FBJ B;  1I35 A;  3BVM A;  2KYW A;  2MLB A;  4XGA B;  3VTV A;  2AEH A;  3TEZ A;  1YQ3 B;  2QSD A;  3EGR A;  1ZP0 B;  3ZYY X;  4XZ4 A;  1Z5S B;  1E0Z A;  3H8H A;  4GVZ A;  3ZTD A;  2KDM A;  3N1Y C;  1N61 A;  1OQY A;  1WZ0 A;  2KTR A;  2ZPN A;  2G1E A;  3AH7 A;  3DQV A;  3BYT B;  3NJT A;  2Z59 B;  4ZHP A;  2BKR B;  1NI2 A;  2GOW A;  4HDQ A;  2DAF A;  3V05 A;  3W5U B;  2WDQ B;  4PS3 A;  1VRA B;  2Q5W D;  3DBR B;  4J3O D;  4RNA A;  4H2A A;  2MHJ A;  1M4V A;  2XBB C;  2L76 A;  2N7E A;  4HXD A;  2OJW A;  2WYQ A;  2IY1 B;  3JSV A;  3VR9 B;  3QA8 A;  1EM7 A;  3BK1 A;  1YMH E;  3QAR A;  1CK1 A;  1ET6 A;  2ZCB A;  1WXA A;  4EOY A;  5JHB A;  1JRP A;  1Y8R C;  3R66 C;  3AE1 B;  2LGX A;  2CU1 A;  3NUH B;  1SE3 A;  2PJH A;  2BS3 B;  2WU5 B;  2NR2 A;  2GLS A;  1WJ4 A;  2QIE B;  1UF0 A;  2IO2 B;  2LEK A;  1WFY A;  4FHJ A;  3KUD B;  2ZZP B;  4K7U A;  1T0S C;  2GBN A;  3V6E B;  2AQ3 B;  4P1C C;  1NDD A;  4ANW A;  4G11 A;  4FJZ A;  2KKC A;  1D4B A;  2JZP A;  4XWT A;  2XN9 C;  2K8H A;  1L2N A;  3UI3 A;  4GMV A;  4C80 A;  2M1M A;  2N1W A;  3TMP B;  1Z2M A;  5LXH A;  4LDT B;  2PE9 A;  3JW0 X;  4P16 A;  2K3U A;  2JRI B;  1GAQ B;  5J9A A;  1I4Q A;  3PGE A;  4PT5 A;  3TCA A;  3HVD A;  1ZXI A;  2NMQ A;  1QT9 A;  3T8M A;  5FKA C;  2QHO A;  4HKZ E;  2FCQ A;  4E74 A;  4K7S A;  2KQ4 X;  2ICI A;  2O2V A;  3Q3F A;  2WXI A;  3CMM B;  3WAL A;  4AWJ A;  4MSM B;  2CJO A;  1V5T A;  4NZL B;  1NBF C;  2KNB A;  4AQ7 A;  2Z0E B;  3B1L X;  2DYM A;  4K3C A;  1WYG A;  1TTN A;  1L4Z B;  2RGF A;  2KLG A;  4WWN A;  2MP2 B;  3PS6 A;  4RGM A;  3DVG X;  4CO7 A;  3L10 B;  4LK0 M;  4IKG A;  4O1N A;  5JXV A;  2IGG A;  3DCG A;  5G5H A;  3L2E A;  4KVG B;  1YN4 A;  4JWS C;  1J7A A;  2BF8 B;  3VDZ A;  4L1B A;  3I63 C;  3NS1 A;  4OW0 A;  1E7U A;  2YEP F;  2KVR A;  3R7R A;  2MBO A;  2WXR A;  2XEW A;  3AE4 B;  3AE6 B;  4KGT A;  3EHV A;  3A4S C;  2IDY A;  3ZJT A;  3V60 A;  2QC8 A;  4N58 A;  2DAJ A;  4KGR A;  2UU7 A;  2AL3 A;  4W9G A;  3MHZ A;  3U30 