2QC8A

Crystal structure of human glutamine synthetase in complex with adp and methionine sulfoximine phosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 116
structure length 356
sequence length 356
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2qc8A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2qc8A02
2WGSA 2GLSA 3NG0A 1F52A 4LNFA 4LNIA 1FPYA 3ZXVA 3ZXRA 4LNKA 4LNNA 4S17A 2OJWA 2D3BA 3FKYA 4S0RA 4HPPA 2BVCA 4LNOA 2QC8A 2UU7A 2LGSA 2D3AA 1F1HA 4BAXA 2WHIA 4XYCA 4ACFA 1HTQA 1LGRA 1HTOA 2D3CA
chains in the Genus database with same CATH superfamily
3APCA 3BVGA 2KJRA 3AE2B 1Y56A 1T0RC 3BYYB 4ZOHC 2NPTB 4N6EB 2NBVB 1ZXIA 3C19A 1PQSA 2PTLA 3OJ3A 3EGRA 2KFKA 4A90A 2G4DB 4JX1C 1XLQA 4M0WB 1R7SA 1WXSA 4IM3A 2LRWA 3N1YC 2WXPA 2DLBA 2D10A 2MH7A 4ARCA 4IW0A 2MP2A 1Z2MA 4ANXA 1TTNA 2KLGA 3Q8CA 4M8NA 2N1VA 1R4NI 4URKA 1VD2A 5D6JB 1Y8RC 4NPNA 4JGHB 4WJOA 1IGCA 1HA5A 4G11A 1C3TA 2W3RA 3NHEB 1VJKA 2INPE 1CK1A 1D5ZC 1E8XA 4KKJA 1DGJA 4ANWA 5DPSA 3ZUNA 1P0RA 1TY0A 2KX3A 2YEPF 3AE3B 3W1SC 5J17A 4OZAA 4PYUA 4KIKB 5G55A 1RWSA 1D3ZA 4US9A 3V60A 5HG2A 2L0FA 1WJ6A 3BWUD 1J7BA 2FUHB 3PT2B 2ZPYA 1AWDA 1QQRA 4EUTA 2IGDA 3KQ4A 2J0JA 1EO6A 4N9F4 4OW0A 3PZ7A 3P4PB 2RMMA 3BYTB 3TSSA 4LNOA 3KYDD 2HTHA 3ZTDA 4FJYA 1TS2A 1GB1A 1C79A 3PPAA 2DYOA 4IUMB 3PHXB 1L6VA 2C7NB 3N30A 1V49A 2N9KA 4NQKE 4PYZA 3QJZA 2MA9B 2KHWB 4A6QA 1TBEA 2GBRA 3ALBA 2EELA 2K9XA 2FE8A 4RF6A 2D5GA 1XF5L 4P1CC 1IYFA 1A70A 2KJ6A 3A4SC 5JXVA 1F77A 2KWVB 2PE6B 3W1SA 4Z9MA 1UUPA 4JWUC 5CHWA 1KF6B 2WX1A 1C4PA 1DOYA 1V86A 2N7DA 4DHZE 3QWZB 2MX2A 3L16A 3E56A 5AZFA 3C8YA 3ECIA 4YTPB 1WXMA 3VXWA 3VRBB 4LDTB 2WXGA 1SEBD 2W54A 3DHIC 2KN4A 3WALA 4PS3A 3RT3B 2FUG1 1MHXA 5TR5A 3AU5A 2G3QB 3PV1A 4LNIA 3UINB 3BK1A 3NZUA 4P7IA 3AEBB 2D33A 4REZA 4AOFA 2Z0EB 4FLHA 4LNKA 3DBRB 2QEJC 4BVUC 4EZKA 3AB5A 1UBQA 3CF6E 2A4ZA 3IBEA 3DWMA 3T9LA 1LQBA 3LN6A 1YQ3B 1XEEA 1AN8A 1ZPSA 2Y5PA 4ACFA 5IKCM 4XDDA 1Q0WB 2JX5A 4W9CA 4D2KA 1GJZA 5J9AA 1HZ5A 1E7VA 4II2B 2KWUB 4IC7B 2K8HA 4BKSA 2FIDA 4LTUA 1ZUD2 4WAAA 4EKUA 4HLEA 4DDID 4BFRA 2KQ7A 4NAMA 4HKZE 3T3OA 3A9KB 4MH0E 1V9JA 3JW0X 3FILB 5HKHA 1ZKHA 4NZLB 1EWCA 3PHWB 5EE3A 3QA8A 1HTOA 3UI3A 3PZDA 1NI3A 4W9HA 3PZ8A 3RMKC 1WYWB 3GS2A 2MBQA 3WIMA 4K7WA 2N7JA 4OZCA 1BXTA 1V1PA 3K9PB 2FCNA 4RGOS 2WDRB 1TKYA 3ML8A 3MC9A 4ZRIA 3DREA 2INNE 2BF8B 1M94A 1D5MC 2LVOA 1Z5SB 3L2DA 1JW9D 3C0RB 1K50A 1JWUD 2IPKD 1R4MB 1R4NB 1N5XA 1B9RA 2GWCA 2KWCA 2BYEA 3L0WB 2FNJB 3BY4B 3R2TA 2J1QA 4K81A 3AEFB 4PK1A 1GPXA 1B1ZA 1BUIC 4N59A 3OJ4B 1UGJA 3A1QB 1OEYA 2IZVB 2SEBD 4CYEA 1LGRA 1V80A 3KUCB 1YQBA 4MT5A 4DHJD 4GVYA 3ZTCA 1V2YA 4YTNB 2MHJA 2V0GA 2VZKB 3MP9A 2KDMA 3JSVB 2OJWA 3KWLA 3SHQA 4WQMA 3W1YA 2LGSA 3NY5A 2ZZPB 1QKZA 1M4VA 1LO5D 4BBNC 4HDOA 3Q3NC 2J0MA 2X38A 3SEBA 4TMAB 4AM1A 1TZ1A 3S2AA 2KTFA 3DHGC 2KVZA 4ANVA 3Q3JA 2DX5B 3VAWA 2PLPA 2KMMA 2I38A 4WJNA 4LNNA 1SD0A 3OWEB 1YX5B 4HPPA 5GMVA 1SIJA 3HHMA 1GUAB 2ACZB 2QC8A 3L08A 2JT4B 1L2NA 1N60A 2PEAA 1SGHA 1E8ZA 4NJCA 2FCQA 2MEKA 5HHDG 2C7HA 3GZNI 2PIAA 1RRBA 1QLBB 4G0NB 2K25A 4TKNA 1V81A 1VZ6A 3ZNGC 2IGGA 3TIXA 3R8BA 2ZW1A 5FK9C 5CX3A 3BINA 2BKRB 5C2TB 4TSSA 3TEWA 1ENFA 2NTSA 4HCPB 2XK5B 2B3AA 4YTMB 3T3NA 5AUIA 3SFDB 4IKGA 1SF0A 4HVBA 3RFZB 1EUVB 2QMTA 2OJRA 1WJNA 1OTRB 3A9JA 3OAWA 4NY0A 2LASA 4GDLA 1UD7A 3MC8A 3V6CB 3PRMB 3M63B 2L7RA 2G1EA 4M00A 3U30A 1C9FA 2N1WA 4DQOC 1YIWA 2WXNA 4W9DA 1XQQA 1FO4A 4HROA 1OQYA 4RGNA 5I4DA 4KGTA 2JU6X 1EF1A 2REXA 2RPQA 2WXMA 2KVRA 1XCTL 3IT6B 1QOAA 2KFJA 3K9OB 2IO1B 2JWUA 2XBBC 2Z59B 1FFUA 1ZW7A 1KLGD 3ZNHB 1PGBA 4ZYNA 1MG8A 4MM3A 4BHLA 3VH4B 4WQOB 1N5WA 3PS6A 3JSVA 5J18A 2RDHA 4BG4B 2LGDA 1YOVB 1KJTA 2D3AA 4GSWA 2LUEA 2WXQA 1KLVA 3HVZA 3VFKA 4KGSA 3QHTA 2LGYA 2HD5B 4JE3B 2BS3B 2PW9A 2CS4A 2EMTA 2UYZB 2ON8A 2D2QA 1IUEA 3N32A 3DBLB 