2QC8A

Crystal structure of human glutamine synthetase in complex with adp and methionine sulfoximine phosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Glutamine synthetase
total genus 116
structure length 356
sequence length 356
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2qc8A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2qc8A02
4LNIA 2QC8A 2GLSA 2D3BA 4BAXA 4LNOA 3FKYA 4LNKA 2UU7A 1LGRA 1HTQA 3ZXRA 4S0RA 4HPPA 1FPYA 3NG0A 1F52A 2D3AA 1HTOA 4ACFA 2LGSA 3ZXVA 4LNNA 4LNFA 1F1HA 2D3CA 2WHIA 4XYCA 2OJWA 2WGSA 4S17A 2BVCA
chains in the Genus database with same CATH superfamily
3B6RA 1T0SC 5EDSA 1E5WA 3E9SA 1YNTE 2KC2A 4NNJB 2WU5B 2LWPA 5JHBA 1XQQA 2BYFA 3AV8A 4LJOB 3RT3B 2BYVE 1P0RA 1MVKA 1M4VA 2ZPNA 1A70A 2Y5BB 1VZ6A 4LK0M 3VDZA 2HTME 4AP4C 2NCNA 1F77A 3Q3FA 1XF5L 1GPXA 1KH0A 3M3JA 3SDLC 2W3SA 4EZJA 2RSUA 3KYDD 1HTQA 3AEBB 3J9CA 4EFOA 1WRDB 1C4AA 4RCOA 2AQ3B 4USAA 4KDIC 3VR9B 1HZ6A 3IAM1 2J0MA 4M0WB 3AE1B 4Z9MA 2W9NA 4RMAA 4BZAA 2LGXA 3TSSA 1J7CA 3P63A 5HG2A 4FULA 2KWVB 1OEYJ 3NZSA 2M19A 1UF0A 1IP9A 1XO3A 3U30A 5E6NA 3DBRI 2LGDA 3T9LA 4RF8A 2JQRB 5AEKB 4ICUA 4AM1A 3TEYA 2INNE 1YX6B 2N9XA 3U7DA 1J19A 2X8XX 4HPLB 3KVFB 1TS5A 4E71A 1FNUA 3AEDB 2E6XA 3BIID 2INCC 1R4NB 1Z2MA 3B2GA 4P7IA 1N62A 4P1CC 2MLBA 3UIPB 4HRSA 4BBNF 5HHDG 2BS2B 3M62B 1R8GA 4IW0A 1JWSD 3AB5A 4B95A 2JYEA 2KDBA 2BQQA 4LLGM 4A55A 3ZTCA 1HXYD 4GDLA 1I4XA 2CU1A 1B1ZA 5H8YE 1V9JA 4ZRJA 4MGZE 3SD5A 1F2RI 1PFDA 2MBOA 2JXTA 3PV1A 3MC0B 2FBWB 1YJJA 2D3AA 4L1BA 4GN1A 3MC8A 1UGMA 5LXIB 1XLNA 2WHIA 1JQ4A 3HK0A 1ZKHA 3LVVA 2J53A 5CX3A 1MFWA 3IAS1 3B1LX 2D11A 3OWEB 2J1QA 2BWES 2RD0A 1JROA 1X1MA 3GB1A 2YLMA 2DYBA 2WLBA 4C4VA 3DBLB 3HM6X 1ISNA 4C4VB 2JYTA 5J17A 1FNVA 1E9MA 2DENB 2H89B 4RF9A 4W9JA 1L0YB 3ZVVA 4MACA 3EUB2 3BK2A 2IBIB 4LDTB 2VRRB 1SXTA 1L0VB 4HPPA 4XX5A 5EE0A 5EE9A 4PS3A 1C78A 4ZHOA 3RZWC 1OTRB 1V1PA 4K3CA 3W9CB 1WM2A 3WAMA 1N60A 3FC4A 2KOXA 2WDQB 2C7NB 1WYWB 5C1ZA 2KTRA 3Q3OC 3DHHC 4MH8A 4YTMB 2KAJA 4WAAA 4PT5A 2A4ZA 2LUEA 4W9GA 1WZ3A 3APDA 4WURA 4RF6A 3L2EA 5AZFA 1FNWA 1XXGA 3SR6A 3H8HA 2PVOD 3MP9A 3DRBA 3VUYA 2BT6A 1QLBB 1FEHA 2AWTA 3KUCB 3QARA 2QILA 1JW9D 2MJ3A 4ANWA 3UQBA 3JQ3A 1FD6A 1TY2A 1XCTL 3GZNB 1IYFA 4MM3A 2BS4B 1WGRA 1U6RA 3PREA 1CJEA 3QQ8B 1ESFA 1WGYA 3U7ZA 4Q2RA 2IO1B 2MBQA 3N3KB 4XGAB 3LYYA 4REZA 1KF6B 3L17A 2Z59B 3DBRB 4DHZE 2G9HD 2K1FA 2N7EA 1SBBB 2MEKA 2WGSA 4RF7A 5E6OA 1OQYA 3MTNB 3ZO5B 3DVGY 2B76B 3DWGC 1UH6A 4IC7B 1VRAB 1J8CA 3I9V1 4IM2A 4YXDB 2GRIA 1QZEA 2AQ1B 1GB1A 3DHGC 5AZHA 1SJED 3O65B 2RDHA 3B9JA 3W5VB 4ZOHC 1ZP0B 1F1HA 1GNUA 1WXAA 1YN5A 3DQVA 3VXWA 3M95A 3P4SB 2AL3A 4WQMA 3Q8FA 3TIXA 2D10A 2PE6B 2LZ6A 1WGKA 2NTTA 3ZYYX 2Z8LA 5EE1A 2QJLA 4GDLB 2XEWA 1WGDA 5J18A 2EKIA 1V4GA 3ZKJC 1E7PB 1DGJA 3CSTA 5AZGA 2JUOA 1KOTA 1L7YA 2JZ3B 3BVMA 2PPHA 2XBBC 4G0NB 2NS5A 1MG4A 4KKJA 3Q8BA 4S17A 2BVCA 2O6VA 4WIPA 2KVRA 1QOFA 1V49A 5DCNA 4XE0A 2KQ7A 1AYFA 2LASA 1V2YA 2LXCA 2NMQA 2ZEQA 1RRBA 5HFYA 3WIMA 3VHTC 1V81A 1KTKA 2V4IB 4FBJB 2E3TA 4GOCA 4B9KA 3HVDA 2K9XA 4YSXB 4KX6B 2BKRB 2PVGC 1HE8A 2W3RA 2IO2B 1WXSA 3JSVB 4N59A 1QOAA 2WXQA 1ROEA 1KLVA 2KJHB 3CIRB 4GU2A 4OZCA 3OJ4B 2LGIA 2N7DA 2KANA 3NZTA 1ENFA 1SE4A 2NTSA 1V86A 4XDCA 3BVGA 2L0FA 3CMMB 3ALBA 2W54A 4JX1C 5BMGA 3IHPC 1J7AA 1U4AA 2DLBA 3C8YA 1QOGA 2OOBB 2MJDA 2WXLA 4N58A 1P52A 3ZW3A 3KUDB 2KMAA 1VZ7A 4DHJB 3CF6E 1D3ZA 4LNIA 4AUQC 3AM9A 1R4NI 3FAHA 3AE4B 3PLVA 1ZDXA 3ZRFA 4YSZB 3Q3JA 1EWCA 4RGOS 1ACCA 2RDGA 2GBNA 1EWYC 2L3ZA 2WXJA 3S2AA 1KJTA 3V05A 1AWDA 2G4SA 4NJ7A 2KQSA 3DBHB 2KHWB 3APFA 2N4FA 1WZ0A 1TGZB 4US8A 4C7YA 1UNSA 4JWSC 2O2VB 4RM8A 3V61A 2V3PA 1SE2A 2I1JA 4S0RA 2ZPYA 2PMVA 4I6NB 4H2AA 4EZLA 3NZUA 1WI0A 2M0XA 4RGTA 3UI3A 1WGGA 3AE3B 3A9JA 4C56C 1MI0A 2HDEA 2N9EB 3A4RA 1I0EA 3PS6A 1MHXA 2PLPA 3VTWA 4HDQA 