2QC8A

Crystal structure of human glutamine synthetase in complex with adp and methionine sulfoximine phosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
b'NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 116
structure length 356
sequence length 356
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2qc8A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2qc8A02
3ZXVA 1FPYA 2BVCA 4S17A 2QC8A 2LGSA 4HPPA 1F1HA 2OJWA 4ACFA 2WHIA 1HTOA 4LNOA 4LNFA 4LNNA 3FKYA 2GLSA 2WGSA 4LNKA 4S0RA 1HTQA 4BAXA 1LGRA 3ZXRA 1F52A 2UU7A 2D3CA 4LNIA 3NG0A 4XYCA 2D3BA 2D3AA
chains in the Genus database with same CATH superfamily
2LVOA 1P0RA 3IHPC 3JVZX 3ZNGC 1HEZE 2O6VD 4IW0A 1T6BX 2LJIA 1XLPA 4RMAA 2LMCA 4BFRA 4MGIE 1YQBA 1MHHE 4MGZE 2C7NB 2UYZB 1WX7A 3IG8A 2LUMA 5IKCM 3ZJUA 3JSVB 3EC8A 1AARA 1TT5B 2QHOA 3MHSD 2WX1A 2RR9A 4A6QA 4AM1A 2LGIA 3ZNID 4CO7A 3GS2A 2IO3B 4WURA 4J6IA 1MG4A 1NYRA 3VRBB 1SIJA 2KT7A 4W9CA 2ONQA 1FFVA 3L08A 1V2YA 2BW2A 1V80A 1SE9A 4RM9A 4IWQA 1ACCA 4NZLB 1SE3A 3QCAA 2BKRB 3AE5B 2XK5A 4FN2A 2WU5B 3ENEA 4W9FA 4I6LB 3JU6A 1MJDA 1WGRA 3WAMA 1S3SG 4LNKA 4LCDE 5G5GA 4PYZA 1IBXB 3R3MA 1KJTA 3V3XA 3UI3A 1BMLC 1IGDA 4KIKB 2ZNVB 1L4DB 5G55A 3IFWB 3A9KA 3C19A 2KDIA 2MBHA 2H89B 1JALA 4WJQA 1YQ3B 2B3AA 1WFYA 2RDGA 1UWMA 2L8JA 2Z8LA 2DAFA 4HJGE 1XQQA 4URKA 3M3JA 1GOZA 5CHWA 3UINB 2UU7A 4CYEA 2G1EA 5E6JA 4MSQB 2KD0A 2WXPA 1WYWB 4KSKC 2GMIC 1R7SA 2K6QA 2KDMA 2QILA 4HPPA 2RMMA 2LVQA 5D6JB 3B2FA 1BG0A 4AS1A 5EE3A 3HVZA 3NVYA 1SEBD 1TZ1A 1WGYA 1UBQA 3W5VB 3TMPB 1WSPA 3L17A 2D33A 2J4XA 2NCNA 2J0MA 3KLSX 1FXAA 2FUHB 1YX5B 4LNOA 3RI7C 4MH8A 1E9MA 1OQQA 4W9IA 3N1ZC 1LO5D 3WCQA 4RF7A 2WXJA 4OZBA 1LXDA 1K53A 2L3ZA 3QX1A 2VZKD 3PTFC 2HJ8A 1AYFA 3GP7A 1MVKA 3TUOA 1F77A 4E74A 1YJIA 3RNFC 4Q2RA 1WF9A 4N58A 4RCOA 4YWGG 2JVCA 3AE4B 3M62B 1I4RA 3MJWA 4JQWC 4EZJA 3DBRI 1GC6A 2GI9A 4A55A 2KOXA 2WP9B 3AEGB 3APFA 4FBJB 1I4XA 1HZ6A 3MTNB 1WGDA 1Q5WB 1WXSA 2L05A 1D5ZC 3W2DA 4WJNA 4YTPB 1T5XD 1RRBA 2KWDA 1FNWA 3NS8A 4MACA 2EKIA 3RZFA 3T8MA 4MH0E 2HTME 3R66C 2XK5B 3H9DA 5DPSA 1UZXB 3PS6A 3LYYA 2JWZA 2NBUA 1EM7A 3OWEB 4A3OA 2IO0B 4GDKB 1JWAD 4E71A 4M01A 1Z5SB 2LGSA 4J3OD 4ARCA 4LLGM 2XBBC 1GJZA 2R61A 3P42A 4NNJB 2DZJA 1JWBD 3FKYA 1OEYA 2D11A 1GAQB 3PHWB 4MDKE 3B0AA 3BINA 1UUPA 2IYDB 1J7AA 4XGAB 5FR3A 1XLQA 3L2EB 2JZZA 3Q3NC 1M94A 1V8CA 4GB9A 1E7PB 2W9NA 3RNAC 1PDXA 4IM3A 2JRIB 2R2OA 2A4ZA 1BXTA 3Q8EA 3VTVA 1C78A 1FCLA 1WZ0A 5BYSA 1K8RB 2NR2A 3Q2AC 1SIFA 2FCSA 2MEKA 4MM3A 2W55A 2IY0B 2QJLA 2J42A 4TSSA 4IM0A 2L32A 2M4NA 4DQOC 2BT6A 2LI5A 1TKGA 1WRDB 1E10A 1K52A 2N4FA 3EA6A 4LJPB 3P4PB 2ZCCA 3M95A 1JMLA 1H4RA 1L0YB 2YLMA 1R4NI 2X8XX 1ZGUB 1JW9D 4FJYA 5LXIB 4RF8A 5AUKA 2V4IB 3CIRB 2RPQA 4PYUA 4WQMA 1FEHA 4HRSA 3NUHB 3PVLA 2KWUB 1TGZB 3KUDB 3W5UB 1SE2A 2KJRA 1TS2A 4WAAA 4P6VF 4DXFA 3KYCD 3BVZA 3AV8A 2LHEA 3NS1A 1MFWA 2FE8A 2ZEQA 1EWYC 1Y56A 4LDTD 5AUIA 1E8XA 2D2QA 3DVGY 4S17A 1WXQA 4L2YA 1ZKHA 3DQVA 5D2MB 5HI1A 3DHIC 3KH0A 1QZEA 2KQ7A 2MX2A 3PZ7A 1YD8U 2JUOA 2OHFA 2AL6A 1KLGD 2O6VB 4S0RA 1SB3C 2IBIB 1K51A 3QAQA 1XEEA 4BKGA 2DX5B 4RF0A 4ARIA 5EE1A 3Q8BA 1TKYA 3IVFA 1IYFA 2ZNVC 4BG4B 5D94A 4JIOU 4AOFA 1P98A 2BGFA 4GVYA 3N1XC 1E7VA 3AMZA 2FCQA 2KLCA 1VCBA 2LWPA 2KFJA 3MC8A 2NMQA 1QLBB 2FIFA 3U2SC 2MJDA 3KUCB 1FPYA 1UGMA 2K8HA 2J0KA 4GGQA 1YQ4B 2OJWA 5C3JB 3PRZA 1FNVA 1KH0A 2NPTA 2KVZA 1OTRB 4K3BA 1WM2A 2PMVA 5C23A 2KACA 2BYTA 1RYJA 3MP9A 3RNGC 4EEWA 3PZDA 4MM3B 3AE8B 3GZNB 2KDEB 3ZIMA 4XC2A 2Z0DB 4WJOA 3DHHC 1TS4A 2JSVX 4BKTA 1WZ3A 2QSDA 2HDEA 1A5RA 3O13A 4W9JA 2WXIA 3QK0A 4PK1A 4YTMB 3EECA 1CQVA 2DYOA 1OQYA 2RSUA 1N63A 4GN1A 4ZRPA 4HDOA 1F0ZA 1E0ZA 2CRKA 2CJOA 5JH5C 3AE2B 4GMVA 4REZA 1QH4A 3CWIA 2MSED 2WLBA 3IG5A 2KO3A 3JYUA 1EF1A 1UH6A 1VRPA 1FNUA 2DZIA 2IJ0A 5C2TB 2BPSA 4KZ0A 3ZVVA 5G5HA 2R2QA 