3AMZA 3P4SB 3TEXA 5BO4B 3AE6B 1YMHE 1HZ6A 4JLCA 3HK0A 3QC8B 1Q10A 1TS5A 2FAZA 2L05A 2MBBB 2IO2B 1NEKB 3IFWB 4MACA 3ZJVA 1JALA 4BKSD 2DZKA 3JU5A 1ZE3D 2K6DB 1JWSD 3NJTA 2O6VB 3DQVA 2JZPA 2W55A 2BVCA 3RNEC 2MBOA 1SJED 1HQRD 3PO0A 5JHBA 2V1YA 1E0ZA 2JRHA 3EC8A 3A33B 2VRRB 2ZW0A 2PE9A 2WXJA 1E7UA 2WXHA 3W2DA 1UH6A 3EUB2 2CHZA 2H88B 1QOBA 1L6UA 4GN1A 4AWJA 3DBRI 2KAJA 3RZFA 1KRHA 3R66C 2ZJDA 3CMMB 1I4PA 4AUQC 1QH4A 1UNSA 2FIFA 1WXAA 4FULA 3JU6A 2MBEA 1XCQL 1UF0A 3DRBA 4K1RB 4PS8A 1ZOYB 2IY0B 2KTRB 2LHDA 4HJKA 2WDTB 2M56B 1YN4A 4XWTA 5IO9A 2HJ1A 4KSKC 4RCOA 1VR9A 1ZGUB 3R3MA 2ZVNA 2R2QA 3Q8AA 2KXJA 1S1QB 4R3DA 1N62A 2J53A 1WIAA 1WZ0A 3AN1A 4PT5A 3NG0A 1C1YB 2WQYB 1WE7A 2L3ZA 4XGAB 1TZOA 3GZNB 1WX8A 2AQ1B 1F2RI 3LXFA 1IPGA 3NVVA 2V4IB 3HM6X 3L13A 2MJ3A 2NBWB 1T5XD 3JPZA 2KMCA 2GBKA 2KDIA 5AZHA 3SFEB 4XYCA 2BYVE 3Q8FA 5IOIA 2QDFA 4XWWA 1G6JA 3AULA 4RFBA 4JPSA 3VRAB 5TSSA 1R4MI 4MGIE 2N9PC 3KUDB 1XXGA 1MI0A 3FAHA 3RULA 2LI5A 1C4CA 3LB8C 4LK0M 3AV8A 1TGZB 3X0WA 4W9GA 3Q3MC 1F52A 2L32A 3U8ZA 1J8CA 3NRZA 1JRPA 3B9JA 4W9JA 3P42A 4QAYA 4IWPA 3ZYYX 2O6VA 2V9HA 1VZ7A 3FKYA 1GB4A 1XLPA 1TKEA 3Q3OC 1R8GA 2LJ5A 1QZEA 4RGTA 3RNCC 5AUKA 2LXAA 5C23A 3UF8A 4YXDB 5C1ZA 3RD2A 1C4AA 2N9EB 2DYBA 1L0YB 3ETRA 1OEYJ 4YT0B 1OFFA 4MJSB 4AJYB 1SJHD 1FNWA 2JZZA 2KKCA 1VCBA 3LN7A 1ROEA 2HJ8A 5AZGA 3ENEA 1UGMA 2AEHA 4ASWC 4LJPB 2KTRA 1BT0A 3H1UA 5BMHA 3HIZA 2PJHA 1FRRA 4BZAA 1TKGA 4IG7B 4S0RA 3TEZA 1VA6A 3APDA 2O2VB 3NUHB 2KYWA 5AEKB 2LMCA 2GBJA 3NS1A 3O65B 4DWFA 1P7EA 3ZDMC 2D3GA 2AYOB 1TYGB 2RPVA 1D6EC 1DOIA 1WXVA 4IWQA 1E6EB 4F8CB 1P9DU 2K0PA 2YVCA 5E6PA 1JWMD 2CRKA 2NPTA 1WY8A 2JUOA 1K53A 4XE0A 2BS4B 1L0XB 3T8MA 1QT9A 3KUZA 4LCDE 4M0WA 3BZDB 2J42A 2GRIA 3LVVA 4RM9A 2D3CA 2NVUI 3EFCA 3R7QA 1PGXA 4ZRPA 3U4EG 5BYQA 4AJWA 4GIVA 3ML9A 2IBIB 2KX0A 3H8HA 3WAOA 3ZNID 2Q5WD 1SE9A 2BKFA 2I1KA 4MGZE 4CO7A 2RD0A 2D07B 2KACA 4J6IA 4KDIC 4L23A 2BWES 2X8XX 1UWMA 2NMQA 4GOCA 4LNFA 1EWYC 3MTNB 2OOBB 3PLUA 5C3JB 4OZBA 3QQ8B 2MLBA 2KDFB 3U7DA 3W9CB 1G0WA 2LEKA 2UU7A 5IA7A 1FXIA 3DWGC 5D3IB 3UIPB 3A4RA 4KIKA 4IWOA 3P4QB 2AWTA 2BYFA 2RGFA 1V5OA 3EHVA 4Q2RA 4HDQA 4MJSA 1CJEA 4FA6A 3B2FA 4IDIA 2HE7A 4KVGB 3LDZE 2WXRA 4FADA 1RLFA 1PGAA 3NOBA 3DBLI 2RDBC 4XZ4A 3VDZA 3SD5A 1N63A 3ZKJC 2OEDA 2AL3A 2JPHA 2ZCCA 5J99A 1UWXA 4EZLA 4GW0A 2LJIA 2RDGA 1YQ4B 1K52A 2JRIB 3CIRB 1V1OA 3B1LX 3QAQA 1WRDB 2KDBA 4BOSC 2JXXA 2WP9B 4JQWC 3H7SA 3H9DA 3IVFA 4YWGG 3Q69A 2NS5A 2PVOD 2MQJA 3RPFC 3Q3FA 5CTRC 2ZNVB 2M0AA 4YSZB 4WWOA 4KKIA 3NS8A 2GI9A 4OVZA 2RR9A 2MBHA 2BS2B 2OHFA 4RF8A 4HEA1 3ONSA 2K6QA 1N61A 1TS3A 3PRPB 3L54A 4WJPA 3N1ZC 1J0GA 3N9YC 4L2YA 1E10A 3ZXRA 1L7YA 2KN5A 4P16A 3KVFB 4HK2A 1WR6E 1V4GA 2ZEQA 2LHEA 1FFVA 3VUXA 3GB1A 1WMHB 3CSTA 1DYQA 3I3TB 2QJLA 2KQ4X 4IM2A 1T0SC 3NZ3A 3RCZA 3AE8B 1SE2A 3TMPB 1EU4A 1BMLC 5GXGB 2WU5B 1J7CA 1E90A 1P7FA 3NVYA 1KH0A 2CU1A 1FNUA 2EKEC 5JZEB 1K51A 2K8BA 3VQIA 3H7PB 1WJUA 3V05A 3RNGC 2IDYA 4FHJA 1NI2A 1K8RB 4GLSC 3A9KA 2ZVOA 3FILA 3TEYA 1FEHA 1FIQA 2N4FA 1FMAD 1MG4A 2N9LA 1KLUD 2J4XA 1TT5B 2M1MA 2BYTA 2BT6A 4RF9A 3MHZA 4YL8A 4B6WA 2K3UA 3LVWA 3AXCA 1NBFC 4G50A 1D5XC 2CHXA 3AE9B 4TQ0A 3Q2AC 1WE6A 1MVKA 1L5PA 4KZ0A 1MJDA 4CHKA 1ZDXA 2NTTA 5H92C 3ZQ4A 5LXIB 2WXLA 1V97A 3L2EB 4GU2A 1VRPA 3ABVB 2N9XA 1F1HA 1U6RA 1LXDA 1KM7A 3NZTA 2WXOA 2QHOA 3U52E 5FKAC 3RN9C 4GW2A 5D94A 4C4VB 3R2IA 3MJWA 1ISNA 3QARA 3PGEA 1Q1OA 1KTKA 3DPDA 4NAWB 3VR8B 1E8YA 4MH8A 4GMVA 1P50A 3L10B 3VTVA 4E71A 3WCQA 3B08A 3A1QA 2BW2A 4K3BA 2WX0A 3APFA 4XC2A 3ZO5B 1PFDA 3DOWA 3DBSA 1PYWD 5FR6A 5G2NA 3MJ5A 2AQ3B 2MJEA 3Q8BA 4ZRQA 1NYRA 2CJNA 4AS1A 4DBGA 4ICUA 4FHKA 2BB6A 3MHSD 2CHWA 3D32A 2V3NA 3PSEB 4JL9A 1UZXB 1XLNA 1FXTB 1VDVA 5DCNA 2KD0A 4C7YA 1YN5A 1E5WA 2BQQA 1KOTA 4DHJB 2XEWA 5FR3A 1VRAB 1WGHA 4YSXB 3AE1B 2L76A 2KFKB 3OG5A 