3FKYA 4RGNA 1GJZA 3PZ8A 4NPNA 2CKHB 1EU4A 2CHWA 4MGIE 1K8RB 2MCNB 4HEA1 2K6DB 2WXKA 1P50A 3B2FA 1SEBD 2JXXA 1TKEA 1VR9A 2KYWA 1AARA 4AJWA 2KJRA 2O6VD 2LRUA 2M8SA 3ZXRA 3P4RB 3PPAA 3ZIMA 5D94A 4ZYSA 3LXFA 1C79A 1N6ZA 1FFVA 3W2DA 4BG4B 2MH7A 3QAQA 3QX1A 3L16A 2N9KA 1PYWD 4FJZA 5CHFA 5JH5C 4ZRPA 3ZJUA 4W9DA 3ONSA 1MG8A 3UGBB 3T3NA 4WAFA 3UQAA 3AEGB 3WAPA 1FMAD 2ZCCA 3QHTA 4F7ZA 5IAAC 1TTNA 5CTRC 3VAWA 4BKTA 3RFZB 3JYUA 1C1YB 3APCA 2N0SB 1TIFA 3RZFA 4KDLB 4ZYNA 4W9KA 3PZ7A 5DPRA 3I3TB 3DCGA 4IG7B 2NBUA 2K22A 1QF6A 1WX9A 2EMSA 5C2TB 2K8CA 2WNMA 3JSVA 2KNBA 2DNFA 2EMTA 3EFUA 1V97A 1WR6E 2XNAC 3GP7A 3QK0A 4WH4A 3TUOA 5D7GA 5I4DA 1FRDA 4NQLB 4HXDA 4FHKA 2FIDA 2WP9B 3U2SC 5JZEB 3P2BA 3RNCC 3ZLZA 4A3OA 4P16A 1C77A 1JWAD 2V3NA 2BGFA 3RULA 4I6PA 2Y5CA 2O6VB 5E6PA 4FN2A 2FUHB 3N30A 3I57A 2WWZA 2Y3AA 3L0WB 4MGYE 2KDFB 3VRBB 1WMHA 2M17A 3V6EB 4M02A 1PGAA 3PRMB 4IOIE 4A8XC 4ZRIA 1CQVA 4XWTA 4R3DA 2FNJB 2KJ6A 1KRHA 1M94A 1GC7A 1BT0A 1NYQA 1VCBA 1YD8U 2LRWA 4K7UA 3AULA 1YIWA 3RN9C 1CMXB 4G11A 2JY6A 4JE3B 4GVYA 1CRKA 3ZJVA 3AXCA 2ACZB 1KFYB 2HE7A 2M56B 3P4QB 3MJ5A 4XYCA 2MBEA 1FXAA 4BKSD 3R8BA 4GDKB 4HKZE 5D2MB 5LNK1 4RNAA 3P1MA 3DHIC 1JWBD 1RLFA 3FILA 2L83A 2YEPF 3LJ3A 3R3MA 4DXAB 3Q8EA 3M63B 2X38A 1MJDA 2HJ8A 3C0RB 1V6EA 2KTFA 2WDTB 3DOWA 1I4QA 1NEKB 2WXFA 4OW0A 2WXIA 3A9KA 4M01A 3B0AA 2RPQA 1TZ1A 3AE9B 2L05A 1VZ8A 3IFWB 4JL9A 3H9DA 1YQBA 1UBIA 3O13A 1PGBA 1HEZE 4A3PA 3TEWA 2JRIB 1WFYA 2NPTB 4KVGB 1Y56A 3NG0A 3DWMA 2WDVB 5G5HA 3TEZA 4IM0A 2GOWA 1SE3A 2D33A 3EC8A 4CQNA 1L6VA 2FUG1 3AECB 2KKCA 1WYGA 2GBKA 4W9CA 2C5LC 2LVOA 4ANUA 1WJ4A 2CHZA 2ICIA 4BVUC 3IT6B 3L2EB 3HM3A 2PW9A 3SFEB 3AN1A 3WCQA 1TKYA 1D5MC 2BBCA 5DPWA 4DHJD 2J0KA 3P4PB 2N1WA 3R2TA 2SAKA 2MSED 3NVZA 1P1AA 2N7JA 4CHKA 2CJOA 3N1ZC 5D3IB 4DQOC 3VTUA 5L95C 2BB5A 4EE2A 3QIJA 3UIOB 2GBRA 1G0WA 2OJRA 4NAWA 4IDIA 3BY4B 1FPYA 5IN7A 2KWDA 2KDEB 2V9HA 2QSDA 1I35A 4KIKB 2L52A 1GG3A 2K3UA 5IP4D 3PT2B 4JLCA 1DOYA 4KV2A 5FR3A 1EUVB 2NBVB 5BMIA 1YX5B 2RMMA 2LJ5A 1IGDA 3PO0A 2GBJA 2QMTA 2GBMA 3PRPB 1YQ3B 3ML8A 3SFDB 2R2OA 1T3QA 4IWOA 3R66C 3MC9A 4HJKA 2JWZA 3LDZE 3U4EG 1QILA 5BYQA 3RYTA 1SIFA 4P1BC 1L2NA 1FRRA 3L4PA 1YQ4B 3A1QB 2KO3A 2V0GA 2KN5A 3JVZX 3L54A 2Q5WD 4HCNB 4DWFA 1P7EA 2PE9A 3HUIA 2ZCBA 2LD9A 2PIAA 5KHQA 4HROA 2D5GA 2KK8A 4AJYB 3PSEB 2DZKA 2DBYA 3LVWA 1WWTA 1K50A 3ZDMC 4BFRA 3AE6B 4YSYB 1D5XC 4HLEA 4ARIA 3NY5A 1WRIA 2YVCA 2KFKA 1BUIC 4DXGA 2LHDA 1L4DB 3PLUA 2WXHA 4ZDVA 2MRPA 1E8ZA 3DVGX 2VZKD 2JZZA 3ZNID 1ZDVA 5IO9A 3N9YC 1SF0A 1FM0D 1ET6A 3ZQ4A 1K53A 4GW2A 3T8MA 1IBXB 2CU3A 2LMCA 3N1XC 2VZKB 2MBBB 3OJ3A 1ET9A 2K8BA 2KX3A 1OEYA 2INDC 3BINA 4GXBA 4BAXA 2FE8A 2KTRB 1E7VA 4K3BA 3Q3NC 3JPZA 3HVZA 2BS3B 3UINB 2J52A 1I4PA 1L4ZB 2NR2A 1DOXA 1K51A 4UDUC 2BTEA 5G55A 3AEAB 2INPE 3DBHI 1OQRA 2BWFA 2IYDB 3RNEC 2J42A 2WYQA 3LN7A 1UWMA 2LJIA 1IPGA 2KWUB 4RF1A 1SD0A 2I2YA 4MJSA 3AU5A 4BOSC 4LNNA 4TUUA 1EM7A 4MSQB 3ZRCA 4E3CA 1D5ZC 1BMLC 3D32A 3U52E 3ZGZA 4N9F4 1VRPA 2LUMA 2K6QA 3HIZA 2QC8A 3LB8C 1FFUA 2KN4A 2HJ1A 2V3SA 3BVZA 1LGRA 3ZUNA 4W9HA 3KLSX 3X0WA 1E8XA 3AE2B 3U8ZA 2ZVNA 1ZOYB 1WR1A 3DPDA 5IA7A 4WJNA 3TL5A 4P6VF 4WJOA 2PTLA 2K0PA 3UF8A 4DXFA 2O2VA 2MHJA 3X23A 1JCKB 4G3XB 3DDCB 1VD2A 1R7SA 2N9LA 2WXOA 3ZXVA 3ECIA 1VLBA 1IBXA 1TT4A 5H92C 4WWMA 4X57B 2AYOB 5G5GA 1UGJA 4GB9A 4AS1A 1QK1A 1EU3A 2IGDA 2IGHA 4NQKE 1OFFA 1I7HA 1HTOA 2C9WB 4ACFA 3KW5B 3R7RA 1V5OA 1ZUD2 4EOYA 4KGRA 1TS2A 4LTUA 1IGCA 2L76A 2BKFA 4GSWA 3TEXA 1RFKA 2OJWA 3PHXB 2Y5PA 3DBLI 5KHOA 4KGTA 2PJHA 5AUKA 2D07B 2MX2A 2LEKA 2ZVOA 3TBLD 5T8IA 3RD2A 4II2B 1DYQA 2BYTA 3AEEB 3P42A 2AQ2B 3V60A 1RWSA 4ICVA 3WANA 1E6EB 1LQBA 4IKGA 4MSMB 1CK1A 1JRUA 3WALA 3VFKA 4XC2A 4KSLC 4DBGA 3KUZA 1EO6A 2KZRA 3GOEA 3DBSA 1HA5A 4LJPB 2DYMA 3BZDB 2LGSA 4HKQA 4Q2JA 1L0XB 4GIVA 1FIQA 3VVWB 4FXCA 