1A70A 1SGHA 1JWSD 2J1QA 3BIID 5LXHA 3JSVA 1TZOA 2NTTA 3P1MA 1QOAA 3L10B 2GOWA 1C77A 1C4AA 2KVRA 2PLPA 2KDBA 4L1BA 3AULA 1OEYJ 2DBYA 4HWIB 3MFGA 2VZKB 3KWLA 1R4MB 2G4SA 3PO0A 1DOIA 1QOFA 3ZO5B 4AQ7A 2KX3A 1N5XA 4FULA 4MT5A 2HJ1A 2WXQA 3L16A 1E8WA 1IBXA 1WRIA 4B0EA 3IT6B 2NS5A 4GW2A 4E3CA 1U4AA 4DHJB 2CJNA 2D3CA 4W9LA 3E9SA 1PGBA 1V49A 5J99A 1JRPA 1FCCC 1TIFA 1T0SC 3BK2A 4UDUC 4W9KA 3MHZA 5E6PA 3X23A 1WR1A 3H7SA 3AE7B 3SU8X 2WGSA 2GWDA 3NVVA 3A33B 1L0XB 2INCC 4WWOA 4OVVA 3JPZA 1AW7A 1ZDXA 1VZ7A 3OJ4B 1VJKA 1RAXA 1SJHD 3NZUA 4KGSA 3TJPA 4KDIC 4KKJA 4F1SA 2BYVE 2J52A 4Z9MA 4IUMB 1FXIA 4TMAB 4EZLA 5CHVC 1F9JA 3W9CB 4ICVA 2G3QB 5HG2A 2INPE 2C7MB 1JCKB 4AUQC 4W9HA 2DYMA 3TSSA 4YXDB 2KWVB 1F2RC 4CQNA 4ASWC 4JL9A 1TY2A 3NOBA 3KW5B 3EFUA 1WE7A 2KQSA 5FKAC 3H8HA 4RF9A 4C4VB 1WIAA 2KYWA 3GOEA 1UD7A 2NVUI 3VVWB 1CK1A 2IZVB 3ZJTA 5CX3A 2WXHA 2WXOA 2INDC 2KHWB 4F7ZA 4HVBA 4XX5A 4BVUC 1NVID 2WYQA 4US8A 2VRRB 4HDQA 3N1YC 2C9WB 2KQ4X 4KV2A 3A4SC 2REXA 4HCPB 1JROA 3IT4B 3ONSA 1U6RA 2GBKA 3NJTA 4DXGA 2JXTA 3Q69A 2K5PA 3V60A 1P50A 4OW0A 5TSSA 3SD5A 3FILA 3BVMA 4BAXA 4ANUA 2PE9A 5E6OA 2FCNA 4XYCA 1I4HA 3DCGA 1YN4A 1ISNA 2BVCA 4F8CB 3W1YA 3H1UA 3ZW3A 2WXGA 4RH6A 4C7ZA 1F1HA 2LXAA 3AEBB 5JHBA 3Q3OC 1UWXA 2WXNA 3KUZA 2KWCA 3WALA 1J7BA 4AJYB 4Q2JA 3MC0B 4GDKA 1HQRD 2BWFA 4BOZB 3R7QA 2N9LA 3ZXVA 4LDTB 3OAWA 3Q8CA 3VFKA 2FUG1 3BY4B 2MQJA 3URYA 2XNAC 3DVNV 4B9KA 2L7RA 5BMIA 3PSEB 4HPMB 2WDVB 1L5PA 1XD3B 3C0RB 4DBGA 3L2EA 4MEMA 2D3BA 2D3AA 2WNMA 3ML8A 1NYQA 3NZTA 1S1QB 2KMCA 4FJZA 2AEHA 1V1OA 3PPAA 2RDHA 3BZDB 1XO3A 2JF5A 3PV1A 2K6DB 1PUTA 3NRZA 1V1PA 1V5OA 4C00A 1CJEA 2FAZA 2GB1A 2KC2A 4C80A 5KHOA 4GLSC 3GE3C 1C3TA 2DZKA 1VRAB 2K9XA 1QOBA 3PT2B 3N3KB 1I4GA 2WXFA 1QT9A 3UQBA 4NJCA 5BMHA 3ZJVA 5IN7A 1G0WA 2CHXA 1VDVA 2I38A 3TBLD 1QQRA 2K25A 1NBFC 5TR5A 2WHIA 2K1FA 4WAFA 2J0JA 2PE6B 3PHXB 2JT4B 2MA9B 1DYQA 2MJ3A 2AWTA 4K1RB 5J2RA 2VH1A 2KX0A 3PRMB 2N1WA 3FAHA 2GBRA 4RNAA 2WDTB 3DBHB 4I6NB 3FILB 3L2DA 2Y5PA 1IPGA 3APCA 4ZYNA 3R8BA 1DGJA 2LVPA 4OZCA 4ACFA 3Q14C 2JQRB 2ON8A 2AQ3B 1D3ZA 2O6VA 1TTNA 5GMVA 3M10A 3Q8AA 2N9PC 4BHLA 3RZWC 2D3GA 3Q3FA 3RNCC 4MSMB 2PVGC 1YX6B 4NPNA 4BG4A 2JY6A 3QIJA 2LEKA 1E90A 1D5MC 3AXCA 4KDLB 2CHZA 4GIVA 1Z2MA 2CU1A 4LK0M 1GG3A 1YN3A 2WDRB 3P63A 1RFAA 4MELA 3V6EB 2CHWA 3Q3MC 4IOIE 4NQLB 1E8YA 2GBJA 2W3SA 4N6EB 2BYEA 2JX5A 1Q10A 2KN5A 1MG8A 2M17A 1FM0D 3NY5A 3LN6A 1MI0A 1H8CA 1ZPSA 1V86A 3I63C 1HTOA 1R4MI 2DYBA 3PLVA 4K7UA 4II3B 1EUVB 2ZVNA 2KK8A 3VR9B 1XCTL 2O2VA 3A1QB 4XWWA 2HD5B 3V6CB 5EDSA 1I7HA 2RDBC 3QJZA 1V1PB 1SE4A 1L4ZB 3FC4A 3LB8C 1HE8A 3RNBC 3TIXA 2BTEA 2MJEA 2K0PA 4OHJA 2I1KA 2MCNB 4P1BC 3IAS1 5H92C 1P1AA 3T3NA 2KANA 2M56B 3T9LA 2LD9A 2RPVA 2JRHA 1HXYD 1WR6E 2C7HA 2MWSB 1TT4A 3QQ8B 1CMXB 5JZEB 2ZW0A 1WGHA 1LQBA 3ZTDA 3CMMB 1ENFA 3H7PB 1NEKB 3ZKJC 2HTHA 4DDGD 3DVNU 1YNTE 3ECIA 2L83A 3QC8B 1XLOA 4TUUA 5BO4B 2LGYA 5D3IB 5IO9A 1K50A 5DPRA 2WWZA 2OOBB 3QWZB 2N7JA 3AH7A 1KLVA 3KWVA 1QKZA 1YMHE 1HTQA 4IM2A 1V81A 4FHJA 3VUXA 1C9FA 2EELA 4ZRIA 2ZPNA 1PGAA 1N6ZA 1WGGA 2FIDA 4RM8A 2MBBB 3KYDD 4EUTA 1JRUA 1WJ4A 1TS3A 3R2TA 2LRUA 1FXTB 2L0TA 2IO2B 4WQOB 2H88B 2FCMA 2EMSA 2OJRA 1J0GA 4IG7B 1E7UA 1GNUA 2KKCA 4K7WA 2V1YA 4NAMA 2L52A 4DWFA 1XCQL 2V3SA 4YTNB 5D3DA 4O1NA 1ET9A 1PFDA 4AJWA 1KFYB 4XDDA 1P7EA 3HRDD 1E6EB 2UWQA 2Y5CA 4USAA 1RFKA 2MRPA 3Q8FA 3WIMA 2BF8B 2PPHA 3B08A 3B6RA 1WX8A 2ZCBA 2O2VB 2N1VA 1KTKA 2YEPB 4BKSD 2KDFB 4IC7B 4ITKA 4YSZB 2K8BA 2KTRB 1BUIC 2D5GA 4HXDA 4WWMA 3ZRFA 2ICIA 5IOIA 4DDID 2DENB 3RFZB 2KTFA 1YIWA 5AZHA 2X38A 3ZNHB 1XF5L 1NDDA 2WXRA 1FO4A 3OLMD 2Z59B 5BYQA 1L2NA 3I3TB 2AL3A 1GPXA 1WXMA 3DBRB 3WAPA 4C4VA 3RNEC 3QA8A 4EZKA 1FMAD 2IDYA 3L54A 1J8CA 3U8ZA 1SD0A 2MBOA 3RUIB 5H8YE 4HPLB 2BB5A 1JQ4A 4HCNB 4YL8A 4GDLB 3AE3B 1EU3A 5L83A 2L0FA 2BS4B 5T8IA 