2KDEB 1E8WA 3TBLD 3SDLC 1HTQA 1YJIA 2IY1B 2N0SB 2FCMA 3P1MA 4CQNA 4A8XC 5BMGA 3ZLZA 1XD3B 1QK1A 1DOXA 3B2GA 4G3XB 2WS3B 4X57B 1UELA 4F7ZA 1QF6A 2CU3A 2VH2A 3M3JA 4M02A 2XK5A 2WGSA 4DXGA 1MPEA 1L4DB 3DCGA 1FPYA 2DZIA 2GOWA 4AP4C 4OHJA 3P2BA 1H4RA 3VHTC 3UGBB 2L83A 4ARIA 3L2EA 4EEWA 2XN9C 1XO3A 2ICIA 5BYSA 3EFUA 3BVMA 2KOXA 2K8CA 2VH1A 1RYJA 4A3OA 2MRPA 1IBXB 2EKIA 1AW7A 2DYMA 2YEPB 3N1XC 2RSUA 5CHFA 4E3CA 1L4ZB 2JWZA 3VTUA 1SBBB 1T0QC 1YN3A 3DHHC 3RNFC 1TIFA 2SAKA 2I1JA 3QIJA 4EOYA 4M8MA 2LVQA 1FXAA 3U7ZA 2LFIA 4W9IA 4LDTD 3RUIB 4DXAB 4BG4A 2BGFA 2K1FA 1WGRA 2IO3B 3QCAA 4US8A 3RNBC 4DXFA 1FM0D 5L83A 2QCZA 1SB3C 1WGYA 1GC7A 1SE3A 4O1NA 3W5UB 1I4QA 3IHPC 5EE1A 3X23A 2GBNA 1D4BA 2LZ6A 2PKOA 2A5UA 3BK2A 3DVNU 4TQ1A 2N7EA 3M95A 1T3QA 2JVCA 4C80A 4HCNB 3L17A 4FJZA 2L52A 3AM9A 1WM3A 1E9MA 1S3SG 1TJEA 2Y3AA 3V62A 4WIPA 3KW5B 4OVVA 4I6NB 1HEZE 1I4HA 2PMVA 2E3TA 4ZHPA 1U4AA 4OVUA 2KC1A 3ZGZA 1M15A 2I2YA 3DBHB 3ZDTA 4ZDVA 2MW5A 1LFDA 2JYTA 3UQAA 5IAAC 4HPLB 3VR9B 2G4SA 1J7AA 4MGYE 1VLBA 2DAFA 5KHOA 4A3PA 1NYQA 2KT7A 2MJDA 1NDDA 2W82A 2XNAC 2QIEB 2J52A 2AL6A 4A9AA 2E6XA 2JF5A 1IBXA 4WJQA 1QILA 5L95C 2GBMA 3RNAC 1XLOA 2HDEA 1FRDA 4S17A 1BG0A 2KANA 1C77A 1V1PB 1OQQA 2KK8A 3ZJTA 3KWVA 3RYTA 2DZJA 4IM0A 1JRUA 1I42A 2BWFA 1EM7A 2V4LA 1A5RA 1I35A 3SR6A 2WXIA 5LXHA 3AEEB 2LWPA 3I5JC 3W5VB 2LD9A 2KO3A 2D32A 2C60A 2DENB 1P1AA 4HRSA 2CKHB 4RF0A 3GE3C 4WH4A 3WAPA 2BB5A 2WDQB 3IG5A 2WU2B 4ITKA 5D2MB 1GOZA 4GVZA 2VZKD 1AARA 4MSQB 3AEDB 1C78A 1JWAD 2NBUA 1WYGA 2YLMA 2L0TA 1FCLA 1YJJA 1MFWA 2INCC 1P3QU 2M0XA 4FBJB 3I9V1 4WWNA 3VVWB 1WWTA 1ESFA 4FJVB 4W9FA 3QX1A 4ZRJA 2PVGC 4DHZB 2KZRA 4KV2A 1YD8U 2DNFA 1I0EA 3NVZA 5JH5C 1WGGA 3I63C 3B0AA 3NVWA 4IOIE 4RF1A 3R7RA 4MELA 3AH7A 4RM8A 2QSDA 1YJ1A 4HPMB 1JCKB 4B0MA 1TY2A 4RF7A 3P63A 2TSSA 4LJOB 1PDXA 1ZP0B 5HI1A 2IYDB 2W3SA 3EECA 2MCNB 1IGDA 1CRKA 3TUOA 3IT4B 1WXQA 3BIID 1H8CA 4EFOA 2NCNA 3HM3A 4H2AA 5G5HA 3IG3A 4GB9A 3DDCB 1RFAA 2IO0B 2WDVB 1YX6B 3PVLA 3GP7A 5DPWA 1AYFA 3VUYA 2C7MB 3V3XA 2J7QB 2UWQA 5LLIA 2K22A 3L4PA 5IN7A 1F9JA 1ZDVA 2LUMA 3VUWA 3TL5A 2O2VA 3AE4B 2BPSA 2WXFA 4FN2A 2K39A 4GDKB 4C56C 3DVGX 1JQ4A 4MSMB 4JIOU 3P4RB 3ZRCA 1WX7A 3WANA 1N6ZA 1MHHE 3JVZX 4E74A 2KJHB 3A9JB 4GDLB 2B76B 3ZVVA 2KNBA 1IP9A 2KC2A 3KYCD 2JXTA 1WM2A 1Q5WB 4HKQA 4C7ZA 4A20A 2PPHA 2IJ0A 2FBWB 2QILA 1WR1A 4XX5A 4W9LA 1CMXB 2Y5BB 1GNUA 2GLSA 1FD6A 3UIOB 1KFYB 4NJ7A 3V6EB 1F2RC 3GOEA 4GGQA 3N20C 1WJ4A 4DK5A 2BTEA 2KLCA 4A55A 3OLMD 4P1BC 2ZPNA 1PUTA 3CWIA 5MPOA 3UQBA 3MC0B 4WWMA 2WLBA 3CSFA 4ANUA 1P98A 4EE2A 4UDUC 2NR2A 2BBCA 3ZW3A 4MM3B 1P52A 1CQVA 3IG8A 3IAM1 2D11A 2M8SA 1TS4A 3NZSA 1FCCC 1VZ8A 1SE4A 2DWQA 4AQ7A 3ZJUA 3PTFC 4K3CA 3O13A 2GB1A 4BAXA 1QOGA 1ET6A 1V6EA 5IP4D 1RAXA 2M4NA 4RMAA 3MFGA 5BYRA 2IGHA 5D7GA 2FCSA 3JQ3A 2O6VD 2JYEA 3B6RA 4MGKE 2ZNVC 4BOZB 2LRUA 1HXYD 1SSNA 4DDGD 1T6BX 1WX9A 4F1SA 5E6JA 1I4RA 4Q2JA 3AE7B 4K7SA 5DPRA 4MEMA 5T8IA 3DVNV 1WI0A 1WRIA 4HXDA 5EE0A 4NQLB 2DAJA 2J0KA 1SXTA 1J19A 4W9EA 4N58A 2DHZA 2WWZA 2R61A 1E7PB 2KWDA 4K7UA 2JY6A 3URYA 5D3DA 4TUUA 2AX5A 3U2SC 2Z0DB 2DBYA 1OQRA 3AI5A 4BBNF 1JWBD 3V61A 3QK0A 4USAA 3WA0A 2H89B 4II3B 4GDKA 1WGKA 1EU3A 3M62B 1WF9A 2D3BA 3HVDA 1C76A 3AEAB 1OGWA 1JROA 2LXCA 3VTWA 1HE8A 2CJOA 4J3OD 4NJ6A 3E9SA 2KMAA 3DVGY 3PREA 5DPTA 1QOFA 2LGIA 1GC6A 3BVZA 1L0VB 5KHQA 3IXSA 2LVPA 3DBHI 5CHVC 1ET9A 3H6NA 3I57A 2INDC 2G9HD 4ICVA 1ACCA 3GE8C 1LM8B 2JZ3B 1NENB 3RZWC 3IAS1 4L1BA 3LYYA 1YNTE 2W9NA 4W9KA 4RH6A 4I6PA 3AU4A 4BKGA 2CR5A 1I7HA 1WMHA 1NVID 2R2OA 4NNJB 1UBIA 2G45B 4ZHOA 5G5GA 3KLSX 3HRDD 4BKTA 1GG3A 5BMIA 4WAFA 2V3SA 1WGDA 1JMLA 1RL9A 5E6OA 2C9WB 3Q8EA 3TJPA 2GWDA 5JHAA 2C5LC 3H7PA 2L00B 4XDCA 3SU8X 3TCAA 4B0EA 1XT9B 2ONQA 3M10A 3WAMA 4YSYB 5HFYA 4I6LB 3N3KB 1EF5A 2EMSA 2L8JA 4M01A 4WURA 1SIFA 1I4XA 