3PGEA 4PS7A 2W55A 3ETRA 2IDYA 2KVZA 4ZHPA 5DPSA 1T0QC 1MHHE 3NVYA 3SU8X 2ON8A 3MFGA 1QOBA 2KT7A 5MPOA 5J99A 2JZPA 1TJEA 2RPVA 1FXTB 1RFAA 3IVFA 4ZRKA 1SSNA 4C80A 1M15A 1E8WA 2ZZPB 4FJVB 2WXRA 1C3TA 4C00A 4PS8A 2K25A 3JU6A 1WE7A 4ITKA 3EA6A 3IT4B 4HPMB 1STEA 4WWOA 3AMZA 2AEHA 4K81A 2A5UA 1LFDA 1P9DU 4HVBA 4B0EA 1P3QU 1V8CA 4GLSC 1UWXA 2K8HA 1Q10A 3DVNV 1XLQA 2CR5A 3Q14C 1BXTA 4I6LB 3VUWA 1KLUD 1QKZA 3IG3A 1C76A 1YJIA 1XT9B 2WXMA 1WY8A 2DAJA 1FCLA 1FXIA 2KDIA 3HRDD 1HQRD 1WJNA 2QHOA 1J7BA 4QAYA 2QIEB 3Q3MC 4ARCA 2RR9A 2BPSA 1CZPA 4A20A 4KZ0A 4DDID 3MJWA 3Q2AC 5D6JB 4LNKA 2IPKD 1GB4A 1JRPA 4RM9A 3SEBA 2JX5A 4FHJA 1LO5D 4PK1A 5EE3A 1C4CA 3KQ4A 2ZW1A 1B9RA 2CS4A 5IKCM 3L08A 1WXMA 2GMIC 2RDBC 4JGHB 4IM3A 2J4XA 2GLSA 4JQWC 1F0ZA 3AE8B 3Q8CA 4HDOA 4ASWC 3DREA 4JIOU 5FR6A 3VQIA 4AOFA 3N32A 2G4DB 1VDVA 4YT0B 2VH1A 3EFCA 2KC1A 3OLMD 4PYUA 3JU5A 1BG0A 3AU4A 1G6JA 3NJTA 3EECA 4MT5A 3RNGC 3QWZB 4FLHA 2FCNA 3H1UA 4MELA 1TS4A 1AW7A 3R2IA 4E74A 1SIJA 3RCZA 2LFIA 4LCDE 5J9AA 1NDDA 4BKSA 4BKGA 2Z0DB 5LLIA 1WX8A 4MEMA 1XLOA 2GWDA 3NUHB 2KFKB 3NZ3A 1V1PB 3ZNZB 1I4HA 3RUIB 1C9FA 4A9AA 2G1EA 5G2NA 1UBQA 1WXQA 4CO7A 3VRAB 2R2QA 1OGWA 1E10A 1WSPA 1WIAA 2FCSA 4WWPA 2D3GA 2LXAA 2CRKA 3RI7C 2IO3B 2WS3B 5C3JB 3OG5A 2KX0A 4OVZA 2FCMA 4G50A 4HCPB 1TS3A 2FCQA 3QA8A 3V6CB 4RGMA 2K5PA 1Q1OA 4A6QA 2NVUI 3NHEB 2L0TA 3E56A 1N5WA 2PEAA 1QQRA 2L32A 2JSVX 2JF5A 4IWPA 1TT5B 4NJCA 2QEJC 1K52A 3A9JB 1OQQA 1UUPA 3GE8C 3VTVA 1V5TA 4K7SA 2D32A 3RPFC 4FA6A 2Z0EB 5AUIA 4PYZA 4NJ6A 1IUEA 2WX1A 3ZTDA 3RNBC 5HI1A 4AWJA 2KWCA 5FKAC 1ZXHA 3AI5A 4US9A 2TSSA 2JWUA 3Q6BA 1TKGA 5DPTA 4GGQA 5JHAA 2XK5A 4FJYA 1YN3A 2M0AA 2ASQA 2VH2A 1H4RA 2N9PC 3VUXA 1D6EC 1Y8RC 4GW0A 2C7HA 3ML9A 1D4BA 1JALA 1Q5WB 5GXGB 3VH4B 2GB1A 4WJPA 2PKOA 2J7QB 2CHXA 2G3QB 2DZIA 1LM8B 2EKEC 2JRHA 1WF9A 2C7MB 4J6IA 1T5XD 1WE6A 2KD0A 2DYOA 2L7RA 4RH6A 3NVWA 2LHEA 3A9KB 4MM3B 2KLCA 1ZPSA 2AL6A 1L5PA 2UU7A 1WM3A 1PQSA 2JPHA 4WQOB 1P98A 2MW5A 1NBFC 1TYGB 4EUTA 2MJEA 4ANVA 1GAQB 2IGGA 3PZDA 3RNAC 3VH3B 3QC8B 4GVZA 2LI5A 3KWVA 2H88B 1UELA 3WAOA 2KQ4X 1J0GA 4HWIB 3I63C 3QCAA 5HKHA 1C4PA 3TJPA 2D2QA 5CHWA 4TQ0A 1A5RA 1SGHA 2KXJA 3L2DA 4AQ7A 4DK5A 1S3SG 1WJ6A 5LXHA 2KLGA 1PDXA 1JWUD 5BYRA 5TSSA 4F8CB 4W9EA 2SEBD 4HK2A 3TCAA 2ZNVC 2C60A 3DVNU 2DWQA 3W1SC 2ONQA 1NYRA 4M8NA 4B6WA 1NVID 4HJGE 3L13A 1VA6A 2M4NA 1ZE3D 4OHJA 2KDMA 1DOIA 4II3B 3WA0A 2WQYB 1T0RC 1L6UA 2IZVB 3ZNGC 4D2KA 3N1YC 4KKIA 1S1QB 3PTFC 4IUMB 1RM6C 4NAWB 4CYEA 1QT9A 1NI2A 4K7WA 4A90A 3BWUD 5J2RA 3H7SA 1LXDA 4MJSB 4TSSA 3MHZA 2DHZA 1Q0WB 3GZNI 2BF8B 1E8YA 3RMKC 2YEPB 2I1KA 4KGSA 1WJUA 2MQJA 1WX7A 2LGYA 4BBNC 2WU2B 2L00B 4FADA 1RAXA 1VJKA 2V1YA 4OVVA 2WXNA 2L8JA 4GMVA 4MH0E 1P7FA 4DHZB 1Z5SB 3KYCD 1TBEA 4EEWA 1SJHD 1WH3A 2HTHA 3T3OA 2IY0B 2BW2A 3TMPB 2KFJA 1T0YA 2DX5B 4KIKA 4N6EB 3OAWA 2DZJA 2AX5A 1YN4A 1H8CA 1KM7A 2LVQA 4RF0A 4URKA 4LNFA 3SHQA 1RYJA 1FO4A 1WXVA 3ABVB 1QH4A 1GOZA 4TKNA 3ZDTA 2DAFA 3H6NA 5CHVC 3KWLA 3M10A 3A4SC 3RNFC 2B3AA 3FILB 4NY0A 4ZRQA 2R61A 3NVVA 5BMHA 2M1MA 4GDKA 1AN8A 3CSFA 3H7PA 5FK9C 3IG8A 1NENB 3IXSA 2DZMA 2J0JA 2FAZA 3ENEA 4XZ4A 3A33B 2MWSB 4MGKE 2MBHA 2JT4B 4W9LA 1E0ZA 2QDFA 2ZNVB 3K9OB 4M0WA 3MHSD 2EELA 1ZXIA 3GE3C 1TZOA 1WGHA 1MPEA 4OZAA 4EZKA 1UZXB 3BYYB 3NS8A 5GMVA 2HD5B 2WXGA 1N5XA 2WDRB 2MP2A 4IWQA 3V3XA 4TMAB 4C7ZA 4M8MA 3W1YA 1R4MB 3W5UB 4MDKE 3NS1A 4ANXA 4YL8A 2WXPA 3CWIA 2V4LA 3AH7A 4KZCA 3IBEA 3L10B 1I4RA 2L1AA 3QJZA 2BB6A 3PVLA 2IY1B 4YWGG 2KACA 5C23A 1F52A 2MP2B 4LDTD 3PRZA 4XWWA 3URYA 1EF5A 4WJQA 1YOVB 3NRZA 2W82A 3EHVA 3Q69A 1SB3C 3KH0A 4TV3A 4BOZB 5IOIA 1UD7A 3AE7B 4EKUA 2MA9B 3Q8AA 4OVUA 4F1SA 2KMCA 3H7PB 3AEFB 3HHMA 4BHLA 1E90A 1GC6A 2OHFA 2GI9A 5L83A 4O1NA 4DDGD 3N20C 1TY0A 2XN9C 3AE5B 1V80A 2IO0B 4WWNA 3C19A 3R7QA 1I42A 1FCCC 1HZ5A 1YMHE 4NAMA 