1TYGB 4FXCA 1MPEA 1D5XC 1WJNA 4IKGA 3SR6A 2D07B 3TEZA 2Y5BB 3N30A 2W82A 3MJ5A 3SHQA 4JLCA 3WA0A 1X1MA 3ZUNA 4P16A 2J7QB 4A8XC 3OJ3A 4HKZE 3TEYA 2PIAA 5LLIA 3ZLZA 4NAWA 1GC7A 1RWSA 3SDLC 4KVGB 4HROA 1QOGA 4OVZA 3NG0A 3W1SA 4EOYA 2N0SB 4OZAA 4GOCA 4TQ1A 3RMKC 3DBHI 3KQ4A 4RGOS 2QIEB 2MHJA 3P4RB 4BOSC 1TS5A 4MJSB 5FR6A 3HVDA 4WWNA 3EGRA 1FD6A 1I0EA 1TJEA 3EFCA 3L4PA 1IGCA 3L13A 4US9A 2LGXA 2DZMA 4I6PA 4ANXA 3LJ3A 4ZHPA 3WANA 4H2AA 2KXJA 2JPHA 2W3RA 5EE9A 3C8YA 5J18A 3ALBA 2B76B 4GXBA 2GLSA 2K3UA 1R4NB 2I1JA 2DAJA 2N7EA 3PREA 1Q0WB 3RT3B 4YSXB 1LM8B 1PQSA 3DVGX 1SF0A 3VUYA 4JPSA 1Y8RC 4WH4A 1OFFA 3E56A 1T0QC 1DOYA 2BKFA 2WXKA 3IXSA 3PGEA 4YT0B 3UQAA 4K3CA 2JYTA 2PKOA 1ZOYB 4W9GA 5AZFA 3QHTA 2ZW1A 4X57B 1B9RA 2M8SA 1HZ5A 1P3QU 2G4DB 4IDIA 3ZTCA 4PS3A 2GBNA 4W9DA 1ZDVA 3AU4A 4P7IA 4RFBA 3AE6B 3TEXA 4JGHB 1QF6A 5EE0A 3RD2A 2PEAA 3AB5A 4M0WA 4ZRJA 3VH3B 2WU2B 1NI2A 2ASQA 3I57A 2IGHA 1F2RI 3AN1A 3LN7A 1SBBB 2ZVOA 4G11A 3MC9A 4A90A 2G45B 2JXXA 4TV3A 2WXMA 4N9F4 1G6JA 1WYGA 3DDCB 3UIPB 2AX5A 3VRAB 2W54A 3ZYYX 2N9KA 4NAWB 1UBIA 1V4GA 4GSWA 2MW5A 4OVUA 4LTUA 1STEA 3V05A 3S2AA 4XZ4A 1LFDA 1ZXIA 3SFEB 4WWPA 3UIOB 1WXAA 3AEAB 2V0GA 4GU2A 3AU5A 5MPOA 4AP4C 1ZUD2 4BBNC 2GBMA 2D10A 2V9HA 1KRHA 3DBLB 1SXTA 3RULA 4EE2A 1VZ8A 4A9AA 3U52E 4KX6B 3ZDTA 4DHZE 3A1QA 1IUEA 2C5LC 3A4RA 1B1ZA 1L6UA 2L76A 3V62A 4WJPA 1KOTA 3NHEB 1D6EC 1XXGA 2BBCA 2C60A 3NZ3A 4PS7A 3J9CA 1QILA 4K81A 4KZCA 4NJ6A 5DCNA 3DWMA 2KMMA 3BYTB 4DK5A 3P2BA 4A3PA 4JX1C 3APDA 2KAJA 4RGMA 2I2YA 5E6NA 2IPKD 1YJJA 1WXVA 4G0NB 1GB1A 3H7PA 3IG3A 4C56C 2BYFA 3OG5A 1DOXA 3GZNI 3I9V1 4XE0A 3Q6BA 3B9JA 3BK1A 1I35A 1WWTA 4K7SA 4EFOA 1ET6A 5AEKB 4ZRQA 3AEFB 2K22A 1EF5A 3NVZA 2MBEA 1EO6A 5FK9C 4FADA 3K9OB 4M0WB 2QMTA 2CKHB 1V9JA 3M63B 3CSTA 1CRKA 3EHVA 2JZPA 1XLNA 3LDZE 1WM3A 3KVFB 2V3PA 4GW0A 1FRRA 2LGDA 3AI5A 1WMHA 3TCAA 4M8MA 1ZW7A 2KNBA 4DHJD 2WXLA 2ZPYA 3TL5A 3BWUD 3HM3A 1E5WA 2DNFA 2PJHA 2ZJDA 3P4SB 3RN9C 3VTUA 4HLEA 4PT5A 4W9EA 3RCZA 3X0WA 4JWSC 3VHTC 3GB1A 5HFYA 3ZDMC 1VA6A 1RL9A 2DLBA 3QARA 3IAM1 3D32A 1TKEA 4TQ0A 2NBWB 2RD0A 3DRBA 3B1LX 2XN9C 1T0YA 2D32A 2Z0EB 1V5TA 4ICUA 4FLHA 1SSNA 2OEDA 3PRPB 4NY0A 1UGJA 3AEDB 3Q3JA 4NJ7A 3V61A 3AEEB 4R3DA 3ZNZB 1WJ6A 4WIPA 2BWES 3WAOA 3NZSA 1M15A 4DHZB 2IGDA 3A9KB 3ETRA 4LNNA 3A9JA 1Q1OA 3JU5A 3SFDB 3ZXRA 1RM6C 2LXCA 5HKHA 3N32A 4A20A 2KTRA 3P4QB 4FHKA 4FA6A 1EU4A 4HK2A 3HM6X 3RYTA 1KF6B 1LGRA 4PS8A 4MGKE 4BBNF 2YEPF 1WX9A 2XEWA 3NVWA 4G3XB 1HA5A 2LASA 3UF8A 2WDQB 4ZOHC 5IA7A 1ZXHA 3AECB 1ROEA 4TKNA 2DHZA 3ML9A 2MP2A 4KGRA 4G50A 2GWCA 1C4CA 3TEWA 4GDLA 1V6EA 1GUAB 1T0RC 3DPDA 4RGNA 4JWUC 4B95A 2JZ3B 1L6VA 2KJ6A 1C1YB 2LRWA 1PYWD 2AQ1B 1VZ6A 3AE1B 2KLGA 2FBWB 2SAKA 1N61A 3DOWA 1WJUA 2LFIA 4D2KA 2MBQA 2EMTA 5GXGB 5L95C 4B6WA 4ZRKA 2VH2A 1UF0A 1N62A 1WMHB 3JW0X 2M1MA 3IBEA 4HKQA 1OQRA 2YVCA 3H6NA 2KFKA 3UGBB 2N9XA 2JWUA 2QC8A 4BZAA 2M0AA 3AE9B 3W1SC 4AWJA 3O65B 4ANWA 2N9EB 3I5JC 2LHDA 1XT9B 4B0MA 2A5UA 1P7FA 3VH4B 4LJOB 1L7YA 1YOVB 5IP4D 4EKUA 3ZQ4A 4YSYB 4RF1A 3PZ8A 3GE8C 3ABVB 5BYRA 1SJED 3EUB2 3VUWA 2IY1B 4XWTA 4MJSA 1ZP0B 5AZGA 1FRDA 2G9HD 1L0VB 1JWUD 3N9YC 1J19A 4IWPA 4ZHOA 3HK0A 5I4DA 3A9JB 1EWCA 1WE6A 4M00A 2MH7A 2KN4A 2DWQA 5BMGA 3HHMA 2HE7A 4ANVA 3ZRCA 1E8ZA 3VQIA 1NI3A 3LVVA 1J7CA 1P52A 2CR5A 1ESFA 2ACZB 3VTWA 1BT0A 1ZE3D 2KZRA 4ZDVA 5C1ZA 4GVZA 1KLUD 3CSFA 1UELA 4LNIA 1WI0A 3SEBA 2WX0A 2IO1B 1YJ1A 5KHQA 2MLBA 1V97A 2V4LA 3DREA 1C76A 3L0WB 1IP9A 4QAYA 3DBLI 2BS3B 3DWGC 4IWOA 2KC1A 3HIZA 1KM7A 2J53A 2IGGA 1VR9A 5DPTA 1CZPA 1VD2A 2KMAA 2L1AA 2MP2B 3HUIA 1R8GA 2SEBD 4ZYSA 1N5WA 2LZ6A 3ZGZA 5JXVA 2LJ5A 2BQQA 3U7DA 3RPFC 4RF6A 4M02A 2TSSA 4C7YA 2JU6X 1TY0A 2WQYB 1GB4A 2AQ2B 5DPWA 1UNSA 3CF6E 2CU3A 2E6XA 2M0XA 2EKEC 2PVOD 3DHGC 1YN5A 2PTLA 3VR8B 3AM9A 1M4VA 2PW9A 1VLBA 3T3OA 5CHFA 4L23A 2KFKB 