A;  1I4X A;  1TKE A;  3PZD A;  3SR6 A;  4NNJ B;  5BMG A;  1MPE A;  2J42 A;  4BKS A;  4G50 A;  2DYB A;  3APF A;  5IKC M;  4YTN B;  1YOV B;  5HKH A;  2W3S A;  2CR5 A;  4BOS C;  3RUI B;  1STE A;  2KWV B;  3PRM B;  1SE4 A;  3BII D;  2MX2 A;  4N6E B;  4NAW A;  3P63 A;  1WX8 A;  4IWO A;  1L0X B;  1QF6 A;  3HM6 X;  3ABV B;  3IAS 1;  1N63 A;  3V61 A;  5D94 A;  4RF1 A;  3B2F A;  1FXA A;  5T8I A;  3RZW C;  3GE8 C;  2ZJD A;  2N7J A;  1F77 A;  4B6W A;  4XYC A;  4R3D A;  5FK9 C;  3MTN B;  3RZF A;  1WXS A;  1WM2 A;  2J0M A;  3K9O B;  3B08 A;  5JZE B;  2RDH A;  4BKT A;  4KIK B;  2G3Q B;  1D5M C;  4HVB A;  3AE7 B;  2V3P A;  4HJK A;  3O65 B;  4ASW C;  1ZE3 D;  1K53 A;  4PS7 A;  3GZN I;  2PIA A;  3Q3O C;  3HUI A;  1H4R A;  1T0Y A;  5L95 C;  2V3N A;  3C0R B;  1NYQ A;  3MJW A;  1QQR A;  3URY A;  3ZDT A;  1U4A A;  2LWP A;  2R2O A;  2BTE A;  2J4X A;  2RMM A;  3R2I A;  2ZCC A;  5JH5 C;  1HZ5 A;  3AEG B;  2VH1 A;  1KF6 B;  1L6V A;  3PPA A;  2DHZ A;  3RN9 C;  2QDF A;  3NVV A;  2PPH A;  2OHF A;  1D5Z C;  2J0J A;  2L7R A;  4GLS C;  1YJJ A;  1V49 A;  2KAN A;  3PT2 B;  4OVZ A;  4HPM B;  4A20 A;  3NZU A;  1EUV B;  2JUO A;  2GMI C;  4KV2 A;  3LVW A;  4I6N B;  3AED B;  5TSS A;  3MP9 A;  2M56 B;  2MJE A;  1RAX A;  1EWY C;  3Q8A A;  1GB1 A;  3BVG A;  5C23 A;  2BWE S;  4N9F 4;  3RT3 B;  3RUL A;  2K8B A;  1MHH E;  2BW2 A;  2ZW0 A;  3AMZ A;  4TUU A;  2RD0 A;  3OJ3 A;  2L00 B;  3M95 A;  3NVW A;  1WXQ A;  2PW9 A;  3LJ3 A;  2RDB C;  3N1X C;  1TY0 A;  5IOI A;  1RYJ A;  1C9F A;  1FRD A;  5E6O A;  4ZYS A;  1DOY A;  4IUM B;  3W5V B;  4MEM A;  1IUE A;  4X57 B;  1ACC A;  3NVY A;  1TS3 A;  4HKQ A;  2O6V A;  5JHA A;  4KSL C;  1FIQ A;  1OQQ A;  2O6V B;  3HK0 A;  4WWP A;  1E7P B;  5BYS A;  4W9E A;  2KTF A;  1R4M I;  2WXG A;  3W1Y A;  4MDK E;  4AJY B;  4HEA 1;  1NEK B;  4JQW C;  2A5U A;  3PVL A;  3AEA B;  4YSY B;  2H88 B;  2ZPY A;  2OJR A;  4JE3 B;  2MCN B;  2IO0 B;  4C4V B;  2QEJ C;  1JWS D;  3AXC A;  3DRE A;  2J7Q B;  2KX3 A;  5EE1 A;  