2NPTA 1XEEA 2ZW0A 1PGXA 3V62A 4XDDA 4L2YA 2UYZB 4YTPB 2JVCA 4OZBA 2ZJDA 4NZLB 1F2RC 3NOBA 5JXVA 3I5JC 2LVPA 3VR8B 4W9IA 1YJ1A 2WX0A 3ZJTA 5TR5A 1N63A 4JPSA 5BYSA 2IJ0A 1GUAB 1V1OA 1NI3A 4J3OD 2D3CA 3GS2A 1RL9A 3BYTB 2N1VA 1PUTA 3A1QA 2FIFA 2CJNA 3ZNHB 1I4GA 2QCZA 2KMMA 3EGRA 1ZGUB 1ZW7A 5E6JA 5D3DA 2G45B 2JU6X 1XLPA 5BO4B 2GWCA 1KLGD 2OEDA 2XK5B 4JWUC 1JWMD 4YTNB 2I38A 3LN6A 2K39A 2RGFA 1EF1A 2REXA 2NBWB 1R4MI 4TQ1A 4K1RB 3JW0X 4BG4A 3W1SA 2D3BA 3B08A 4LNOA 4M00A 1E7UA 1F9JA 1SE9A 1XCQL 4B0MA 1WMHB 3BK1A 3IG5A 1N61A 1XD3B 3PHWB 1T6BX 2BYEA 4L23A 4KSKC 2UWQA 1JMLA 3K9PB 4W9FA 4RFBA
chains in the Genus database with same CATH topology
4LNIA 3LVVA 2QC8A 3LN7A 2GLSA 2D3BA 4BAXA 2GWCA 4LNOA 3FKYA 4LNKA 2UU7A 1LGRA 1HTQA 3ZXRA 4S0RA 4HPPA 3LVWA 1FPYA 3NG0A 1F52A 2D3AA 1HTOA 3LN6A 1VA6A 4ACFA 2LGSA 1V4GA 3ZXVA 4LNNA 2GWDA 3IG5A 3NZTA 3IG8A 1R8GA 4LNFA 1TT4A 1F1HA 2D3CA 2WHIA 4XYCA 2OJWA 2WGSA 2D33A 2D32A 4S17A 2BVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNI A;  2QC8 A;  2GLS A;  2D3B A;  4BAX A;  4LNO A;  3FKY A;  4LNK A;  2UU7 A;  1LGR A;  1HTQ A;  3ZXR A;  4S0R A;  4HPP A;  1FPY A;  3NG0 A;  1F52 A;  2D3A A;  1HTO A;  4ACF A;  2LGS A;  3ZXV A;  4LNN A;  4LNF A;  1F1H A;  2D3C A;  2WHI A;  4XYC A;  2OJW A;  2WGS A;  4S17 A;  2BVC A; 
#chains in the Genus database with same CATH topology
 3B6R A;  1T0S C;  5EDS A;  1E5W A;  3E9S A;  1YNT E;  2KC2 A;  4NNJ B;  2WU5 B;  2LWP A;  5JHB A;  1XQQ A;  2BYF A;  3AV8 A;  4LJO B;  3RT3 B;  2BYV E;  1P0R A;  1MVK A;  1M4V A;  2ZPN A;  1A70 A;  2Y5B B;  1VZ6 A;  4LK0 M;  3VDZ A;  2HTM E;  4AP4 C;  2NCN A;  1F77 A;  3Q3F A;  1XF5 L;  1GPX A;  1KH0 A;  3M3J A;  3SDL C;  2W3S A;  4EZJ A;  2RSU A;  3KYD D;  1HTQ A;  3AEB B;  3J9C A;  4EFO A;  1WRD B;  1C4A A;  4RCO A;  2AQ3 B;  4USA A;  4KDI C;  3VR9 B;  1HZ6 A;  3IAM 1;  2J0M A;  4M0W B;  3AE1 B;  4Z9M A;  2W9N A;  4RMA A;  4BZA A;  2LGX A;  3TSS A;  1J7C A;  3P63 A;  5HG2 A;  4FUL A;  2KWV B;  1OEY J;  3NZS A;  2M19 A;  1UF0 A;  1IP9 A;  1XO3 A;  3U30 A;  5E6N A;  3DBR I;  2LGD A;  3T9L A;  4RF8 A;  2JQR B;  5AEK B;  4ICU A;  4AM1 A;  3TEY A;  2INN E;  1YX6 B;  2N9X A;  3U7D A;  1J19 A;  2X8X X;  4HPL B;  3KVF B;  1TS5 A;  4E71 A;  1FNU A;  3AED B;  2E6X A;  3BII D;  2INC C;  1R4N B;  1Z2M A;  3B2G A;  4P7I A;  1N62 A;  4P1C C;  2MLB A;  3UIP B;  4HRS A;  4BBN F;  5HHD G;  2BS2 B;  3M62 B;  1R8G A;  4IW0 A;  1JWS D;  3AB5 A;  4B95 A;  2JYE A;  2KDB A;  2BQQ A;  4LLG M;  4A55 A;  3ZTC A;  1HXY D;  4GDL A;  1I4X A;  2CU1 A;  1B1Z A;  5H8Y E;  1V9J A;  4ZRJ A;  4MGZ E;  3SD5 A;  1F2R I;  1PFD A;  2MBO A;  2JXT A;  3PV1 A;  3MC0 B;  2FBW B;  1YJJ A;  2D3A A;  4L1B A;  4GN1 A;  3MC8 A;  1UGM A;  5LXI B;  1XLN A;  2WHI A;  1JQ4 A;  3HK0 A;  1ZKH A;  3LVV A;  2J53 A;  5CX3 A;  1MFW A;  3IAS 1;  3B1L X;  2D11 A;  3OWE B;  2J1Q A;  2BWE S;  2RD0 A;  1JRO A;  1X1M A;  3GB1 A;  2YLM A;  2DYB A;  2WLB A;  4C4V A;  3DBL B;  3HM6 X;  1ISN A;  4C4V B;  2JYT A;  5J17 A;  1FNV A;  1E9M A;  2DEN B;  2H89 B;  4RF9 A;  4W9J A;  1L0Y B;  3ZVV A;  4MAC A;  3EUB 2;  3BK2 A;  2IBI B;  4LDT B;  2VRR B;  1SXT A;  1L0V B;  4HPP A;  4XX5 A;  5EE0 A;  5EE9 A;  4PS3 A;  1C78 A;  4ZHO A;  3RZW C;  1OTR B;  1V1P A;  4K3C A;  3W9C B;  1WM2 A;  3WAM A;  1N60 A;  3FC4 A;  2KOX A;  2WDQ B;  2C7N B;  1WYW B;  5C1Z A;  2KTR A;  3Q3O C;  3DHH C;  4MH8 A;  4YTM B;  2KAJ A;  4WAA A;  4PT5 A;  2A4Z A;  2LUE A;  4W9G A;  1WZ3 A;  3APD A;  4WUR A;  4RF6 A;  3L2E A;  5AZF A;  1FNW A;  1XXG A;  3SR6 A;  3H8H A;  2PVO D;  3MP9 A;  3DRB A;  3VUY A;  2BT6 A;  1QLB B;  1FEH A;  2AWT A;  3KUC B;  3QAR A;  2QIL A;  1JW9 D;  2MJ3 A;  4ANW A;  3UQB A;  3JQ3 A;  1FD6 A;  1TY2 A;  1XCT L;  3GZN B;  1IYF A;  4MM3 A;  2BS4 B;  