1OGWA 5D7GA 2V3NA 3DBSA 5CTRC 5IAAC 1F52A 5HHDG 4XDCA 2N7DA 1C79A 3N20C 1FIQA 3K9PB 3VXWA 2E3TA 2K8CA 2BB6A 1AN8A 5LNK1 5J17A 4MGYE 3JQ3A 1FFUA 1AWDA 2NTSA 5G2NA 4LNFA 5J9AA 3LVWA 3BYYB 4HJKA 3B2GA 3VDZA 1RLFA 1MHXA 1N60A 4KIKA 2KJHB 2QDFA 2BS2B 1WGKA 1WY8A 1D4BA 2JYEA 1I4PA 1I4QA 2L00B 2LUEA 4II2B 2WS3B 1TBEA 3U7ZA 1T3QA 4FJVB 2Q5WD 2M19A 1WH3A 1NENB 4JE3B 4DXAB 2FNJB 2NPTB 4KKIA 3U4EG 1PGXA 2Y3AA 2CS4A 4RGTA 3VAWA 2QCZA 2NBVB 2ZZPB 3BVGA 4KGTA 2INNE 1QK1A 4M8NA 3PLUA 1JWMD 2RGFA 4P1CC 5JHAA 1P9DU 3LXFA 3R7RA 2AYOB 1I42A 2GRIA 2K39A 4KSLC 4CHKA 1C4PA 4HEA1 4N59A 4NQKE 3R2IA 2QEJC 4BKSA 3U30A
chains in the Genus database with same CATH topology
3ZXVA 1VA6A 1V4GA 1FPYA 2BVCA 4S17A 2QC8A 1TT4A 2LGSA 3IG8A 3LN7A 4HPPA 3LN6A 3NZTA 1F1HA 2OJWA 4ACFA 2WHIA 3IG5A 1HTOA 4LNOA 4LNFA 3LVVA 3LVWA 4LNNA 3FKYA 2GLSA 2GWCA 2WGSA 2GWDA 4LNKA 4S0RA 1HTQA 4BAXA 1LGRA 2D32A 3ZXRA 2D33A 1F52A 2UU7A 2D3CA 1R8GA 4LNIA 3NG0A 4XYCA 2D3BA 2D3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXV A;  1FPY A;  2BVC A;  4S17 A;  2QC8 A;  2LGS A;  4HPP A;  1F1H A;  2OJW A;  4ACF A;  2WHI A;  1HTO A;  4LNO A;  4LNF A;  4LNN A;  3FKY A;  2GLS A;  2WGS A;  4LNK A;  4S0R A;  1HTQ A;  4BAX A;  1LGR A;  3ZXR A;  1F52 A;  2UU7 A;  2D3C A;  4LNI A;  3NG0 A;  4XYC A;  2D3B A;  2D3A A; 
#chains in the Genus database with same CATH topology
 2LVO A;  1P0R A;  3IHP C;  3JVZ X;  3ZNG C;  1HEZ E;  2O6V D;  4IW0 A;  1T6B X;  2LJI A;  1XLP A;  4RMA A;  2LMC A;  4BFR A;  4MGI E;  1YQB A;  1MHH E;  4MGZ E;  2C7N B;  2UYZ B;  1WX7 A;  3IG8 A;  2LUM A;  5IKC M;  3ZJU A;  3JSV B;  3EC8 A;  1AAR A;  1TT5 B;  2QHO A;  3MHS D;  2WX1 A;  2RR9 A;  4A6Q A;  4AM1 A;  2LGI A;  3ZNI D;  4CO7 A;  3GS2 A;  2IO3 B;  4WUR A;  4J6I A;  1MG4 A;  1NYR A;  3VRB B;  1SIJ A;  2KT7 A;  4W9C A;  2ONQ A;  1FFV A;  3L08 A;  1V2Y A;  2BW2 A;  1V80 A;  1SE9 A;  4RM9 A;  4IWQ A;  1ACC A;  4NZL B;  1SE3 A;  3QCA A;  2BKR B;  3AE5 B;  2XK5 A;  4FN2 A;  2WU5 B;  3ENE A;  4W9F A;  4I6L B;  3JU6 A;  1MJD A;  1WGR A;  3WAM A;  1S3S G;  4LNK A;  4LCD E;  5G5G A;  4PYZ A;  1IBX B;  3R3M A;  1KJT A;  3V3X A;  3UI3 A;  1BML C;  1IGD A;  4KIK B;  2ZNV B;  1L4D B;  5G55 A;  3IFW B;  3A9K A;  3C19 A;  2KDI A;  2MBH A;  2H89 B;  1JAL A;  4WJQ A;  1YQ3 B;  2B3A A;  1WFY A;  2RDG A;  1UWM A;  2L8J A;  2Z8L A;  2DAF A;  4HJG E;  1XQQ A;  4URK A;  3M3J A;  1GOZ A;  5CHW A;  3UIN B;  2UU7 A;  4CYE A;  2G1E A;  5E6J A;  4MSQ B;  2KD0 A;  2WXP A;  1WYW B;  4KSK C;  2GMI C;  1R7S A;  2K6Q A;  2KDM A;  2QIL A;  4HPP A;  2RMM A;  2LVQ A;  5D6J B;  3B2F A;  1BG0 A;  4AS1 A;  5EE3 A;  3HVZ A;  3NVY A;  1SEB D;  1TZ1 A;  1WGY A;  1UBQ A;  3W5V B;  3TMP B;  1WSP A;  3L17 A;  2D33 A;  2J4X A;  2NCN A;  2J0M A;  3KLS X;  1FXA A;  2FUH B;  1YX5 B;  4LNO A;  3RI7 C;  4MH8 A;  1E9M A;  1OQQ A;  4W9I A;  3N1Z C;  1LO5 D;  3WCQ A;  4RF7 A;  2WXJ A;  4OZB A;  1LXD A;  1K53 A;  2L3Z A;  3QX1 A;  2VZK D;  3PTF C;  2HJ8 A;  1AYF A;  3GP7 A;  1MVK A;  3TUO A;  1F77 A;  4E74 A;  1YJI A;  3RNF C;  4Q2R A;  1WF9 A;  4N58 A;  4RCO A;  4YWG G;  2JVC A;  3AE4 B;  3M62 B;  1I4R A;  3MJW A;  4JQW C;  4EZJ A;  3DBR I;  1GC6 A;  2GI9 A;  4A55 A;  2KOX A;  2WP9 B;  3AEG B;  3APF A;  4FBJ B;  1I4X A;  1HZ6 A;  3MTN B;  1WGD A;  1Q5W B;  1WXS A;  2L05 A;  1D5Z C;  3W2D A;  4WJN A;  4YTP B;  1T5X D;  1RRB A;  2KWD A;  1FNW A;  3NS8 A;  4MAC A;  2EKI A;  3RZF A;  3T8M A;  4MH0 E;  2HTM E;  3R66 C;  2XK5 B;  3H9D A;  5DPS A;  1UZX B;  3PS6 A;  3LYY A;  2JWZ A;  2NBU A;  1EM7 A;  3OWE B;  4A3O A;  2IO0 B;  4GDK B;  1JWA D;  4E71 A;  4M01 A;  1Z5S B;  2LGS A;  4J3O D;  4ARC A;  4LLG M;  2XBB C;  1GJZ A;  2R61 A;  3P42 A;  4NNJ B;  2DZJ A;  1JWB D;  3FKY A;  1OEY A;  2D11 A;  1GAQ B;  3PHW B;  