3ZUN A;  5D3I B;  1SJH D;  1P9D U;  1WJ6 A;  3X0W A;  1UGJ A;  2CKH B;  1JWM D;  2HJ8 A;  4MGY E;  1IPG A;  4EUT A;  3GB1 A;  2GWD A;  3FAH A;  2W9N A;  4MJS B;  1GC6 A;  2FAZ A;  2YEP B;  4P6V F;  1VZ6 A;  2Y5P A;  2KDI A;  3MC0 B;  1HXY D;  2G45 B;  2DZM A;  1N60 A;  3VH4 B;  2J52 A;  3L54 A;  1V1O A;  3U7D A;  4LNO A;  2WXO A;  3DDC B;  3JU6 A;  2FID A;  3A1Q A;  3UIO B;  2O6V D;  2WDT B;  1GC7 A;  1TGZ B;  3RYT A;  3MHS D;  4L2Y A;  1GUA B;  5IA7 A;  1NVI D;  3IBE A;  5AZF A;  3S2A A;  1WIA A;  1JW9 D;  3UIN B;  2IO3 B;  4ZRK A;  1S3S G;  1XLN A;  2PVG C;  3BK2 A;  1VD2 A;  1I0E A;  2WXK A;  3ZQ4 A;  1WWT A;  1ZDX A;  1WF9 A;  1Q10 A;  3TUO A;  3Q8E A;  1QOF A;  3EEC A;  1TKY A;  4NJC A;  3V6C B;  1WX7 A;  3JU5 A;  2M0A A;  3B6R A;  2JZZ A;  1YIW A;  2MH7 A;  1E7V A;  4HRS A;  3QWZ B;  2ASQ A;  3AE9 B;  1F52 A;  3APD A;  2V4I B;  2NTS A;  4RF0 A;  1N5W A;  1WM3 A;  1MI0 A;  4LLG M;  2LHE A;  3VVW B;  2KZR A;  1TY2 A;  1CMX B;  4HK2 A;  1WY8 A;  2HDE A;  3PRE A;  2D2Q A;  5H92 C;  3NZ3 A;  2UYZ B;  3NY5 A;  2RPQ A;  3SU8 X;  5J2R A;  1XLP A;  4B0E A;  2QMT A;  3VH3 B;  4CYE A;  3FKY A;  5D3D A;  2MWS B;  4W9J A;  4DXF A;  1EO6 A;  3OAW A;  1Y56 A;  1SE9 A;  2KN5 A;  2LXA A;  3ZNH B;  1PQS A;  1IYF A;  2KJH B;  5EE3 A;  1VJK A;  2JWZ A;  4WJO A;  3RNE C;  2K22 A;  3N9Y C;  3CIR B;  1ZPS A;  3PLU A;  3AM9 A;  1XLQ A;  4K7W A;  2JYE A;  2DNF A;  4K81 A;  2JY6 A;  4NJ7 A;  1A5R A;  2C9W B;  1TZO A;  4MEL A;  1IP9 A;  5TR5 A;  3N3K B;  1P52 A;  1B1Z A;  2CHX A;  4KKI A;  4WUR A;  3UQA A;  1WGK A;  1VDV A;  3VTU A;  3U8Z A;  1RL9 A;  4IWP A;  3RNC C;  2D3B A;  1V1P B;  2BGF A;  4NAM A;  3L08 A;  1WX9 A;  3Q69 A;  5G5G A;  1TKG A;  1K51 A;  1SGH A;  4IM0 A;  1GG3 A;  3GS2 A;  4WJP A;  1TT5 B;  2O2V B;  1J8C A;  2D3C A;  1SE2 A;  2JX5 A;  3R8B A;  3A9K A;  4HRO A;  4D2K A;  5BMH A;  1U6R A;  1JRO A;  2PE6 B;  3RNA C;  3Q8B A;  2WLB A;  1EF1 A;  1ROE A;  2EKE C;  5CHF A;  1PDX A;  2L83 A;  3VUW