1WGR A;  1U6R A;  3PRE A;  1CJE A;  3QQ8 B;  1ESF A;  1WGY A;  3U7Z A;  4Q2R A;  2IO1 B;  2MBQ A;  3N3K B;  4XGA B;  3LYY A;  4REZ A;  1KF6 B;  3L17 A;  2Z59 B;  3DBR B;  4DHZ E;  2G9H D;  2K1F A;  2N7E A;  1SBB B;  2MEK A;  2WGS A;  4RF7 A;  5E6O A;  1OQY A;  3MTN B;  3ZO5 B;  3DVG Y;  2B76 B;  3DWG C;  1UH6 A;  4IC7 B;  1VRA B;  1J8C A;  3I9V 1;  4IM2 A;  4YXD B;  2GRI A;  1QZE A;  2AQ1 B;  1GB1 A;  3DHG C;  5AZH A;  1SJE D;  3O65 B;  2RDH A;  3B9J A;  3W5V B;  4ZOH C;  1ZP0 B;  1F1H A;  1GNU A;  1WXA A;  1YN5 A;  3DQV A;  3VXW A;  3M95 A;  3P4S B;  2AL3 A;  4WQM A;  3Q8F A;  3TIX A;  2D10 A;  2PE6 B;  2LZ6 A;  1WGK A;  2NTT A;  3ZYY X;  2Z8L A;  5EE1 A;  2QJL A;  4GDL B;  2XEW A;  1WGD A;  5J18 A;  2EKI A;  1V4G A;  3ZKJ C;  1E7P B;  1DGJ A;  3CST A;  5AZG A;  2JUO A;  1KOT A;  1L7Y A;  2JZ3 B;  3BVM A;  2PPH A;  2XBB C;  4G0N B;  2NS5 A;  1MG4 A;  4KKJ A;  3Q8B A;  4S17 A;  2BVC A;  2O6V A;  4WIP A;  2KVR A;  1QOF A;  1V49 A;  5DCN A;  4XE0 A;  2KQ7 A;  1AYF A;  2LAS A;  1V2Y A;  2LXC A;  2NMQ A;  2ZEQ A;  1RRB A;  5HFY A;  3WIM A;  3VHT C;  1V81 A;  1KTK A;  2V4I B;  4FBJ B;  2E3T A;  4GOC A;  4B9K A;  3HVD A;  2K9X A;  4YSX B;  4KX6 B;  2BKR B;  2PVG C;  1HE8 A;  2W3R A;  2IO2 B;  1WXS A;  3JSV B;  4N59 A;  1QOA A;  2WXQ A;  1ROE A;  1KLV A;  2KJH B;  3CIR B;  4GU2 A;  4OZC A;  3OJ4 B;  2LGI A;  2N7D A;  2KAN A;  3NZT A;  1ENF A;  1SE4 A;  2NTS A;  1V86 A;  4XDC A;  3BVG A;  2L0F A;  3CMM B;  3ALB A;  2W54 A;  4JX1 C;  5BMG A;  3IHP C;  1J7A A;  1U4A A;  2DLB A;  3C8Y A;  1QOG A;  2OOB B;  2MJD A;  2WXL A;  4N58 A;  1P52 A;  3ZW3 A;  3KUD B;  2KMA A;  1VZ7 A;  4DHJ B;  3CF6 E;  1D3Z A;  4LNI A;  4AUQ C;  3AM9 A;  1R4N I;  3FAH A;  3AE4 B;  3PLV A;  1ZDX A;  3ZRF A;  4YSZ B;  3Q3J A;  1EWC A;  4RGO S;  1ACC A;  2RDG A;  2GBN A;  1EWY C;  2L3Z A;  2WXJ A;  3S2A A;  1KJT A;  3V05 A;  1AWD A;  2G4S A;  4NJ7 A;  2KQS A;  3DBH B;  2KHW B;  3APF A;  2N4F A;  1WZ0 A;  1TGZ B;  4US8 A;  4C7Y A;  1UNS A;  4JWS C;  2O2V B;  4RM8 A;  3V61 A;  2V3P A;  1SE2 A;  2I1J A;  4S0R A;  2ZPY A;  2PMV A;  4I6N B;  4H2A A;  4EZL A;  3NZU A;  1WI0 A;  2M0X A;  4RGT A;  3UI3 A;  1WGG A;  3AE3 B;  3A9J A;  4C56 C;  1MI0 A;  2HDE A;  2N9E B;  3A4R A;  1I0E A;  3PS6 A;  1MHX A;  2PLP A;  3VTW A;  4HDQ A;  3FKY A;  4RGN A;  1GJZ A;  3PZ8 A;  4NPN A;  2CKH B;  1EU4 A;  2CHW A;  4MGI E;  1K8R B;  2MCN B;  4HEA 1;  2K6D B;  2WXK A;  1P50 A;  3B2F A;  1SEB D;  2JXX A;  1TKE A;  1VR9 A;  2KYW A;  1AAR A;  4AJW A;  2KJR A;  2O6V D;  2LRU A;  2M8S A;  3ZXR A;  3P4R B;  3PPA A;  3ZIM A;  5D94 A;  4ZYS A;  3LXF A;  1C79 A;  1N6Z A;  1FFV A;  3W2D A;  4BG4 B;  2MH7 A;  3QAQ A;  3QX1 A;  3L16 A;  2N9K A;  1PYW D;  4FJZ A;  5CHF A;  5JH5 C;  4ZRP A;  3ZJU A;  4W9D A;  3ONS A;  1MG8 A;  3UGB B;  3T3N A;  4WAF A;  3UQA A;  3AEG B;  3WAP A;  1FMA D;  2ZCC A;  3QHT A;  4F7Z A;  5IAA C;  1TTN A;  5CTR C;  3VAW A;  4BKT A;  3RFZ B;  3JYU A;  1C1Y B;  3APC A;  2N0S B;  1TIF A;  3RZF A;  4KDL B;  4ZYN A;  4W9K A;  3PZ7 A;  5DPR A;  3I3T B;  3DCG A;  4IG7 B;  2NBU A;  2K22 A;  1QF6 A;  1WX9 A;  2EMS A;  5C2T B;  2K8C A;  2WNM A;  3JSV A;  2KNB A;  2DNF A;  2EMT A;  3EFU A;  1V97 A;  1WR6 E;  2XNA C;  3GP7 A;  3QK0 A;  4WH4 A;  3TUO A;  5D7G A;  5I4D A;  1FRD A;  4NQL B;  4HXD A;  4FHK A;  2FID A;  2WP9 B;  3U2S C;  5JZE B;  3P2B A;  3RNC C;  3ZLZ A;  4A3O A;  4P16 A;  1C77 A;  1JWA D;  2V3N A;  2BGF A;  3RUL A;  4I6P A;  2Y5C A;  2O6V B;  5E6P A;  4FN2 A;  2FUH B;  3N30 A;  3I57 A;  2WWZ A;  2Y3A A;  3L0W B;  4MGY E;  2KDF B;  3VRB B;  1WMH A;  2M17 A;  3V6E B;  4M02 A;  1PGA A;  3PRM B;  4IOI E;  4A8X C;  4ZRI A;  1CQV A;  4XWT A;  4R3D A;  2FNJ B;  2KJ6 A;  1KRH A;  1M94 A;  1GC7 A;  1BT0 A;  1NYQ A;  1VCB