4MDK E;  3B0A A;  3BIN A;  1UUP A;  2IYD B;  1J7A A;  4XGA B;  5FR3 A;  1XLQ A;  3L2E B;  2JZZ A;  3Q3N C;  1M94 A;  1V8C A;  4GB9 A;  1E7P B;  2W9N A;  3RNA C;  1PDX A;  4IM3 A;  2JRI B;  2R2O A;  2A4Z A;  1BXT A;  3Q8E A;  3VTV A;  1C78 A;  1FCL A;  1WZ0 A;  5BYS A;  1K8R B;  2NR2 A;  3Q2A C;  1SIF A;  2FCS A;  2MEK A;  4MM3 A;  2W55 A;  2IY0 B;  2QJL A;  2J42 A;  4TSS A;  4IM0 A;  2L32 A;  2M4N A;  4DQO C;  2BT6 A;  2LI5 A;  1TKG A;  1WRD B;  1E10 A;  1K52 A;  2N4F A;  3EA6 A;  4LJP B;  3P4P B;  2ZCC A;  3M95 A;  1JML A;  1H4R A;  1L0Y B;  2YLM A;  1R4N I;  2X8X X;  1ZGU B;  1JW9 D;  4FJY A;  5LXI B;  4RF8 A;  5AUK A;  2V4I B;  3CIR B;  2RPQ A;  4PYU A;  4WQM A;  1FEH A;  4HRS A;  3NUH B;  3PVL A;  2KWU B;  1TGZ B;  3KUD B;  3W5U B;  1SE2 A;  2KJR A;  1TS2 A;  4WAA A;  4P6V F;  4DXF A;  3KYC D;  3BVZ A;  3AV8 A;  2LHE A;  3NS1 A;  1MFW A;  2FE8 A;  2ZEQ A;  1EWY C;  1Y56 A;  4LDT D;  5AUI A;  1E8X A;  2D2Q A;  3DVG Y;  4S17 A;  1WXQ A;  4L2Y A;  1ZKH A;  3DQV A;  5D2M B;  5HI1 A;  3DHI C;  3KH0 A;  1QZE A;  2KQ7 A;  2MX2 A;  3PZ7 A;  1YD8 U;  2JUO A;  2OHF A;  2AL6 A;  1KLG D;  2O6V B;  4S0R A;  1SB3 C;  2IBI B;  1K51 A;  3QAQ A;  1XEE A;  4BKG A;  2DX5 B;  4RF0 A;  4ARI A;  5EE1 A;  3Q8B A;  1TKY A;  3IVF A;  1IYF A;  2ZNV C;  4BG4 B;  5D94 A;  4JIO U;  4AOF A;  1P98 A;  2BGF A;  4GVY A;  3N1X C;  1E7V A;  3AMZ A;  2FCQ A;  2KLC A;  1VCB A;  2LWP A;  2KFJ A;  3MC8 A;  2NMQ A;  1QLB B;  2FIF A;  3U2S C;  2MJD A;  3KUC B;  1FPY A;  1UGM A;  2K8H A;  2J0K A;  4GGQ A;  1YQ4 B;  2OJW A;  5C3J B;  3PRZ A;  1FNV A;  1KH0 A;  2NPT A;  2KVZ A;  1OTR B;  4K3B A;  1WM2 A;  2PMV A;  5C23 A;  2KAC A;  2BYT A;  1RYJ A;  3MP9 A;  3RNG C;  4EEW A;  3PZD A;  4MM3 B;  3AE8 B;  3GZN B;  2KDE B;  3ZIM A;  4XC2 A;  2Z0D B;  4WJO A;  3DHH C;  1TS4 A;  2JSV X;  4BKT A;  1WZ3 A;  2QSD A;  2HDE A;  1A5R A;  3O13 A;  4W9J A;  2WXI A;  3QK0 A;  4PK1 A;  4YTM B;  3EEC A;  1CQV A;  2DYO A;  1OQY A;  2RSU A;  1N63 A;  4GN1 A;  4ZRP A;  4HDO A;  1F0Z A;  1E0Z A;  2CRK A;  2CJO A;  5JH5 C;  3AE2 B;  4GMV A;  4REZ A;  1QH4 A;  3CWI A;  2MSE D;  2WLB A;  3IG5 A;  2KO3 A;  3JYU A;  1EF1 A;  1UH6 A;  1VRP A;  1FNU A;  2DZI A;  2IJ0 A;  5C2T B;  2BPS A;  4KZ0 A;  3ZVV A;  5G5H A;  2R2Q A;  1A70 A;  1SGH A;  1JWS D;  2J1Q A;  3BII D;  5LXH A;  3JSV A;  1TZO A;  2NTT A;  3P1M A;  1QOA A;  3L10 B;  2GOW A;  1C77 A;  1C4A A;  2KVR A;  2PLP A;  2KDB A;  4L1B A;  3AUL A;  1OEY J;  2DBY A;  4HWI B;  3MFG A;  2VZK B;  3KWL A;  1R4M B;  2G4S A;  3PO0 A;  1DOI A;  1QOF A;  3ZO5 B;  4AQ7 A;  2KX3 A;  1N5X A;  4FUL A;  4MT5 A;  2HJ1 A;  2WXQ A;  3L16 A;  1E8W A;  1IBX A;  1WRI A;  4B0E A;  3IT6 B;  2NS5 A;  4GW2 A;  4E3C A;  1U4A A;  4DHJ B;  2CJN A;  2D3C A;  4W9L A;  3E9S A;  1PGB A;  1V49 A;  5J99 A;  1JRP A;  1FCC C;  1TIF A;  1T0S C;  3BK2 A;  4UDU C;  4W9K A;  3MHZ A;  5E6P A;  3X23 A;  1WR1 A;  3H7S A;  3AE7 B;  3SU8 X;  2WGS A;  2GWD A;  3NVV A;  3A33 B;  1L0X B;  2INC C;  4WWO A;  4OVV A;  3JPZ A;  1AW7 A;  1ZDX A;  1VZ7 A;  3OJ4 B;  1VJK A;  1RAX A;  1SJH D;  3NZU A;  4KGS A;  3TJP A;  4KDI C;  4KKJ A;  4F1S A;  2BYV E;  2J52 A;  4Z9M A;  4IUM B;  1FXI A;  4TMA B;  4EZL A;  5CHV C;  1F9J A;  3W9C B;  4ICV A;  2G3Q B;  5HG2 A;  2INP E;  2C7M B;  1JCK B;  4AUQ C;  4W9H A;  2DYM A;  3TSS A;  4YXD B;  2KWV B;  1F2R C;  4CQN A;  4ASW C;  4JL9 A;  1TY2 A;  3NOB A;  3KW5 B;  3EFU A;  1WE7 A;  2KQS A;  5FKA C;  3H8H A;  4RF9 A;  4C4V B;  1WIA A;  2KYW A;  3GOE A;  1UD7 A;  2NVU I;  3VVW B;  1CK1 A;  2IZV B;  3ZJT A;  5CX3 A;  2WXH A;  2WXO A;  2IND C;  2KHW B;  4F7Z A;  4HVB A;  4XX5 A;  4BVU C;  1NVI D;  2WYQ A;  4US8 A;  2VRR B;  4HDQ A;  3N1Y C;  2C9W B;  2KQ4 X;  4KV2 A;  3A4S C;  2REX A;  4HCP B;  1JRO