A;  2WHI A;  2D3G A;  1EU3 A;  2LFI A;  4XE0 A;  3WIM A;  4E71 A;  4MSQ B;  4IM2 A;  2LRW A;  5GMV A;  1WR6 E;  4UDU C;  2JYT A;  2L32 A;  3U7Z A;  3ONS A;  2INN E;  3SHQ A;  3GE3 C;  4B0M A;  1V81 A;  3LB8 C;  5FR3 A;  1HTQ A;  3UF8 A;  1M94 A;  4A3O A;  3ZJU A;  4FUL A;  1Q5W B;  2DX5 B;  5AUK A;  1FNW A;  4Q2R A;  4WWM A;  2NBU A;  5J17 A;  4QAY A;  4FLH A;  1ZXH A;  5BO4 B;  2NS5 A;  5H8Y E;  4B9K A;  2CHW A;  2LVP A;  2WDR B;  2YVC A;  1C76 A;  2FNJ B;  3H7S A;  3RNB C;  3IT6 B;  2RPV A;  5E6P A;  1E90 A;  4WAF A;  3A9J A;  3MFG A;  3RPF C;  3ZO5 B;  1WGD A;  1NI3 A;  2K25 A;  3T9L A;  2NBV B;  3DBH B;  4II3 B;  1AAR A;  3AB5 A;  4EZL A;  4LNN A;  3RI7 C;  1DOX A;  4OZB A;  2PTL A;  2LUE A;  3TBL D;  1JWU D;  4MJS A;  2INP E;  5IP4 D;  2K5P A;  3SDL C;  2WXQ A;  4L23 A;  3P4P B;  5IAA C;  4DWF A;  3CST A;  2KJ6 A;  3AU4 A;  5EE0 A;  2KXJ A;  1XLO A;  1ZW7 A;  1TS4 A;  4DK5 A;  1F1H A;  3NVZ A;  1YX5 B;  2KAJ A;  3FIL B;  3M10 A;  4LDT D;  3DBH I;  2QCZ A;  3X23 A;  3DVN V;  1L0Y B;  4FJV B;  1R4N B;  1YN3 A;  2Z0D B;  1R4N I;  3M62 B;  4I6P A;  1WYW B;  3QC8 B;  2GWC A;  1X1M A;  1EF5 A;  4DDG D;  1ZKH A;  4BAX A;  4PS8 A;  2NPT B;  4TQ1 A;  2AQ2 B;  2IPK D;  3JVZ X;  3AE3 B;  3BZD B;  3ZXV A;  1KFY B;  1VZ7 A;  2FCM A;  3TJP A;  1P0R A;  4M0W B;  4MM3 A;  2BT6 A;  1GPX A;  2JPH A;  2LVO A;  1ZGU B;  1GNU A;  3WCQ A;  1OQR A;  1FEH A;  4TKN A;  4W9K A;  2IY0 B;  3KUC B;  1LFD A;  1E9M A;  4WWO A;  1V2Y A;  1JWB D;  2ZVO A;  2MQJ A;  2AQ1 B;  3TEY A;  1L4D B;  3KLS X;  1FFU A;  2C7M B;  4IW0 A;  3RD2 A;  1K52 A;  1IBX B;  3H7P A;  4YT0 B;  3PRP B;  4GVY A;  4IOI E;  4YL8 A;  2BWF A;  1NYR A;  4FN2 A;  4BKS D;  2JSV X;  2LGS A;  4RF9 A;  2Z8L A;  3Q2A C;  1E10 A;  2J0K A;  5KHQ A;  4JX1 C;  4PK1 A;  2KC1 A;  3V3X A;  4HPP A;  2L8J A;  4NJ6 A;  1YX6 B;  4DXA B;  3EA6 A;  4GDK A;  3QAQ A;  3HRD D;  4EEW A;  1C79 A;  2FE8 A;  4AJW A;  3JYU A;  1V6E A;  1BG0 A;  2EEL A;  3IFW B;  4ITK A;  