3JU6A

Crystal structure of dimeric arginine kinase in complex with amppnp and arginine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
369
structure length
361
Chain Sequence
b'ANLNQKKYPAKDDFPNFEGHKSLLSKYLTADMYAKLRDVATPSGYTLDRAIQNGVDNPDFHLGLLAGDEETYTVFADLFDPVIEEYHNGFKKTDNHKTDLDASKILDDVLDPAYVISSRVRTGRNIRGMALSPHVCRSERRAIEKMVSEALNSLAADLKGKYYSLMKMDEKTQQQLIDDHFLFDRPVSRHFTSGGMARDFPDGRGIWHNDKKNFLVWINEEDHTRIISMQMGGNMKEVFERFTRGLTEVEKHIKDKTGKEFMKNDHLGFVLTCPSNLGTGVRCSVHAKLPHMAKDKRFEEICTKMRLQKRGTGGVYDISNLDRLGSSEVEQVNCVIKGVKVLIEMEKKLEKGESIDDLVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine kinase
publication title Structural basis for a reciprocating mechanism of negative cooperativity in dimeric phosphagen kinase activity
pubmed doi rcsb
source organism Apostichopus japonicus
molecule tags Transferase
total genus 112
structure length 361
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3ju6A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3ju6A02
1P50A 3JQ3A 4RF7A 3B6RA 1G0WA 3ZXRA 4LNNA 4XYCA 4GW2A 5J9AA 4RF9A 3L2EA 3ZXVA 4Q2RA 1I0EA 1QK1A 4GVYA 3NG0A 1M15A 1F52A 2GLSA 3L2DA 4BG4A 2WGSA 5J99A 1HTQA 1F1HA 4RF6A 1BG0A 3M10A 4S0RA 3JU6A 1CRKA 4HPPA 3JU5A 4GVZA 4LNIA 3L2EB 3DRBA 3JPZA 1LGRA 1HTOA 4Z9MA 1FPYA 4LNKA 1QH4A 4BHLA 1P52A 1RL9A 4S17A 4ACFA 4BG4B 1SD0A 4LNFA 2WHIA 1VRPA 4RF8A 2BVCA 4LNOA 1U6RA 2CRKA 3DREA 4GW0A 4AM1A 2J1QA 2LGSA
chains in the Genus database with same CATH superfamily
3JQ3A 3B6RA 1G0WA 2GWCA 1M15A 2D3BA 1R8GA 5J99A 1CRKA 2GWDA 1HTOA 1VA6A 1QH4A 3LVWA 2BVCA 3LN7A 4RF7A 2OJWA 1TT4A 3NZTA 4LNNA 5J9AA 4RF9A 4BG4A 2WGSA 1F1HA 3M10A 1V4GA 3JU6A 3LN6A 3JU5A 2D3CA 4S17A 4ACFA 1SD0A 4LNFA 1VRPA 2D32A 3DREA 2CRKA 4GW0A 2LGSA 3IG8A 4XYCA 4GW2A 3L2EA 3ZXVA 4Q2RA 1I0EA 1QK1A 4GVYA 2GLSA 3L2DA 1HTQA 4GVZA 4LNIA 3L2EB 4Z9MA 1FPYA 4BHLA 1P52A 1RL9A 3IG5A 4BG4B 2WHIA 2J1QA 1P50A 3ZXRA 3NG0A 1F52A 4BAXA 2D33A 4RF6A 3LVVA 1BG0A 4S0RA 4HPPA 2D3AA 3DRBA 3JPZA 1LGRA 4LNKA 3FKYA 4RF8A 4LNOA 1U6RA 4AM1A 2QC8A 2UU7A
chains in the Genus database with same CATH topology