2MP2B 3PLVA 4KZCA 4MDKE 3AEGB 4KGRA 3ZNZB 3AECB 2HTME 4P6VF 2ZCBA 1F0ZA 4HJGE 2JQRB 1WZ3A 1WH3A 2MWSB 2WYQA 1WSPA 4KX6B 2GMIC 4LLGM 4KSLC 3RI7C 5H8YE 2L1AA 1WFYA 2MSED 4EZJA 2Z8LA 3FC4A 3J9CA 4TV3A 5EE9A 1V5TA 4C00A 4HWIB 1V8CA 2M19A 1STEA 1CZPA 4B95A 3AE5B 5LNK1 4C4VA 1FNVA 3ZXVA 2LGXA 2KQSA 1I4GA 4RGMA 4NAWA 4ZYSA 3EA6A 1RFKA 2JSVX 2M17A 1ZXHA 5E6NA 3VH3B 3ZIMA 5J2RA 2Y5CA 2K5PA 3PRZA 2DZMA 3HUIA 2WHIA 1TT4A 3LJ3A 2WNMA 1X1MA 4FXCA 4ZRKA 4GXBA 1T0YA 4KDLB 2WXKA 2V3PA 2ASQA 2AQ2B 3Q14C 4B9KA 4RNAA 1GAQB 3KH0A 3Q6BA 4PS7A 3ZRFA 4WWPA 3JYUA 5EDSA 4JWSC 1RM6C
chains in the Genus database with same CATH topology
2WGSA 2GLSA 3NG0A 1F52A 4LNFA 4LNIA 1FPYA 2GWCA 3IG8A 3ZXVA 3ZXRA 2D32A 2D33A 4LNKA 4LNNA 4S17A 2OJWA 2D3BA 3FKYA 4S0RA 4HPPA 1VA6A 2BVCA 4LNOA 1V4GA 2GWDA 2QC8A 2UU7A 2LGSA 2D3AA 1R8GA 3LVWA 1F1HA 3LN7A 4BAXA 3IG5A 3NZTA 3LN6A 2WHIA 4XYCA 4ACFA 3LVVA 1HTQA 1LGRA 1TT4A 1HTOA 2D3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGS A;  2GLS A;  3NG0 A;  1F52 A;  4LNF A;  4LNI A;  1FPY A;  3ZXV A;  3ZXR A;  4LNK A;  4LNN A;  4S17 A;  2OJW A;  2D3B A;  3FKY A;  4S0R A;  4HPP A;  2BVC A;  4LNO A;  2QC8 A;  2UU7 A;  2LGS A;  2D3A A;  1F1H A;  4BAX A;  2WHI A;  4XYC A;  4ACF A;  1HTQ A;  1LGR A;  1HTO A;  2D3C A; 
#chains in the Genus database with same CATH topology
 3APC A;  3BVG A;  2KJR A;  3AE2 B;  1Y56 A;  1T0R C;  3BYY B;  4ZOH C;  2NPT B;  4N6E B;  2NBV B;  1ZXI A;  3C19 A;  1PQS A;  2PTL A;  3OJ3 A;  3EGR A;  2KFK A;  4A90 A;  2G4D B;  4JX1 C;  1XLQ A;  4M0W B;  1R7S A;  1WXS A;  4IM3 A;  2LRW A;  3N1Y C;  2WXP A;  2DLB A;  2D10 A;  2MH7 A;  4ARC A;  4IW0 A;  2MP2 A;  1Z2M A;  4ANX A;  1TTN A;  2KLG A;  3Q8C A;  4M8N A;  2N1V A;  1R4N I;  4URK A;  1VD2 A;  5D6J B;  1Y8R C;  4NPN A;  4JGH B;  4WJO A;  1IGC A;  1HA5 A;  4G11 A;  1C3T A;  2W3R A;  3NHE B;  1VJK A;  2INP E;  1CK1 A;  1D5Z C;  1E8X A;  4KKJ A;  1DGJ A;  4ANW A;  5DPS A;  3ZUN A;  1P0R A;  1TY0 A;  2KX3 A;  2YEP F;  3AE3 B;  3W1S C;  5J17 A;  4OZA A;  4PYU A;  4KIK B;  5G55 A;  1RWS A;  1D3Z A;  4US9 A;  3V60 A;  5HG2 A;  2L0F A;  1WJ6 A;  3BWU D;  1J7B A;  2FUH B;  3PT2 B;  2ZPY A;  1AWD A;  1QQR A;  4EUT A;  2IGD A;  3KQ4 A;  2J0J A;  1EO6 A;  4N9F 4;  4OW0 A;  3PZ7 A;  3P4P B;  2RMM A;  3BYT B;  3TSS A;  4LNO A;  3KYD D;  2HTH A;  3ZTD A;  4FJY A;  1TS2 A;  1GB1 A;  1C79 A;  3PPA A;  2DYO A;  4IUM B;  3PHX B;  1L6V A;  2C7N B;  3N30 A;  1V49 A;  2N9K A;  4NQK E;  4PYZ A;  3QJZ A;  2MA9 B;  2KHW B;  4A6Q A;  1TBE A;  2GBR A;  3ALB A;  2EEL A;  2K9X A;  2FE8 A;  4RF6 A;  2D5G A;  1XF5 L;  4P1C C;  1IYF A;  1A70 A;  2KJ6 A;  3A4S C;  5JXV A;  1F77 A;  2KWV B;  2PE6 B;  3W1S A;  4Z9M A;  1UUP A;  4JWU C;  5CHW A;  1KF6 B;  2WX1 A;  1C4P A;  1DOY A;  1V86 A;  2N7D A;  4DHZ E;  3QWZ B;  2MX2 A;  3L16 A;  3E56 A;  5AZF A;  3C8Y A;  3ECI A;  4YTP B;  1WXM A;  3VXW A;  3VRB B;  4LDT B;  2WXG A;  1SEB D;  2W54 A;  3DHI C;  2KN4 A;  3WAL A;  4PS3 A;  3RT3 B;  2FUG 1;  1MHX A;  5TR5 A;  3AU5 A;  2G3Q B;  3PV1 A;  4LNI A;  3UIN B;  3BK1 A;  3NZU A;  4P7I A;  3AEB B;  2D33 A;  4REZ A;  4AOF A;  2Z0E B;  4FLH A;  4LNK A;  3DBR B;  2QEJ C;  4BVU C;  4EZK A;  3AB5 A;  1UBQ A;  3CF6 E;  2A4Z A;  3IBE A;  3DWM A;  3T9L A;  1LQB A;  3LN6 A;  1YQ3 B;  1XEE A;  1AN8 A;  1ZPS A;  2Y5P A;  4ACF A;  5IKC M;  4XDD A;  1Q0W B;  2JX5 A;  4W9C A;  4D2K A;  1GJZ A;  5J9A A;  1HZ5 A;  1E7V A;  4II2 B;  2KWU B;  4IC7 B;  2K8H A;  4BKS A;  2FID A;  4LTU A;  1ZUD 2;  4WAA A;  4EKU A;  4HLE A;  4DDI D;  4BFR A;  2KQ7 A;  4NAM A;  4HKZ E;  3T3O A;  3A9K B;  4MH0 E;  1V9J A;  3JW0 X;  3FIL B;  5HKH A;  1ZKH A;  4NZL B;  1EWC A;  3PHW B;  5EE3 A;  3QA8 A;  1HTO A;  3UI3 A;  3PZD A;  1NI3 A;  4W9H A;  3PZ8 A;  3RMK C;  