A;  3IT4 B;  3ONS A;  1U6R A;  2GBK A;  3NJT A;  4DXG A;  2JXT A;  3Q69 A;  2K5P A;  3V60 A;  1P50 A;  4OW0 A;  5TSS A;  3SD5 A;  3FIL A;  3BVM A;  4BAX A;  4ANU A;  2PE9 A;  5E6O A;  2FCN A;  4XYC A;  1I4H A;  3DCG A;  1YN4 A;  1ISN A;  2BVC A;  4F8C B;  3W1Y A;  3H1U A;  3ZW3 A;  2WXG A;  4RH6 A;  4C7Z A;  1F1H A;  2LXA A;  3AEB B;  5JHB A;  3Q3O C;  1UWX A;  2WXN A;  3KUZ A;  2KWC A;  3WAL A;  1J7B A;  4AJY B;  4Q2J A;  3MC0 B;  4GDK A;  1HQR D;  2BWF A;  4BOZ B;  3R7Q A;  2N9L A;  3ZXV A;  4LDT B;  3OAW A;  3Q8C A;  3VFK A;  2FUG 1;  3BY4 B;  2MQJ A;  3URY A;  2XNA C;  3DVN V;  4B9K A;  2L7R A;  5BMI A;  3PSE B;  4HPM B;  2WDV B;  1L5P A;  1XD3 B;  3C0R B;  4DBG A;  3L2E A;  4MEM A;  2D3B A;  2D3A A;  2WNM A;  3ML8 A;  1NYQ A;  3NZT A;  1S1Q B;  2KMC A;  4FJZ A;  2AEH A;  1V1O A;  3PPA A;  2RDH A;  3BZD B;  1XO3 A;  2JF5 A;  3PV1 A;  2K6D B;  1PUT A;  3NRZ A;  1V1P A;  1V5O A;  4C00 A;  1CJE A;  2FAZ A;  2GB1 A;  2KC2 A;  4C80 A;  5KHO A;  4GLS C;  3GE3 C;  1C3T A;  2DZK A;  1VRA B;  2K9X A;  1QOB A;  3PT2 B;  3N3K B;  1I4G A;  2WXF A;  1QT9 A;  3UQB A;  4NJC A;  5BMH A;  3ZJV A;  5IN7 A;  1G0W A;  2CHX A;  1VDV A;  2I38 A;  3TBL D;  1QQR A;  2K25 A;  1NBF C;  5TR5 A;  2WHI A;  2K1F A;  4WAF A;  2J0J A;  2PE6 B;  3PHX B;  2JT4 B;  2MA9 B;  1DYQ A;  2MJ3 A;  2AWT A;  4K1R B;  5J2R A;  2VH1 A;  2KX0 A;  3PRM B;  2N1W A;  3FAH A;  2GBR A;  4RNA A;  2WDT B;  3DBH B;  4I6N B;  3FIL B;  3L2D A;  2Y5P A;  1IPG A;  3APC A;  4ZYN A;  3R8B A;  1DGJ A;  2LVP A;  4OZC A;  4ACF A;  3Q14 C;  2JQR B;  2ON8 A;  2AQ3 B;  1D3Z A;  2O6V A;  1TTN A;  5GMV A;  3M10 A;  3Q8A A;  2N9P C;  4BHL A;  3RZW C;  2D3G A;  3Q3F A;  3RNC C;  4MSM B;  2PVG C;  1YX6 B;  4NPN A;  4BG4 A;  2JY6 A;  3QIJ A;  2LEK A;  1E90 A;  1D5M C;  3AXC A;  4KDL B;  2CHZ A;  4GIV A;  1Z2M A;  2CU1 A;  4LK0 M;  1GG3 A;  1YN3 A;  2WDR B;  3P63 A;  1RFA A;  4MEL A;  3V6E B;  2CHW A;  3Q3M C;  4IOI E;  4NQL B;  1E8Y A;  2GBJ A;  2W3S A;  4N6E B;  2BYE A;  2JX5 A;  1Q10 A;  2KN5 A;  1MG8 A;  2M17 A;  1FM0 D;  3NY5 A;  3LN6 A;  1MI0 A;  1H8C A;  1ZPS A;  1V86 A;  3I63 C;  1HTO A;  1R4M I;  2DYB A;  3PLV A;  4K7U A;  4II3 B;  1EUV B;  2ZVN A;  2KK8 A;  3VR9 B;  1XCT L;  2O2V A;  3A1Q B;  4XWW A;  2HD5 B;  3V6C B;  5EDS A;  1I7H A;  2RDB C;  3QJZ A;  1V1P B;  1SE4 A;  1L4Z B;  3FC4 A;  3LB8 C;  1HE8 A;  3RNB C;  3TIX A;  2BTE A;  2MJE A;  2K0P A;  4OHJ A;  2I1K A;  2MCN B;  4P1B C;  3IAS 1;  5H92 C;  1P1A A;  3T3N A;  2KAN A;  2M56 B;  3T9L A;  2LD9 A;  2RPV A;  2JRH A;  1HXY D;  1WR6 E;  2C7H A;  2MWS B;  1TT4 A;  3QQ8 B;  1CMX B;  5JZE B;  2ZW0 A;  1WGH A;  1LQB A;  3ZTD A;  3CMM B;  1ENF A;  3H7P B;  1NEK B;  3ZKJ C;  2HTH A;  4DDG D;  3DVN U;  1YNT E;  3ECI A;  2L83 A;  3QC8 B;  1XLO A;  4TUU A;  5BO4 B;  2LGY A;  5D3I B;  5IO9 A;  1K50 A;  5DPR A;  2WWZ A;  2OOB B;  3QWZ B;  2N7J A;  3AH7 A;  1KLV A;  3KWV A;  1QKZ A;  1YMH E;  1HTQ A;  4IM2 A;  1V81 A;  4FHJ A;  3VUX A;  1C9F A;  2EEL A;  4ZRI A;  2ZPN A;  1PGA A;  1N6Z A;  1WGG A;  2FID A;  4RM8 A;  2MBB B;  3KYD D;  4EUT A;  1JRU A;  1WJ4 A;  1TS3 A;  3R2T A;  2LRU A;  1FXT B;  2L0T A;  2IO2 B;  4WQO B;  2H88 B;  2FCM A;  2EMS A;  2OJR A;  1J0G A;  4IG7 B;  1E7U A;  1GNU A;  2KKC A;  4K7W A;  2V1Y A;  4NAM A;  2L52 A;  4DWF A;  1XCQ L;  2V3S A;  4YTN B;  5D3D A;  4O1N A;  1ET9 A;  1PFD A;  4AJW A;  1KFY B;  4XDD A;  1P7E A;  3HRD D;  1E6E B;  2UWQ A;  2Y5C A;  4USA A;  1RFK A;  2MRP A;  3Q8F A;  3WIM A;  2BF8 B;  2PPH A;  3B08 A;  3B6R A;  1WX8 A;  2ZCB A;  2O2V B;  2N1V A;  1KTK A;  2YEP B;  4BKS D;  2KDF B;  4IC7 B;  4ITK A;  4YSZ B;  2K8B A;  2KTR B;  1BUI C;  2D5G A;  4HXD A;  4WWM A;  3ZRF A;  2ICI A;  5IOI A;  4DDI D;  2DEN B;  3RFZ B;  2KTF A;  1YIW