A;  1YD8 U;  2LRW A;  4K7U A;  3AUL A;  1YIW A;  3RN9 C;  1CMX B;  4G11 A;  2JY6 A;  4JE3 B;  4GVY A;  1CRK A;  3ZJV A;  3AXC A;  2ACZ B;  1KFY B;  2HE7 A;  2M56 B;  3P4Q B;  3MJ5 A;  4XYC A;  2MBE A;  1FXA A;  4BKS D;  3R8B A;  4GDK B;  4HKZ E;  5D2M B;  5LNK 1;  4RNA A;  3P1M A;  3DHI C;  1JWB D;  1RLF A;  3FIL A;  2L83 A;  2YEP F;  3LJ3 A;  3R3M A;  4DXA B;  3Q8E A;  3M63 B;  2X38 A;  1MJD A;  2HJ8 A;  3C0R B;  1V6E A;  2KTF A;  2WDT B;  3DOW A;  1I4Q A;  1NEK B;  2WXF A;  4OW0 A;  2WXI A;  3A9K A;  4M01 A;  3B0A A;  2RPQ A;  1TZ1 A;  3AE9 B;  2L05 A;  1VZ8 A;  3IFW B;  4JL9 A;  3H9D A;  1YQB A;  1UBI A;  3O13 A;  1PGB A;  1HEZ E;  4A3P A;  3TEW A;  2JRI B;  1WFY A;  2NPT B;  4KVG B;  1Y56 A;  3NG0 A;  3DWM A;  2WDV B;  5G5H A;  3TEZ A;  4IM0 A;  2GOW A;  1SE3 A;  2D33 A;  3EC8 A;  4CQN A;  1L6V A;  2FUG 1;  3AEC B;  2KKC A;  1WYG A;  2GBK A;  4W9C A;  2C5L C;  2LVO A;  4ANU A;  1WJ4 A;  2CHZ A;  2ICI A;  4BVU C;  3IT6 B;  3L2E B;  3HM3 A;  2PW9 A;  3SFE B;  3AN1 A;  3WCQ A;  1TKY A;  1D5M C;  2BBC A;  5DPW A;  4DHJ D;  2J0K A;  3P4P B;  2N1W A;  3R2T A;  2SAK A;  2MSE D;  3NVZ A;  1P1A A;  2N7J A;  4CHK A;  2CJO A;  3N1Z C;  5D3I B;  4DQO C;  3VTU A;  5L95 C;  2BB5 A;  4EE2 A;  3QIJ A;  3UIO B;  2GBR A;  1G0W A;  2OJR A;  4NAW A;  4IDI A;  3BY4 B;  1FPY A;  5IN7 A;  2KWD A;  2KDE B;  2V9H A;  2QSD A;  1I35 A;  4KIK B;  2L52 A;  1GG3 A;  2K3U A;  5IP4 D;  3PT2 B;  4JLC A;  1DOY A;  4KV2 A;  5FR3 A;  1EUV B;  2NBV B;  5BMI A;  1YX5 B;  2RMM A;  2LJ5 A;  1IGD A;  3PO0 A;  2GBJ A;  2QMT A;  2GBM A;  3PRP B;  1YQ3 B;  3ML8 A;  3SFD B;  2R2O A;  1T3Q A;  4IWO A;  3R66 C;  3MC9 A;  4HJK A;  2JWZ A;  3LDZ E;  3U4E G;  1QIL A;  5BYQ A;  3RYT A;  1SIF A;  4P1B C;  1L2N A;  1FRR A;  3L4P A;  1YQ4 B;  3A1Q B;  2KO3 A;  2V0G A;  2KN5 A;  3JVZ X;  3L54 A;  2Q5W D;  4HCN B;  4DWF A;  1P7E A;  2PE9 A;  3HUI A;  2ZCB A;  2LD9 A;  2PIA A;  5KHQ A;  4HRO A;  2D5G A;  2KK8 A;  4AJY B;  3PSE B;  2DZK A;  2DBY A;  3LVW A;  1WWT A;  1K50 A;  3ZDM C;  4BFR A;  3AE6 B;  4YSY B;  1D5X C;  4HLE A;  4ARI A;  3NY5 A;  1WRI A;  2YVC A;  2KFK A;  1BUI C;  4DXG A;  2LHD A;  1L4D B;  3PLU A;  2WXH A;  4ZDV A;  2MRP A;  1E8Z A;  3DVG X;  2VZK D;  2JZZ A;  3ZNI D;  1ZDV A;  5IO9 A;  3N9Y C;  1SF0 A;  1FM0 D;  1ET6 A;  3ZQ4 A;  1K53 A;  4GW2 A;  3T8M A;  1IBX B;  2CU3 A;  2LMC A;  3N1X C;  2VZK B;  2MBB B;  3OJ3 A;  1ET9 A;  2K8B A;  2KX3 A;  1OEY A;  2IND C;  3BIN A;  4GXB A;  4BAX A;  2FE8 A;  2KTR B;  1E7V A;  4K3B A;  3Q3N C;  3JPZ A;  3HVZ A;  2BS3 B;  3UIN B;  2J52 A;  1I4P A;  1L4Z B;  2NR2 A;  1DOX A;  1K51 A;  4UDU C;  2BTE A;  5G55 A;  3AEA B;  2INP E;  3DBH I;  1OQR A;  2BWF A;  2IYD B;  3RNE C;  2J42 A;  2WYQ A;  3LN7 A;  1UWM A;  2LJI A;  1IPG A;  2KWU B;  4RF1 A;  1SD0 A;  2I2Y A;  4MJS A;  3AU5 A;  4BOS C;  4LNN A;  4TUU A;  1EM7 A;  4MSQ B;  3ZRC A;  4E3C A;  1D5Z C;  1BML C;  3D32 A;  3U52 E;  3ZGZ A;  4N9F 4;  1VRP A;  2LUM A;  2K6Q A;  3HIZ A;  2QC8 A;  3LB8 C;  1FFU A;  2KN4 A;  2HJ1 A;  2V3S A;  3BVZ A;  1LGR A;  3ZUN A;  4W9H A;  3KLS X;  3X0W A;  1E8X A;  3AE2 B;  3U8Z A;  2ZVN A;  1ZOY B;  1WR1 A;  3DPD A;  5IA7 A;  4WJN A;  3TL5 A;  4P6V F;  4WJO A;  2PTL A;  2K0P A;  3UF8 A;  4DXF A;  2O2V A;  2MHJ A;  3X23 A;  1JCK B;  4G3X B;  3DDC B;  1VD2 A;  1R7S A;  2N9L A;  2WXO A;  3ZXV A;  3ECI A;  1VLB A;  1IBX A;  1TT4 A;  5H92 C;  4WWM A;  4X57 B;  2AYO B;  5G5G A;  1UGJ A;  4GB9 A;  4AS1 A;  1QK1 A;  1EU3 A;  2IGD A;  2IGH A;  4NQK E;  1OFF A;  1I7H A;  1HTO A;  2C9W B;  4ACF A;  3KW5 B;  3R7R A;  1V5O A;  1ZUD 2;  4EOY A;  4KGR A;  1TS2 A;  4LTU A;  1IGC A;  2L76 A;  2BKF A;  4GSW A;  3TEX A;  1RFK A;  2OJW A;  3PHX B;  2Y5P A;  3DBL I;  5KHO A;  4KGT A;  2PJH A;  5AUK