1WYW B;  3GS2 A;  2MBQ A;  3WIM A;  4K7W A;  2N7J A;  4OZC A;  1BXT A;  1V1P A;  3K9P B;  2FCN A;  4RGO S;  2WDR B;  1TKY A;  3ML8 A;  3MC9 A;  4ZRI A;  3DRE A;  2INN E;  2BF8 B;  1M94 A;  1D5M C;  2LVO A;  1Z5S B;  3L2D A;  1JW9 D;  3C0R B;  1K50 A;  1JWU D;  2IPK D;  1R4M B;  1R4N B;  1N5X A;  1B9R A;  2GWC A;  2KWC A;  2BYE A;  3L0W B;  2FNJ B;  3BY4 B;  3R2T A;  2J1Q A;  4K81 A;  3AEF B;  4PK1 A;  1GPX A;  1B1Z A;  1BUI C;  4N59 A;  3OJ4 B;  1UGJ A;  3A1Q B;  1OEY A;  2IZV B;  2SEB D;  4CYE A;  1LGR A;  1V80 A;  3KUC B;  1YQB A;  4MT5 A;  4DHJ D;  4GVY A;  3ZTC A;  1V2Y A;  4YTN B;  2MHJ A;  2V0G A;  2VZK B;  3MP9 A;  2KDM A;  3JSV B;  2OJW A;  3KWL A;  3SHQ A;  4WQM A;  3W1Y A;  2LGS A;  3NY5 A;  2ZZP B;  1QKZ A;  1M4V A;  1LO5 D;  4BBN C;  4HDO A;  3Q3N C;  2J0M A;  2X38 A;  3SEB A;  4TMA B;  4AM1 A;  1TZ1 A;  3S2A A;  2KTF A;  3DHG C;  2KVZ A;  4ANV A;  3Q3J A;  2DX5 B;  3VAW A;  2PLP A;  2KMM A;  2I38 A;  4WJN A;  4LNN A;  1SD0 A;  3OWE B;  1YX5 B;  4HPP A;  5GMV A;  1SIJ A;  3HHM A;  1GUA B;  2ACZ B;  2QC8 A;  3L08 A;  2JT4 B;  1L2N A;  1N60 A;  2PEA A;  1SGH A;  1E8Z A;  4NJC A;  2FCQ A;  2MEK A;  5HHD G;  2C7H A;  3GZN I;  2PIA A;  1RRB A;  1QLB B;  4G0N B;  2K25 A;  4TKN A;  1V81 A;  1VZ6 A;  3ZNG C;  2IGG A;  3TIX A;  3R8B A;  2ZW1 A;  5FK9 C;  5CX3 A;  3BIN A;  2BKR B;  5C2T B;  4TSS A;  3TEW A;  1ENF A;  2NTS A;  4HCP B;  2XK5 B;  2B3A A;  4YTM B;  3T3N A;  5AUI A;  3SFD B;  4IKG A;  1SF0 A;  4HVB A;  3RFZ B;  1EUV B;  2QMT A;  2OJR A;  1WJN A;  1OTR B;  3A9J A;  3OAW A;  4NY0 A;  2LAS A;  4GDL A;  1UD7 A;  3MC8 A;  3V6C B;  3PRM B;  3M63 B;  2L7R A;  2G1E A;  4M00 A;  3U30 A;  1C9F A;  2N1W A;  4DQO C;  1YIW A;  2WXN A;  4W9D A;  1XQQ A;  1FO4 A;  4HRO A;  1OQY A;  4RGN A;  5I4D A;  4KGT A;  2JU6 X;  1EF1 A;  2REX A;  2RPQ A;  2WXM A;  2KVR A;  1XCT L;  3IT6 B;  1QOA A;  2KFJ A;  3K9O B;  2IO1 B;  2JWU A;  2XBB C;  2Z59 B;  1FFU A;  1ZW7 A;  1KLG D;  3ZNH B;  1PGB A;  4ZYN A;  1MG8 A;  4MM3 A;  4BHL A;  3VH4 B;  4WQO B;  1N5W A;  3PS6 A;  3JSV A;  5J18 A;  2RDH A;  4BG4 B;  2LGD A;  1YOV B;  1KJT A;  2D3A A;  4GSW A;  2LUE A;  2WXQ A;  1KLV A;  3HVZ A;  3VFK A;  4KGS A;  3QHT A;  2LGY A;  2HD5 B;  4JE3 B;  2BS3 B;  2PW9 A;  2CS4 A;  2EMT A;  2UYZ B;  2ON8 A;  2D2Q A;  1IUE A;  3N32 A;  3DBL B;  3AMZ A;  3P4S B;  3TEX A;  5BO4 B;  3AE6 B;  1YMH E;  1HZ6 A;  4JLC A;  3HK0 A;  3QC8 B;  1Q10 A;  1TS5 A;  2FAZ A;  2L05 A;  2MBB B;  2IO2 B;  1NEK B;  3IFW B;  4MAC A;  3ZJV A;  1JAL A;  4BKS D;  2DZK A;  3JU5 A;  1ZE3 D;  2K6D B;  1JWS D;  3NJT A;  2O6V B;  3DQV A;  2JZP A;  2W55 A;  2BVC A;  3RNE C;  2MBO A;  1SJE D;  1HQR D;  3PO0 A;  5JHB A;  2V1Y A;  1E0Z A;  2JRH A;  3EC8 A;  3A33 B;  2VRR B;  2ZW0 A;  2PE9 A;  2WXJ A;  1E7U A;  2WXH A;  3W2D A;  1UH6 A;  3EUB 2;  2CHZ A;  2H88 B;  1QOB A;  1L6U A;  4GN1 A;  4AWJ A;  3DBR I;  2KAJ A;  3RZF A;  1KRH A;  3R66 C;  2ZJD A;  3CMM B;  1I4P A;  4AUQ C;  1QH4 A;  1UNS A;  2FIF A;  1WXA A;  4FUL A;  3JU6 A;  2MBE A;  1XCQ L;  1UF0 A;  3DRB A;  4K1R B;  4PS8 A;  1ZOY B;  2IY0 B;  2KTR B;  2LHD A;  4HJK A;  2WDT B;  2M56 B;  1YN4 A;  4XWT A;  5IO9 A;  2HJ1 A;  4KSK C;  4RCO A;  1VR9 A;  1ZGU B;  3R3M A;  2ZVN A;  2R2Q A;  3Q8A A;  2KXJ A;  1S1Q B;  4R3D A;  1N62 A;  2J53 A;  1WIA A;  1WZ0 A;  3AN1 A;  4PT5 A;  3NG0 A;  1C1Y B;  2WQY B;  1WE7 A;  2L3Z A;  4XGA B;  1TZO A;  3GZN B;  1WX8 A;  2AQ1 B;  1F2R I;  3LXF A;  1IPG A;  3NVV A;  2V4I B;  3HM6 X;  3L13 A;  2MJ3 A;  2NBW B;  1T5X D;  3JPZ A;  2KMC A;  2GBK A;  2KDI A;  5AZH A;  3SFE B;  4XYC A;  2BYV E;  3Q8F A;  5IOI A;  2QDF A;  4XWW A;  1G6J A;  3AUL A;  4RFB A;  4JPS A;  3VRA B;  5TSS A;  1R4M I;  4MGI E;  2N9P C;  3KUD B;  1XXG A;  1MI0 A;  3FAH