A;  5AZH A;  2X38 A;  3ZNH B;  1XF5 L;  1NDD A;  2WXR A;  1FO4 A;  3OLM D;  2Z59 B;  5BYQ A;  1L2N A;  3I3T B;  2AL3 A;  1GPX A;  1WXM A;  3DBR B;  3WAP A;  4C4V A;  3RNE C;  3QA8 A;  4EZK A;  1FMA D;  2IDY A;  3L54 A;  1J8C A;  3U8Z A;  1SD0 A;  2MBO A;  3RUI B;  5H8Y E;  4HPL B;  2BB5 A;  1JQ4 A;  4HCN B;  4YL8 A;  4GDL B;  3AE3 B;  1EU3 A;  5L83 A;  2L0F A;  2BS4 B;  5T8I A;  1TYG B;  4FXC A;  1MPE A;  1D5X C;  1WJN A;  4IKG A;  3SR6 A;  2D07 B;  3TEZ A;  2Y5B B;  3N30 A;  2W82 A;  3MJ5 A;  3SHQ A;  4JLC A;  3WA0 A;  1X1M A;  3ZUN A;  4P16 A;  2J7Q B;  4A8X C;  3OJ3 A;  4HKZ E;  3TEY A;  2PIA A;  5LLI A;  3ZLZ A;  4NAW A;  1GC7 A;  1RWS A;  3SDL C;  4KVG B;  4HRO A;  1QOG A;  4OVZ A;  3NG0 A;  3W1S A;  4EOY A;  2N0S B;  4OZA A;  4GOC A;  4TQ1 A;  3RMK C;  3DBH I;  3KQ4 A;  4RGO S;  2QIE B;  2MHJ A;  3P4R B;  4BOS C;  1TS5 A;  4MJS B;  5FR6 A;  3HVD A;  4WWN A;  3EGR A;  1FD6 A;  1I0E A;  1TJE A;  3EFC A;  3L4P A;  1IGC A;  3L13 A;  4US9 A;  2LGX A;  2DZM A;  4I6P A;  4ANX A;  3LJ3 A;  4ZHP A;  3WAN A;  4H2A A;  2KXJ A;  2JPH A;  2W3R A;  5EE9 A;  3C8Y A;  5J18 A;  3ALB A;  2B76 B;  4GXB A;  2GLS A;  2K3U A;  1R4N B;  2I1J A;  2DAJ A;  2N7E A;  3PRE A;  1Q0W B;  3RT3 B;  4YSX B;  1LM8 B;  1PQS A;  3DVG X;  1SF0 A;  3VUY A;  4JPS A;  1Y8R C;  4WH4 A;  1OFF A;  3E56 A;  1T0Q C;  1DOY A;  2BKF A;  2WXK A;  3IXS A;  3PGE A;  4YT0 B;  3UQA A;  4K3C A;  2JYT A;  2PKO A;  1ZOY B;  4W9G A;  5AZF A;  3QHT A;  2ZW1 A;  4X57 B;  1B9R A;  2M8S A;  1HZ5 A;  1P3Q U;  2G4D B;  4IDI A;  3ZTC A;  4PS3 A;  2GBN A;  4W9D A;  1ZDV A;  3AU4 A;  4P7I A;  4RFB A;  3AE6 B;  3TEX A;  4JGH B;  1QF6 A;  5EE0 A;  3RD2 A;  2PEA A;  3AB5 A;  4M0W A;  4ZRJ A;  3VH3 B;  2WU2 B;  1NI2 A;  2ASQ A;  3I57 A;  2IGH A;  1F2R I;  3AN1 A;  3LN7 A;  1SBB B;  2ZVO A;  4G11 A;  3MC9 A;  4A90 A;  2G45 B;  2JXX A;  4TV3 A;  2WXM A;  4N9F 4;  1G6J A;  1WYG A;  3DDC B;  3UIP B;  2AX5 A;  3VRA B;  2W54 A;  3ZYY X;  2N9K A;  4NAW B;  1UBI A;  1V4G A;  4GSW A;  2MW5 A;  4OVU A;  4LTU A;  1STE A;  3V05 A;  3S2A A;  4XZ4 A;  1LFD A;  1ZXI A;  3SFE B;  4WWP A;  3UIO B;  1WXA A;  3AEA B;  2V0G A;  4GU2 A;  3AU5 A;  5MPO A;  4AP4 C;  1ZUD 2;  4BBN C;  2GBM A;  2D10 A;  2V9H A;  1KRH A;  3DBL B;  1SXT A;  3RUL A;  4EE2 A;  1VZ8 A;  4A9A A;  3U52 E;  4KX6 B;  3ZDT A;  4DHZ E;  3A1Q A;  1IUE A;  2C5L C;  3A4R A;  1B1Z A;  1L6U A;  2L76 A;  3V62 A;  4WJP A;  1KOT A;  3NHE B;  1D6E C;  1XXG A;  2BBC A;  2C60 A;  3NZ3 A;  4PS7 A;  3J9C A;  1QIL A;  4K81 A;  4KZC A;  4NJ6 A;  5DCN A;  3DWM A;  2KMM A;  3BYT B;  4DK5 A;  3P2B A;  4A3P A;  4JX1 C;  3APD A;  2KAJ A;  4RGM A;  2I2Y A;  5E6N A;  2IPK D;  1YJJ A;  1WXV A;  4G0N B;  1GB1 A;  3H7P A;  3IG3 A;  4C56 C;  2BYF A;  3OG5 A;  1DOX A;  3GZN I;  3I9V 1;  4XE0 A;  3Q6B A;  3B9J A;  3BK1 A;  1I35 A;  1WWT A;  4K7S A;  4EFO A;  1ET6 A;  5AEK B;  4ZRQ A;  3AEF B;  2K22 A;  1EF5 A;  3NVZ A;  2MBE A;  1EO6 A;  5FK9 C;  4FAD A;  3K9O B;  4M0W B;  2QMT A;  2CKH B;  1V9J A;  3M63 B;  3CST A;  1CRK A;  3EHV A;  2JZP A;  1XLN A;  3LDZ E;  1WM3 A;  3KVF B;  2V3P A;  4GW0 A;  1FRR A;  2LGD A;  3AI5 A;  1WMH A;  3TCA A;  4M8M A;  1ZW7 A;  2KNB A;  4DHJ D;  2WXL A;  2ZPY A;  3TL5 A;  3BWU D;  3HM3 A;  1E5W A;  2DNF A;  2PJH A;  2ZJD A;  3P4S B;  3RN9 C;  3VTU A;  4HLE A;  4PT5 A;  4W9E A;  3RCZ A;  3X0W A;  4JWS C;  3VHT C;  3GB1 A;  5HFY A;  3ZDM C;  1VA6 A;  1RL9 A;  2DLB A;  3QAR A;  3IAM 1;  3D32 A;  1TKE A;  4TQ0 A;  2NBW B;  2RD0 A;  3DRB A;  3B1L X;  2XN9 C;  1T0Y A;  2D32 A;  2Z0E B;  1V5T A;  4ICU A;  4FLH A;  1SSN A;  2OED A;  3PRP B;  4NY0 A;  1UGJ A;  3AED B;  3Q3J A;  4NJ7 A;  3V61 A;  3AEE B;  4R3D A;  3ZNZ B;  1WJ6 A;  4WIP A;  2BWE S;  3WAO A;  3NZS A;  1M15 A;  4DHZ B;  