A;  2D07 B;  2MX2 A;  2LEK A;  2ZVO A;  3TBL D;  5T8I A;  3RD2 A;  4II2 B;  1DYQ A;  2BYT A;  3AEE B;  3P42 A;  2AQ2 B;  3V60 A;  1RWS A;  4ICV A;  3WAN A;  1E6E B;  1LQB A;  4IKG A;  4MSM B;  1CK1 A;  1JRU A;  3WAL A;  3VFK A;  4XC2 A;  4KSL C;  4DBG A;  3KUZ A;  1EO6 A;  2KZR A;  3GOE A;  3DBS A;  1HA5 A;  4LJP B;  2DYM A;  3BZD B;  2LGS A;  4HKQ A;  4Q2J A;  1L0X B;  4GIV A;  1FIQ A;  3VVW B;  4FXC A;  3PGE A;  4PS7 A;  2W55 A;  3ETR A;  2IDY A;  2KVZ A;  4ZHP A;  5DPS A;  1T0Q C;  1MHH E;  3NVY A;  3SU8 X;  2ON8 A;  3MFG A;  1QOB A;  2KT7 A;  5MPO A;  5J99 A;  2JZP A;  1TJE A;  2RPV A;  1FXT B;  1RFA A;  3IVF A;  4ZRK A;  1SSN A;  4C80 A;  1M15 A;  1E8W A;  2ZZP B;  4FJV B;  2WXR A;  1C3T A;  4C00 A;  4PS8 A;  2K25 A;  3JU6 A;  1WE7 A;  4ITK A;  3EA6 A;  3IT4 B;  4HPM B;  1STE A;  4WWO A;  3AMZ A;  2AEH A;  4K81 A;  2A5U A;  1LFD A;  1P9D U;  4HVB A;  4B0E A;  1P3Q U;  1V8C A;  4GLS C;  1UWX A;  2K8H A;  1Q10 A;  3DVN V;  1XLQ A;  2CR5 A;  3Q14 C;  1BXT A;  4I6L B;  3VUW A;  1KLU D;  1QKZ A;  3IG3 A;  1C76 A;  1YJI A;  1XT9 B;  2WXM A;  1WY8 A;  2DAJ A;  1FCL A;  1FXI A;  2KDI A;  3HRD D;  1HQR D;  1WJN A;  2QHO A;  1J7B A;  4QAY A;  2QIE B;  3Q3M C;  4ARC A;  2RR9 A;  2BPS A;  1CZP A;  4A20 A;  4KZ0 A;  4DDI D;  3MJW A;  3Q2A C;  5D6J B;  4LNK A;  2IPK D;  1GB4 A;  1JRP A;  4RM9 A;  3SEB A;  2JX5 A;  4FHJ A;  1LO5 D;  4PK1 A;  5EE3 A;  1C4C A;  3KQ4 A;  2ZW1 A;  1B9R A;  2CS4 A;  5IKC M;  3L08 A;  1WXM A;  2GMI C;  2RDB C;  4JGH B;  4IM3 A;  2J4X A;  2GLS A;  4JQW C;  1F0Z A;  3AE8 B;  3Q8C A;  4HDO A;  4ASW C;  3DRE A;  4JIO U;  5FR6 A;  3VQI A;  4AOF A;  3N32 A;  2G4D B;  1VDV A;  4YT0 B;  2VH1 A;  3EFC A;  2KC1 A;  3OLM D;  4PYU A;  3JU5 A;  1BG0 A;  3AU4 A;  1G6J A;  3NJT A;  3EEC A;  4MT5 A;  3RNG C;  3QWZ B;  4FLH A;  2FCN A;  3H1U A;  4MEL A;  1TS4 A;  1AW7 A;  3R2I A;  4E74 A;  1SIJ A;  3RCZ A;  2LFI A;  4LCD E;  5J9A A;  1NDD A;  4BKS A;  4BKG A;  2Z0D B;  5LLI A;  1WX8 A;  4MEM A;  1XLO A;  2GWD A;  3NUH B;  2KFK B;  3NZ3 A;  1V1P B;  3ZNZ B;  1I4H A;  3RUI B;  1C9F A;  4A9A A;  2G1E A;  5G2N A;  1UBQ A;  1WXQ A;  4CO7 A;  3VRA B;  2R2Q A;  1OGW A;  1E10 A;  1WSP A;  1WIA A;  2FCS A;  4WWP A;  2D3G A;  2LXA A;  2CRK A;  3RI7 C;  2IO3 B;  2WS3 B;  5C3J B;  3OG5 A;  2KX0 A;  4OVZ A;  2FCM A;  4G50 A;  4HCP B;  1TS3 A;  2FCQ A;  3QA8 A;  3V6C B;  4RGM A;  2K5P A;  1Q1O A;  4A6Q A;  2NVU I;  3NHE B;  2L0T A;  3E56 A;  1N5W A;  2PEA A;  1QQR A;  2L32 A;  2JSV X;  2JF5 A;  4IWP A;  1TT5 B;  4NJC A;  2QEJ C;  1K52 A;  3A9J B;  1OQQ A;  1UUP A;  3GE8 C;  3VTV A;  1V5T A;  4K7S A;  2D32 A;  3RPF C;  4FA6 A;  2Z0E B;  5AUI A;  4PYZ A;  4NJ6 A;  1IUE A;  2WX1 A;  3ZTD A;  3RNB C;  5HI1 A;  4AWJ A;  2KWC A;  5FKA C;  1ZXH A;  3AI5 A;  4US9 A;  2TSS A;  2JWU A;  3Q6B A;  1TKG A;  5DPT A;  4GGQ A;  5JHA A;  2XK5 A;  4FJY A;  1YN3 A;  2M0A A;  2ASQ A;  2VH2 A;  1H4R A;  2N9P C;  3VUX A;  1D6E C;  1Y8R C;  4GW0 A;  2C7H A;  3ML9 A;  1D4B A;  1JAL A;  1Q5W B;  5GXG B;  3VH4 B;  2GB1 A;  4WJP A;  2PKO A;  2J7Q B;  2CHX A;  2G3Q B;  2DZI A;  1LM8 B;  2EKE C;  2JRH A;  1WF9 A;  2C7M B;  4J6I A;  1T5X D;  1WE6 A;  2KD0 A;  2DYO A;  2L7R A;  4RH6 A;  3NVW A;  2LHE A;  3A9K B;  4MM3 B;  2KLC A;  1ZPS A;  2AL6 A;  1L5P A;  2UU7 A;  1WM3 A;  1PQS A;  2JPH A;  4WQO B;  1P98 A;  2MW5 A;  1NBF C;  1TYG B;  4EUT A;  2MJE A;  4ANV A;  1GAQ B;  2IGG A;  3PZD A;  3RNA C;  3VH3 B;  3QC8 B;  4GVZ A;  2LI5 A;  3KWV A;  2H88 B;  1UEL A;  3WAO A;  2KQ4 X;  1J0G A;  4HWI B;  3I63 C;  3QCA A;  5HKH A;  1C4P A;  3TJP A;  2D2Q A;  5CHW A;  4TQ0 A;  1A5R A;  1SGH A;  2KXJ A;  3L2D A;  4AQ7 A;  4DK5 A;  1S3S G;  1WJ6 A;  5LXH A;  2KLG A;  1PDX A;  1JWU D;  5BYR A;  5TSS A;  4F8C B;  4W9E