A;  3RUL A;  2LI5 A;  1C4C A;  3LB8 C;  4LK0 M;  3AV8 A;  1TGZ B;  3X0W A;  4W9G A;  3Q3M C;  1F52 A;  2L32 A;  3U8Z A;  1J8C A;  3NRZ A;  1JRP A;  3B9J A;  4W9J A;  3P42 A;  4QAY A;  4IWP A;  3ZYY X;  2O6V A;  2V9H A;  1VZ7 A;  3FKY A;  1GB4 A;  1XLP A;  1TKE A;  3Q3O C;  1R8G A;  2LJ5 A;  1QZE A;  4RGT A;  3RNC C;  5AUK A;  2LXA A;  5C23 A;  3UF8 A;  4YXD B;  5C1Z A;  3RD2 A;  1C4A A;  2N9E B;  2DYB A;  1L0Y B;  3ETR A;  1OEY J;  4YT0 B;  1OFF A;  4MJS B;  4AJY B;  1SJH D;  1FNW A;  2JZZ A;  2KKC A;  1VCB A;  3LN7 A;  1ROE A;  2HJ8 A;  5AZG A;  3ENE A;  1UGM A;  2AEH A;  4ASW C;  4LJP B;  2KTR A;  1BT0 A;  3H1U A;  5BMH A;  3HIZ A;  2PJH A;  1FRR A;  4BZA A;  1TKG A;  4IG7 B;  4S0R A;  3TEZ A;  1VA6 A;  3APD A;  2O2V B;  3NUH B;  2KYW A;  5AEK B;  2LMC A;  2GBJ A;  3NS1 A;  3O65 B;  4DWF A;  1P7E A;  3ZDM C;  2D3G A;  2AYO B;  1TYG B;  2RPV A;  1D6E C;  1DOI A;  1WXV A;  4IWQ A;  1E6E B;  4F8C B;  1P9D U;  2K0P A;  2YVC A;  5E6P A;  1JWM D;  2CRK A;  2NPT A;  1WY8 A;  2JUO A;  1K53 A;  4XE0 A;  2BS4 B;  1L0X B;  3T8M A;  1QT9 A;  3KUZ A;  4LCD E;  4M0W A;  3BZD B;  2J42 A;  2GRI A;  3LVV A;  4RM9 A;  2D3C A;  2NVU I;  3EFC A;  3R7Q A;  1PGX A;  4ZRP A;  3U4E G;  5BYQ A;  4AJW A;  4GIV A;  3ML9 A;  2IBI B;  2KX0 A;  3H8H A;  3WAO A;  3ZNI D;  2Q5W D;  1SE9 A;  2BKF A;  2I1K A;  4MGZ E;  4CO7 A;  2RD0 A;  2D07 B;  2KAC A;  4J6I A;  4KDI C;  4L23 A;  2BWE S;  2X8X X;  1UWM A;  2NMQ A;  4GOC A;  4LNF A;  1EWY C;  3MTN B;  2OOB B;  3PLU A;  5C3J B;  4OZB A;  3QQ8 B;  2MLB A;  2KDF B;  3U7D A;  3W9C B;  1G0W A;  2LEK A;  2UU7 A;  5IA7 A;  1FXI A;  3DWG C;  5D3I B;  3UIP B;  3A4R A;  4KIK A;  4IWO A;  3P4Q B;  2AWT A;  2BYF A;  2RGF A;  1V5O A;  3EHV A;  4Q2R A;  4HDQ A;  4MJS A;  1CJE A;  4FA6 A;  3B2F A;  4IDI A;  2HE7 A;  4KVG B;  3LDZ E;  2WXR A;  4FAD A;  1RLF A;  1PGA A;  3NOB A;  3DBL I;  2RDB C;  4XZ4 A;  3VDZ A;  3SD5 A;  1N63 A;  3ZKJ C;  2OED A;  2AL3 A;  2JPH A;  2ZCC A;  5J99 A;  1UWX A;  4EZL A;  4GW0 A;  2LJI A;  2RDG A;  1YQ4 B;  1K52 A;  2JRI B;  3CIR B;  1V1O A;  3B1L X;  3QAQ A;  1WRD B;  2KDB A;  4BOS C;  2JXX A;  2WP9 B;  4JQW C;  3H7S A;  3H9D A;  3IVF A;  4YWG G;  3Q69 A;  2NS5 A;  2PVO D;  2MQJ A;  3RPF C;  3Q3F A;  5CTR C;  2ZNV B;  2M0A A;  4YSZ B;  4WWO A;  4KKI A;  3NS8 A;  2GI9 A;  4OVZ A;  2RR9 A;  2MBH A;  2BS2 B;  2OHF A;  4RF8 A;  4HEA 1;  3ONS A;  2K6Q A;  1N61 A;  1TS3 A;  3PRP B;  3L54 A;  4WJP A;  3N1Z C;  1J0G A;  3N9Y C;  4L2Y A;  1E10 A;  3ZXR A;  1L7Y A;  2KN5 A;  4P16 A;  3KVF B;  4HK2 A;  1WR6 E;  1V4G A;  2ZEQ A;  2LHE A;  1FFV A;  3VUX A;  3GB1 A;  1WMH B;  3CST A;  1DYQ A;  3I3T B;  2QJL A;  2KQ4 X;  4IM2 A;  1T0S C;  3NZ3 A;  3RCZ A;  3AE8 B;  1SE2 A;  3TMP B;  1EU4 A;  1BML C;  5GXG B;  2WU5 B;  1J7C A;  1E90 A;  1P7F A;  3NVY A;  1KH0 A;  2CU1 A;  1FNU A;  2EKE C;  5JZE B;  1K51 A;  2K8B A;  3VQI A;  3H7P B;  1WJU A;  3V05 A;  3RNG C;  2IDY A;  4FHJ A;  1NI2 A;  1K8R B;  4GLS C;  3A9K A;  2ZVO A;  3FIL A;  3TEY A;  1FEH A;  1FIQ A;  2N4F A;  1FMA D;  1MG4 A;  2N9L A;  1KLU D;  2J4X A;  1TT5 B;  2M1M A;  2BYT A;  2BT6 A;  4RF9 A;  3MHZ A;  4YL8 A;  4B6W A;  2K3U A;  3LVW A;  3AXC A;  1NBF C;  4G50 A;  1D5X C;  2CHX A;  3AE9 B;  4TQ0 A;  3Q2A C;  1WE6 A;  1MVK A;  1L5P A;  4KZ0 A;  1MJD A;  4CHK A;  1ZDX A;  2NTT A;  5H92 C;  3ZQ4 A;  5LXI B;  2WXL A;  1V97 A;  3L2E B;  4GU2 A;  1VRP A;  3ABV B;  2N9X A;  1F1H A;  1U6R A;  1LXD A;  1KM7 A;  3NZT A;  2WXO A;  2QHO A;  3U52 E;  5FKA C;  3RN9 C;  4GW2 A;  5D94 A;  4C4V B;  3R2I A;  3MJW A;  1ISN A;  3QAR A;  3PGE A;  1Q1O A;  1KTK A;  3DPD A;  4NAW B;  3VR8 B;  1E8Y A;  4MH8 A;  4GMV A;  1P50 A;  3L10 B;  3VTV A;  4E71 A;  3WCQ A;  3B08 A;  3A1Q A;  2BW2 A;  4K3B A;  2WX0 