2IGD A;  3A9K B;  3ETR A;  4LNN A;  3A9J A;  1Q1O A;  3JU5 A;  3SFD B;  3ZXR A;  1RM6 C;  2LXC A;  5HKH A;  3N32 A;  4A20 A;  2KTR A;  3P4Q B;  4FHK A;  4FA6 A;  1EU4 A;  4HK2 A;  3HM6 X;  3RYT A;  1KF6 B;  1LGR A;  4PS8 A;  4MGK E;  4BBN F;  2YEP F;  1WX9 A;  2XEW A;  3NVW A;  4G3X B;  1HA5 A;  2LAS A;  3UF8 A;  2WDQ B;  4ZOH C;  5IA7 A;  1ZXH A;  3AEC B;  1ROE A;  4TKN A;  2DHZ A;  3ML9 A;  2MP2 A;  4KGR A;  4G50 A;  2GWC A;  1C4C A;  3TEW A;  4GDL A;  1V6E A;  1GUA B;  1T0R C;  3DPD A;  4RGN A;  4JWU C;  4B95 A;  2JZ3 B;  1L6V A;  2KJ6 A;  1C1Y B;  2LRW A;  1PYW D;  2AQ1 B;  1VZ6 A;  3AE1 B;  2KLG A;  2FBW B;  2SAK A;  1N61 A;  3DOW A;  1WJU A;  2LFI A;  4D2K A;  2MBQ A;  2EMT A;  5GXG B;  5L95 C;  4B6W A;  4ZRK A;  2VH2 A;  1UF0 A;  1N62 A;  1WMH B;  3JW0 X;  2M1M A;  3IBE A;  4HKQ A;  1OQR A;  2YVC A;  3H6N A;  2KFK A;  3UGB B;  2N9X A;  2JWU A;  2QC8 A;  4BZA A;  2M0A A;  3AE9 B;  3W1S C;  4AWJ A;  3O65 B;  4ANW A;  2N9E B;  3I5J C;  2LHD A;  1XT9 B;  4B0M A;  2A5U A;  1P7F A;  3VH4 B;  4LJO B;  1L7Y A;  1YOV B;  5IP4 D;  4EKU A;  3ZQ4 A;  4YSY B;  4RF1 A;  3PZ8 A;  3GE8 C;  3ABV B;  5BYR A;  1SJE D;  3EUB 2;  3VUW A;  2IY1 B;  4XWT A;  4MJS A;  1ZP0 B;  5AZG A;  1FRD A;  2G9H D;  1L0V B;  1JWU D;  3N9Y C;  1J19 A;  4IWP A;  4ZHO A;  3HK0 A;  5I4D A;  3A9J B;  1EWC A;  1WE6 A;  4M00 A;  2MH7 A;  2KN4 A;  2DWQ A;  5BMG A;  3HHM A;  2HE7 A;  4ANV A;  3ZRC A;  1E8Z A;  3VQI A;  1NI3 A;  3LVV A;  1J7C A;  1P52 A;  2CR5 A;  1ESF A;  2ACZ B;  3VTW A;  1BT0 A;  1ZE3 D;  2KZR A;  4ZDV A;  5C1Z A;  4GVZ A;  1KLU D;  3CSF A;  1UEL A;  4LNI A;  1WI0 A;  3SEB A;  2WX0 A;  2IO1 B;  1YJ1 A;  5KHQ A;  2MLB A;  1V97 A;  2V4L A;  3DRE A;  1C76 A;  3L0W B;  1IP9 A;  4QAY A;  3DBL I;  2BS3 B;  3DWG C;  4IWO A;  2KC1 A;  3HIZ A;  1KM7 A;  2J53 A;  2IGG A;  1VR9 A;  5DPT A;  1CZP A;  1VD2 A;  2KMA A;  2L1A A;  2MP2 B;  3HUI A;  1R8G A;  2SEB D;  4ZYS A;  1N5W A;  2LZ6 A;  3ZGZ A;  5JXV A;  2LJ5 A;  2BQQ A;  3U7D A;  3RPF C;  4RF6 A;  4M02 A;  2TSS A;  4C7Y A;  2JU6 X;  1TY0 A;  2WQY B;  1GB4 A;  2AQ2 B;  5DPW A;  1UNS A;  3CF6 E;  2CU3 A;  2E6X A;  2M0X A;  2EKE C;  2PVO D;  3DHG C;  1YN5 A;  2PTL A;  3VR8 B;  3AM9 A;  1M4V A;  2PW9 A;  1VLB A;  3T3O A;  5CHF A;  4L23 A;  2KFK B;  1OGW A;  5D7G A;  2V3N A;  3DBS A;  5CTR C;  5IAA C;  1F52 A;  5HHD G;  4XDC A;  2N7D A;  1C79 A;  3N20 C;  1FIQ A;  3K9P B;  3VXW A;  2E3T A;  2K8C A;  2BB6 A;  1AN8 A;  5LNK 1;  5J17 A;  4MGY E;  3JQ3 A;  1FFU A;  1AWD A;  2NTS A;  5G2N A;  4LNF A;  5J9A A;  3LVW A;  3BYY B;  4HJK A;  3B2G A;  3VDZ A;  1RLF A;  1MHX A;  1N60 A;  4KIK A;  2KJH B;  2QDF A;  2BS2 B;  1WGK A;  1WY8 A;  1D4B A;  2JYE A;  1I4P A;  1I4Q A;  2L00 B;  2LUE A;  4II2 B;  2WS3 B;  1TBE A;  3U7Z A;  1T3Q A;  4FJV B;  2Q5W D;  2M19 A;  1WH3 A;  1NEN B;  4JE3 B;  4DXA B;  2FNJ B;  2NPT B;  4KKI A;  3U4E G;  1PGX A;  2Y3A A;  2CS4 A;  4RGT A;  3VAW A;  2QCZ A;  2NBV B;  2ZZP B;  3BVG A;  4KGT A;  2INN E;  1QK1 A;  4M8N A;  3PLU A;  1JWM D;  2RGF A;  4P1C C;  5JHA A;  1P9D U;  3LXF A;  3R7R A;  2AYO B;  1I42 A;  2GRI A;  2K39 A;  4KSL C;  4CHK A;  1C4P A;  4HEA 1;  4N59 A;  4NQK E;  3R2I A;  2QEJ C;  4BKS A;  3U30 A; 
#chains in the Genus database with same CATH homology
 3ZXV A;  1VA6 A;  1V4G A;  1FPY A;  2BVC A;  4S17 A;  2QC8 A;  1TT4 A;  2LGS A;  3IG8 A;  3LN7 A;  4HPP A;  3LN6 A;  3NZT A;  1F1H A;  2OJW A;  4ACF A;  2WHI A;  3IG5 A;  1HTO A;  4LNO A;  4LNF A;  3LVV A;  3LVW A;  4LNN A;  3FKY A;  2GLS A;  2GWC A;  2WGS A;  2GWD A;  4LNK A;  4S0R A;  1HTQ A;  4BAX A;  1LGR A;  2D32 A;  3ZXR A;  2D33 A;  1F52 A;  2UU7 A;  2D3C A;  1R8G A;  4LNI A;  3NG0 A;  4XYC A;  2D3B A;  2D3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...