1P50A 3JQ3A 4RF7A 3B6RA 1G0WA 3ZXRA 4LNNA 4XYCA 4GW2A 5J9AA 4RF9A 3L2EA 3ZXVA 4Q2RA 1I0EA 1QK1A 4GVYA 3NG0A 1M15A 1F52A 2GLSA 3L2DA 4BG4A 2WGSA 5J99A 1HTQA 1F1HA 4RF6A 1BG0A 3M10A 4S0RA 3JU6A 1CRKA 4HPPA 3JU5A 4GVZA 4LNIA 3L2EB 3DRBA 3JPZA 1LGRA 1HTOA 4Z9MA 1FPYA 4LNKA 1QH4A 4BHLA 1P52A 1RL9A 4S17A 4ACFA 4BG4B 1SD0A 4LNFA 2WHIA 1VRPA 4RF8A 2BVCA 4LNOA 1U6RA 2CRKA 3DREA 4GW0A 4AM1A 2J1QA 2LGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P50 A;  3JQ3 A;  4RF7 A;  3B6R A;  1G0W A;  3ZXR A;  4LNN A;  4XYC A;  4GW2 A;  5J9A A;  4RF9 A;  3L2E A;  3ZXV A;  4Q2R A;  1I0E A;  1QK1 A;  4GVY A;  3NG0 A;  1M15 A;  1F52 A;  2GLS A;  3L2D A;  4BG4 A;  2WGS A;  5J99 A;  1HTQ A;  1F1H A;  4RF6 A;  1BG0 A;  3M10 A;  4S0R A;  3JU6 A;  1CRK A;  4HPP A;  3JU5 A;  4GVZ A;  4LNI A;  3L2E B;  3DRB A;  3JPZ A;  1LGR A;  1HTO A;  4Z9M A;  1FPY A;  4LNK A;  1QH4 A;  4BHL A;  1P52 A;  1RL9 A;  4S17 A;  4ACF A;  4BG4 B;  1SD0 A;  4LNF A;  2WHI A;  1VRP A;  4RF8 A;  2BVC A;  4LNO A;  1U6R A;  2CRK A;  3DRE A;  4GW0 A;  4AM1 A;  2J1Q A;  2LGS A; 
#chains in the Genus database with same CATH topology
 3JQ3 A;  3B6R A;  1G0W A;  2GWC A;  1M15 A;  2D3B A;  1R8G A;  5J99 A;  1CRK A;  2GWD A;  1HTO A;  1VA6 A;  1QH4 A;  3LVW A;  2BVC A;  3LN7 A;  4RF7 A;  2OJW A;  1TT4 A;  3NZT A;  4LNN A;  5J9A A;  4RF9 A;  4BG4 A;  2WGS A;  1F1H A;  3M10 A;  1V4G A;  3JU6 A;  3LN6 A;  3JU5 A;  2D3C A;  4S17 A;  4ACF A;  1SD0 A;  4LNF A;  1VRP A;  2D32 A;  3DRE A;  2CRK A;  4GW0 A;  2LGS A;  3IG8 A;  4XYC A;  4GW2 A;  3L2E A;  3ZXV A;  4Q2R A;  1I0E A;  1QK1 A;  4GVY A;  2GLS A;  3L2D A;  1HTQ A;  4GVZ A;  4LNI A;  3L2E B;  4Z9M A;  1FPY A;  4BHL A;  1P52 A;  1RL9 A;  3IG5 A;  4BG4 B;  2WHI A;  2J1Q A;  1P50 A;  3ZXR A;  3NG0 A;  1F52 A;  4BAX A;  2D33 A;  4RF6 A;  3LVV A;  1BG0 A;  4S0R A;  4HPP A;  2D3A A;  3DRB A;  3JPZ A;  1LGR A;  4LNK A;  3FKY A;  4RF8 A;  4LNO A;  1U6R A;  4AM1 A;  2QC8 A;  2UU7 A; 
#chains in the Genus database with same CATH homology
 1P50 A;  3JQ3 A;  4RF7 A;  3B6R A;  1G0W A;  3ZXR A;  4LNN A;  4XYC A;  4GW2 A;  5J9A A;  4RF9 A;  3L2E A;  3ZXV A;  4Q2R A;  1I0E A;  1QK1 A;  4GVY A;  3NG0 A;  1M15 A;  1F52 A;  2GLS A;  3L2D A;  4BG4 A;  2WGS A;  5J99 A;  1HTQ A;  1F1H A;  4RF6 A;  1BG0 A;  3M10 A;  4S0R A;  3JU6 A;  1CRK A;  4HPP A;  3JU5 A;  4GVZ A;  4LNI A;  3L2E B;  3DRB A;  3JPZ A;  1LGR A;  1HTO A;  4Z9M A;  1FPY A;  4LNK A;  1QH4 A;  4BHL A;  1P52 A;  1RL9 A;  4S17 A;  4ACF A;  4BG4 B;  1SD0 A;  4LNF A;  2WHI A;  1VRP A;  4RF8 A;  2BVC A;  4LNO A;  1U6R A;  2CRK A;  3DRE A;  4GW0 A;  4AM1 A;  2J1Q A;  2LGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...