3VAW A;  3IAM 1;  2R61 A;  2JVC A;  2KFK B;  2FUG 1;  3FC4 A;  4NQL B;  1KLG D;  2N9L A;  1QOB A;  2JXT A;  1TS2 A;  1Q1O A;  1SIJ A;  1TYG B;  2WDV B;  1PGX A;  1ZDV A;  2V0G A;  1E8Z A;  3VFK A;  2JF5 A;  1C78 A;  2FBW B;  4USA A;  4EE2 A;  4JPS A;  3HVZ A;  1WGR A;  4KIK A;  1ISN A;  4RF7 A;  4ZRJ A;  3DBS A;  5C1Z A;  3EFC A;  2LRU A;  3AUL A;  3ML9 A;  3PRZ A;  1SIF A;  3ZXR A;  1K50 A;  2DYO A;  2JT4 B;  5CX3 A;  3P4Q B;  3KVF B;  4ZDV A;  2K8C A;  1V80 A;  2VZK B;  1V9J A;  4BZA A;  1WE7 A;  5HHD G;  3ZLZ A;  4TSS A;  4MGZ E;  4XDC A;  2KVZ A;  2DLB A;  2WXN A;  1QLB B;  1OFF A;  2MBE A;  2LGY A;  2D32 A;  2BS4 B;  5IO9 A;  3AN1 A;  4MGI E;  2CRK A;  3U4E G;  3WAO A;  4JL9 A;  3JSV B;  1FXT B;  2CS4 A;  2V1Y A;  5HFY A;  1WXV A;  3K9P B;  1BXT A;  2Y3A A;  4DHZ B;  3NOB A;  5G2N A;  1WXM A;  2KMA A;  1VLB A;  4DQO C;  5C2T B;  1GOZ A;  1SEB D;  5LXI B;  1C4C A;  1L7Y A;  1BT0 A;  3VR8 B;  1FMA D;  2DWQ A;  3P2B A;  3EC8 A;  2E3T A;  4IG7 B;  2LVQ A;  2KTR B;  2LI5 A;  4GOC A;  2BB5 A;  4RFB A;  2D5G A;  2DZK A;  3H9D A;  1YJI A;  3HHM A;  1AW7 A;  1L6U A;  4BBN C;  3LYY A;  1WRD B;  3L4P A;  1RRB A;  2GBR A;  3Q14 C;  2IND C;  3UQB A;  4EKU A;  3LN6 A;  2PKO A;  4ANV A;  1UZX B;  1YNT E;  3KWL A;  3IHP C;  1VRP A;  2KD0 A;  2KLC A;  3Q3N C;  4NY0 A;  2K9X A;  4M02 A;  2LGI A;  1PFD A;  1SJE D;  4AUQ C;  2MEK A;  4KX6 B;  1WI0 A;  5AEK B;  2LD9 A;  2WXM A;  4GU2 A;  2C7H A;  4F8C B;  1SB3 C;  3KYD D;  1C1Y B;  2M17 A;  2MA9 B;  4WQM A;  2BYE A;  1MJD A;  4F7Z A;  3W1S C;  1F9J A;  2IGH A;  2YLM A;  2JU6 X;  4DXG A;  1RWS A;  2MBQ A;  2C7N B;  3P1M A;  4XC2 A;  2BS2 B;  4XDD A;  5E6N A;  1WJU A;  2WS3 B;  3IVF A;  2UWQ A;  1UEL A;  5AZG A;  2L1A A;  5C3J B;  2INC C;  5FR6 A;  3LXF A;  5EE9 A;  4BG4 A;  4FAD A;  4KZC A;  1MG4 A;  4KGS A;  1CRK A;  2J53 A;  4AP4 C;  4W9L A;  3IG5 A;  4LTU A;  2W55 A;  4C00 A;  2MJ3 A;  3KUZ A;  4BKG A;  1I4H A;  4WH4 A;  1XQQ A;  4FHK A;  4G0N B;  