A;  2SEB D;  4HK2 A;  3TCA A;  2ZNV C;  2C60 A;  3DVN U;  2DWQ A;  3W1S C;  2ONQ A;  1NYR A;  4M8N A;  4B6W A;  1NVI D;  4HJG E;  3L13 A;  1VA6 A;  2M4N A;  1ZE3 D;  4OHJ A;  2KDM A;  1DOI A;  4II3 B;  3WA0 A;  2WQY B;  1T0R C;  1L6U A;  2IZV B;  3ZNG C;  4D2K A;  3N1Y C;  4KKI A;  1S1Q B;  3PTF C;  4IUM B;  1RM6 C;  4NAW B;  4CYE A;  1QT9 A;  1NI2 A;  4K7W A;  4A90 A;  3BWU D;  5J2R A;  3H7S A;  1LXD A;  4MJS B;  4TSS A;  3MHZ A;  2DHZ A;  1Q0W B;  3GZN I;  2BF8 B;  1E8Y A;  3RMK C;  2YEP B;  2I1K A;  4KGS A;  1WJU A;  2MQJ A;  1WX7 A;  2LGY A;  4BBN C;  2WU2 B;  2L00 B;  4FAD A;  1RAX A;  1VJK A;  2V1Y A;  4OVV A;  2WXN A;  2L8J A;  4GMV A;  4MH0 E;  1P7F A;  4DHZ B;  1Z5S B;  3KYC D;  1TBE A;  4EEW A;  1SJH D;  1WH3 A;  2HTH A;  3T3O A;  2IY0 B;  2BW2 A;  3TMP B;  2KFJ A;  1T0Y A;  2DX5 B;  4KIK A;  4N6E B;  3OAW A;  2DZJ A;  2AX5 A;  1YN4 A;  1H8C A;  1KM7 A;  2LVQ A;  4RF0 A;  4URK A;  4LNF A;  3SHQ A;  1RYJ A;  1FO4 A;  1WXV A;  3ABV B;  1QH4 A;  1GOZ A;  4TKN A;  3ZDT A;  2DAF A;  3H6N A;  5CHV C;  3KWL A;  3M10 A;  3A4S C;  3RNF C;  2B3A A;  3FIL B;  4NY0 A;  4ZRQ A;  2R61 A;  3NVV A;  5BMH A;  2M1M A;  4GDK A;  1AN8 A;  3CSF A;  3H7P A;  5FK9 C;  3IG8 A;  1NEN B;  3IXS A;  2DZM A;  2J0J A;  2FAZ A;  3ENE A;  4XZ4 A;  3A33 B;  2MWS B;  4MGK E;  2MBH A;  2JT4 B;  4W9L A;  1E0Z A;  2QDF A;  2ZNV B;  3K9O B;  4M0W A;  3MHS D;  2EEL A;  1ZXI A;  3GE3 C;  1TZO A;  1WGH A;  1MPE A;  4OZA A;  4EZK A;  1UZX B;  3BYY B;  3NS8 A;  5GMV A;  2HD5 B;  2WXG A;  1N5X A;  2WDR B;  2MP2 A;  4IWQ A;  3V3X A;  4TMA B;  4C7Z A;  4M8M A;  3W1Y A;  1R4M B;  3W5U B;  4MDK E;  3NS1 A;  4ANX A;  4YL8 A;  2WXP A;  3CWI A;  2V4L A;  3AH7 A;  4KZC A;  3IBE A;  3L10 B;  1I4R A;  2L1A A;  3QJZ A;  2BB6 A;  3PVL A;  2IY1 B;  4YWG G;  2KAC A;  5C23 A;  1F52 A;  2MP2 B;  4LDT D;  3PRZ A;  4XWW A;  3URY A;  1EF5 A;  4WJQ A;  1YOV B;  3NRZ A;  2W82 A;  3EHV A;  3Q69 A;  1SB3 C;  3KH0 A;  4TV3 A;  4BOZ B;  5IOI A;  1UD7 A;  3AE7 B;  4EKU A;  2MA9 B;  3Q8A A;  4OVU A;  4F1S A;  2KMC A;  3H7P B;  3AEF B;  3HHM A;  4BHL A;  1E90 A;  1GC6 A;  2OHF A;  2GI9 A;  5L83 A;  4O1N A;  4DDG D;  3N20 C;  1TY0 A;  2XN9 C;  3AE5 B;  1V80 A;  2IO0 B;  4WWN A;  3C19 A;  3R7Q A;  1I42 A;  1FCC C;  1HZ5 A;  1YMH E;  4NAM A;  2NPT A;  1XEE A;  2ZW0 A;  1PGX A;  3V62 A;  4XDD A;  4L2Y A;  2UYZ B;  4YTP B;  2JVC A;  4OZB A;  2ZJD A;  4NZL B;  1F2R C;  3NOB A;  5JXV A;  3I5J C;  2LVP A;  3VR8 B;  4W9I A;  1YJ1 A;  2WX0 A;  3ZJT A;  5TR5 A;  1N63 A;  4JPS A;  5BYS A;  2IJ0 A;  1GUA B;  1V1O A;  1NI3 A;  4J3O D;  2D3C A;  3GS2 A;  1RL9 A;  3BYT B;  2N1V A;  1PUT A;  3A1Q A;  2FIF A;  2CJN A;  3ZNH B;  1I4G A;  2QCZ A;  2KMM A;  3EGR A;  1ZGU B;  1ZW7 A;  5E6J A;  5D3D A;  2G45 B;  2JU6 X;  1XLP A;  5BO4 B;  2GWC A;  1KLG D;  2OED A;  2XK5 B;  4JWU C;  1JWM D;  4YTN B;  2I38 A;  3LN6 A;  2K39 A;  2RGF A;  1EF1 A;  2REX A;  2NBW B;  1R4M I;  4TQ1 A;  4K1R B;  3JW0 X;  4BG4 A;  3W1S A;  2D3B A;  3B08 A;  4LNO A;  4M00 A;  1E7U A;  1F9J A;  1SE9 A;  1XCQ L;  4B0M A;  1WMH B;  3BK1 A;  3IG5 A;  1N61 A;  1XD3 B;  3PHW B;  1T6B X;  2BYE A;  4L23 A;  4KSK C;  2UWQ A;  1JML A;  3K9P B;  4W9F A;  4RFB A; 
#chains in the Genus database with same CATH homology
 4LNI A;  3LVV A;  2QC8 A;  3LN7 A;  2GLS A;  2D3B A;  4BAX A;  2GWC A;  4LNO A;  3FKY A;  4LNK A;  2UU7 A;  1LGR A;  1HTQ A;  3ZXR A;  4S0R A;  4HPP A;  3LVW A;  1FPY A;  3NG0 A;  1F52 A;  2D3A A;  1HTO A;  3LN6 A;  1VA6 A;  4ACF A;  2LGS A;  1V4G A;  3ZXV A;  4LNN A;  2GWD A;  3IG5 A;  3NZT A;  3IG8 A;  1R8G A;  4LNF A;  1TT4 A;  1F1H A;  2D3C A;  2WHI A;  4XYC A;  2OJW A;  2WGS A;  2D33 A;  2D32 A;  4S17 A;  2BVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...