A;  3APF A;  4XC2 A;  3ZO5 B;  1PFD A;  3DOW A;  3DBS A;  1PYW D;  5FR6 A;  5G2N A;  3MJ5 A;  2AQ3 B;  2MJE A;  3Q8B A;  4ZRQ A;  1NYR A;  2CJN A;  4AS1 A;  4DBG A;  4ICU A;  4FHK A;  2BB6 A;  3MHS D;  2CHW A;  3D32 A;  2V3N A;  3PSE B;  4JL9 A;  1UZX B;  1XLN A;  1FXT B;  1VDV A;  5DCN A;  2KD0 A;  4C7Y A;  1YN5 A;  1E5W A;  2BQQ A;  1KOT A;  4DHJ B;  2XEW A;  5FR3 A;  1VRA B;  1WGH A;  4YSX B;  3AE1 B;  2L76 A;  2KFK B;  3OG5 A;  2KDE B;  1E8W A;  3TBL D;  3SDL C;  1HTQ A;  1YJI A;  2IY1 B;  2N0S B;  2FCM A;  3P1M A;  4CQN A;  4A8X C;  5BMG A;  3ZLZ A;  1XD3 B;  1QK1 A;  1DOX A;  3B2G A;  4G3X B;  2WS3 B;  4X57 B;  1UEL A;  4F7Z A;  1QF6 A;  2CU3 A;  2VH2 A;  3M3J A;  4M02 A;  2XK5 A;  2WGS A;  4DXG A;  1MPE A;  1L4D B;  3DCG A;  1FPY A;  2DZI A;  2GOW A;  4AP4 C;  4OHJ A;  3P2B A;  1H4R A;  3VHT C;  3UGB B;  2L83 A;  4ARI A;  3L2E A;  4EEW A;  2XN9 C;  1XO3 A;  2ICI A;  5BYS A;  3EFU A;  3BVM A;  2KOX A;  2K8C A;  2VH1 A;  1RYJ A;  4A3O A;  2MRP A;  1IBX B;  2EKI A;  1AW7 A;  2DYM A;  2YEP B;  3N1X C;  2RSU A;  5CHF A;  4E3C A;  1L4Z B;  2JWZ A;  3VTU A;  1SBB B;  1T0Q C;  1YN3 A;  3DHH C;  3RNF C;  1TIF A;  2SAK A;  2I1J A;  3QIJ A;  4EOY A;  4M8M A;  2LVQ A;  1FXA A;  3U7Z A;  2LFI A;  4W9I A;  4LDT D;  3RUI B;  4DXA B;  4BG4 A;  2BGF A;  2K1F A;  1WGR A;  2IO3 B;  3QCA A;  4US8 A;  3RNB C;  4DXF A;  1FM0 D;  5L83 A;  2QCZ A;  1SB3 C;  1WGY A;  1GC7 A;  1SE3 A;  4O1N A;  3W5U B;  1I4Q A;  3IHP C;  5EE1 A;  3X23 A;  2GBN A;  1D4B A;  2LZ6 A;  2PKO A;  2A5U A;  3BK2 A;  3DVN U;  4TQ1 A;  2N7E A;  3M95 A;  1T3Q A;  2JVC A;  4C80 A;  4HCN B;  3L17 A;  4FJZ A;  2L52 A;  3AM9 A;  1WM3 A;  1E9M A;  1S3S G;  1TJE A;  2Y3A A;  3V62 A;  4WIP A;  3KW5 B;  4OVV A;  4I6N B;  1HEZ E;  1I4H A;  2PMV A;  2E3T A;  4ZHP A;  1U4A A;  4OVU A;  2KC1 A;  3ZGZ A;  1M15 A;  2I2Y A;  3DBH B;  3ZDT A;  4ZDV A;  2MW5 A;  1LFD A;  2JYT A;  3UQA A;  5IAA C;  4HPL B;  3VR9 B;  2G4S A;  1J7A A;  4MGY E;  1VLB A;  2DAF A;  5KHO A;  4A3P A;  1NYQ A;  2KT7 A;  2MJD A;  1NDD A;  2W82 A;  2XNA C;  2QIE B;  2J52 A;  2AL6 A;  4A9A A;  2E6X A;  2JF5 A;  1IBX A;  4WJQ A;  1QIL A;  5L95 C;  2GBM A;  3RNA C;  1XLO A;  2HDE A;  1FRD A;  4S17 A;  1BG0 A;  2KAN A;  1C77 A;  1V1P B;  1OQQ A;  2KK8 A;  3ZJT A;  3KWV A;  3RYT A;  2DZJ A;  4IM0 A;  1JRU A;  1I42 A;  2BWF A;  1EM7 A;  2V4L A;  1A5R A;  1I35 A;  3SR6 A;  2WXI A;  5LXH A;  3AEE B;  2LWP A;  3I5J C;  3W5V B;  2LD9 A;  2KO3 A;  2D32 A;  2C60 A;  2DEN B;  1P1A A;  4HRS A;  2CKH B;  4RF0 A;  3GE3 C;  4WH4 A;  3WAP A;  2BB5 A;  2WDQ B;  3IG5 A;  2WU2 B;  4ITK A;  5D2M B;  1GOZ A;  4GVZ A;  2VZK D;  1AAR A;  4MSQ B;  3AED B;  1C78 A;  1JWA D;  2NBU A;  1WYG A;  2YLM A;  2L0T A;  1FCL A;  1YJJ A;  1MFW A;  2INC C;  1P3Q U;  2M0X A;  4FBJ B;  3I9V 1;  4WWN A;  3VVW B;  1WWT A;  1ESF A;  4FJV B;  4W9F A;  3QX1 A;  4ZRJ A;  2PVG C;  4DHZ B;  2KZR A;  4KV2 A;  1YD8 U;  2DNF A;  1I0E A;  3NVZ A;  5JH5 C;  1WGG A;  3I63 C;  3B0A A;  3NVW A;  4IOI E;  4RF1 A;  3R7R A;  4MEL A;  3AH7 A;  4RM8 A;  2QSD A;  1YJ1 A;  4HPM B;  1JCK B;  4B0M A;  1TY2 A;  4RF7 A;  3P63 A;  2TSS A;  4LJO B;  1PDX A;  1ZP0 B;  5HI1 A;  2IYD B;  2W3S A;  3EEC A;  2MCN B;  1IGD A;  1CRK A;  3TUO A;  3IT4 B;  1WXQ A;  3BII D;  1H8C A;  4EFO A;  2NCN A;  3HM3 A;  4H2A A;  5G5H A;  3IG3 A;  4GB9 A;  3DDC B;  1RFA A;  2IO0 B;  2WDV B;  1YX6 B;  3PVL A;  3GP7 A;  5DPW A;  1AYF A;  3VUY A;  2C7M B;  3V3X A;  2J7Q B;  2UWQ A;  5LLI A;  2K22 A;  3L4P A;  5IN7 A;  1F9J A;  1ZDV A;  2LUM A;  3VUW A;  3TL5 A;  2O2V A;  3AE4 B;  2BPS A;  2WXF A;  4FN2 A;  2K39 A;  4GDK B;  4C56 C;  3DVG X;  1JQ4 A;  4MSM B;  4JIO U;  3P4R B;  3ZRC A;  1WX7 A;  3WAN A;  1N6Z A;  1MHH E;  3JVZ X;  4E74 A;  