1CQV A;  4BHL A;  3H7P B;  3UIP B;  1IBX A;  4HJG E;  4M0W A;  2KN4 A;  4MM3 B;  5IN7 A;  1VA6 A;  3BWU D;  4ARC A;  2WGS A;  4IM3 A;  2KQS A;  2KWU B;  2HTH A;  4I6L B;  2FUH B;  4WIP A;  4F1S A;  2D33 A;  4B95 A;  2V9H A;  1N62 A;  3Q6B A;  1L0V B;  3TL5 A;  1UNS A;  3QIJ A;  5CHV C;  2HJ1 A;  1V5O A;  3GP7 A;  2KHW B;  2N0S B;  4W9C A;  2EKI A;  3R2T A;  5BYR A;  1SD0 A;  1F2R I;  2GB1 A;  1RFA A;  1FFV A;  2H89 B;  3BIN A;  3AEB B;  3AE8 B;  3ZNG C;  4TQ0 A;  1WRI A;  2NPT A;  4LNK A;  5MPO A;  3ZVV A;  1FNV A;  1GJZ A;  2M4N A;  1E8X A;  1J7B A;  4ZOH C;  4W9F A;  1AYF A;  1OEY A;  3GZN B;  5G55 A;  2GRI A;  5GXG B;  4N59 A;  1HTO A;  1FD6 A;  3KWV A;  2D3A A;  1HA5 A;  3B0A A;  2HE7 A;  3FIL A;  4EFO A;  1EU4 A;  2RR9 A;  1XO3 A;  4DHZ E;  2SAK A;  2N1V A;  2WQY B;  3KQ4 A;  2X8X X;  2LUM A;  2MSE D;  4WJN A;  1KH0 A;  1UWX A;  4HLE A;  4AOF A;  1OGW A;  5BMI A;  5DPT A;  4JWU C;  1DGJ A;  1MHX A;  2L05 A;  3W1S A;  2WXH A;  1WZ3 A;  4ICU A;  3DPD A;  1I4G A;  3I9V 1;  4RCO A;  1VCB A;  2MJD A;  4MH8 A;  2WX1 A;  3A9J B;  4KKJ A;  2DBY A;  1E8W A;  3QHT A;  2R2Q A;  1UD7 A;  3VRB B;  2W3R A;  3B9J A;  3NZS A;  4BOZ B;  1VZ8 A;  2CU3 A;  3LN7 A;  1TT4 A;  2Y5C A;  1VR9 A;  2K0P A;  1WGH A;  2TSS A;  2CJN A;  2D07 B;  2ZEQ A;  3WAP A;  1KJT A;  3R7Q A;  3P4S B;  2GBK A;  4GDK B;  3Q8C A;  1YQB A;  2L3Z A;  2WXL A;  5DCN A;  1TJE A;  2RDG A;  3ZW3 A;  2LXC A;  4ZRP A; 
#chains in the Genus database with same CATH homology
 2QC8 A;  2WHI A;  3LN7 A;  2UU7 A;  1V4G A;  2D3A A;  2D33 A;  1TT4 A;  3NZT A;  3NG0 A;  2OJW A;  2GLS A;  4LNI A;  3LVW A;  3LVV A;  4LNN A;  2D3C A;  2LGS A;  4S17 A;  3ZXV A;  2BVC A;  4LNK A;  1LGR A;  1F52 A;  4LNO A;  3ZXR A;  3FKY A;  4HPP A;  4S0R A;  1VA6 A;  2D3B A;  4LNF A;  3IG5 A;  2D32 A;  2WGS A;  1R8G A;  1HTQ A;  4XYC A;  2GWD A;  2GWC A;  3IG8 A;  4ACF A;  1FPY A;  1F1H A;  4BAX A;  1HTO A;  3LN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...