2KJH B;  3A9J B;  4GDL B;  2B76 B;  3ZVV A;  2KNB A;  1IP9 A;  2KC2 A;  3KYC D;  2JXT A;  1WM2 A;  1Q5W B;  4HKQ A;  4C7Z A;  4A20 A;  2PPH A;  2IJ0 A;  2FBW B;  2QIL A;  1WR1 A;  4XX5 A;  4W9L A;  1CMX B;  2Y5B B;  1GNU A;  2GLS A;  1FD6 A;  3UIO B;  1KFY B;  4NJ7 A;  3V6E B;  1F2R C;  3GOE A;  4GGQ A;  3N20 C;  1WJ4 A;  4DK5 A;  2BTE A;  2KLC A;  4A55 A;  3OLM D;  4P1B C;  2ZPN A;  1PUT A;  3CWI A;  5MPO A;  3UQB A;  3MC0 B;  4WWM A;  2WLB A;  3CSF A;  4ANU A;  1P98 A;  4EE2 A;  4UDU C;  2NR2 A;  2BBC A;  3ZW3 A;  4MM3 B;  1P52 A;  1CQV A;  3IG8 A;  3IAM 1;  2D11 A;  2M8S A;  1TS4 A;  3NZS A;  1FCC C;  1VZ8 A;  1SE4 A;  2DWQ A;  4AQ7 A;  3ZJU A;  3PTF C;  4K3C A;  3O13 A;  2GB1 A;  4BAX A;  1QOG A;  1ET6 A;  1V6E A;  5IP4 D;  1RAX A;  2M4N A;  4RMA A;  3MFG A;  5BYR A;  2IGH A;  5D7G A;  2FCS A;  3JQ3 A;  2O6V D;  2JYE A;  3B6R A;  4MGK E;  2ZNV C;  4BOZ B;  2LRU A;  1HXY D;  1SSN A;  4DDG D;  1T6B X;  1WX9 A;  4F1S A;  5E6J A;  1I4R A;  4Q2J A;  3AE7 B;  4K7S A;  5DPR A;  4MEM A;  5T8I A;  3DVN V;  1WI0 A;  1WRI A;  4HXD A;  5EE0 A;  4NQL B;  2DAJ A;  2J0K A;  1SXT A;  1J19 A;  4W9E A;  4N58 A;  2DHZ A;  2WWZ A;  2R61 A;  1E7P B;  2KWD A;  4K7U A;  2JY6 A;  3URY A;  5D3D A;  4TUU A;  2AX5 A;  3U2S C;  2Z0D B;  2DBY A;  1OQR A;  3AI5 A;  4BBN F;  1JWB D;  3V61 A;  3QK0 A;  4USA A;  3WA0 A;  2H89 B;  4II3 B;  4GDK A;  1WGK A;  1EU3 A;  3M62 B;  1WF9 A;  2D3B A;  3HVD A;  1C76 A;  3AEA B;  1OGW A;  1JRO A;  2LXC A;  3VTW A;  1HE8 A;  2CJO A;  4J3O D;  4NJ6 A;  3E9S A;  2KMA A;  3DVG Y;  3PRE A;  5DPT A;  1QOF A;  2LGI A;  1GC6 A;  3BVZ A;  1L0V B;  5KHQ A;  3IXS A;  2LVP A;  3DBH I;  5CHV C;  1ET9 A;  3H6N A;  3I57 A;  2IND C;  2G9H D;  4ICV A;  1ACC A;  3GE8 C;  1LM8 B;  2JZ3 B;  1NEN B;  3RZW C;  3IAS 1;  4L1B A;  3LYY A;  1YNT E;  2W9N A;  4W9K A;  4RH6 A;  4I6P A;  3AU4 A;  4BKG A;  2CR5 A;  1I7H A;  1WMH A;  1NVI D;  2R2O A;  4NNJ B;  1UBI A;  2G45 B;  4ZHO A;  5G5G A;  3KLS X;  3HRD D;  4BKT A;  1GG3 A;  5BMI A;  4WAF A;  2V3S A;  1WGD A;  1JML A;  1RL9 A;  5E6O A;  2C9W B;  3Q8E A;  3TJP A;  2GWD A;  5JHA A;  2C5L C;  3H7P A;  2L00 B;  4XDC A;  3SU8 X;  3TCA A;  4B0E A;  1XT9 B;  2ONQ A;  3M10 A;  3WAM A;  4YSY B;  5HFY A;  4I6L B;  3N3K B;  1EF5 A;  2EMS A;  2L8J A;  4M01 A;  4WUR A;  1SIF A;  1I4X A;  2MP2 B;  3PLV A;  4KZC A;  4MDK E;  3AEG B;  4KGR A;  3ZNZ B;  3AEC B;  2HTM E;  4P6V F;  2ZCB A;  1F0Z A;  4HJG E;  2JQR B;  1WZ3 A;  1WH3 A;  2MWS B;  2WYQ A;  1WSP A;  4KX6 B;  2GMI C;  4LLG M;  4KSL C;  3RI7 C;  5H8Y E;  2L1A A;  1WFY A;  2MSE D;  4EZJ A;  2Z8L A;  3FC4 A;  3J9C A;  4TV3 A;  5EE9 A;  1V5T A;  4C00 A;  4HWI B;  1V8C A;  2M19 A;  1STE A;  1CZP A;  4B95 A;  3AE5 B;  5LNK 1;  4C4V A;  1FNV A;  3ZXV A;  2LGX A;  2KQS A;  1I4G A;  4RGM A;  4NAW A;  4ZYS A;  3EA6 A;  1RFK A;  2JSV X;  2M17 A;  1ZXH A;  5E6N A;  3VH3 B;  3ZIM A;  5J2R A;  2Y5C A;  2K5P A;  3PRZ A;  2DZM A;  3HUI A;  2WHI A;  1TT4 A;  3LJ3 A;  2WNM A;  1X1M A;  4FXC A;  4ZRK A;  4GXB A;  1T0Y A;  4KDL B;  2WXK A;  2V3P A;  2ASQ A;  2AQ2 B;  3Q14 C;  4B9K A;  4RNA A;  1GAQ B;  3KH0 A;  3Q6B A;  4PS7 A;  3ZRF A;  4WWP A;  3JYU A;  5EDS A;  4JWS C;  1RM6 C; 
#chains in the Genus database with same CATH homology
 2WGS A;  2GLS A;  3NG0 A;  1F52 A;  4LNF A;  4LNI A;  1FPY A;  2GWC A;  3IG8 A;  3ZXV A;  3ZXR A;  2D32 A;  2D33 A;  4LNK A;  4LNN A;  4S17 A;  2OJW A;  2D3B A;  3FKY A;  4S0R A;  4HPP A;  1VA6 A;  2BVC A;  4LNO A;  1V4G A;  2GWD A;  2QC8 A;  2UU7 A;  2LGS A;  2D3A A;  1R8G A;  3LVW A;  1F1H A;  3LN7 A;  4BAX A;  3IG5 A;  3NZT A;  3LN6 A;  2WHI A;  4XYC A;  4ACF A;  3LVV A;  1HTQ A;  1LGR A;  1TT4 A;  1HTO A;  2D3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...