3JU6A

Crystal structure of dimeric arginine kinase in complex with amppnp and arginine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
369
structure length
361
Chain Sequence
ANLNQKKYPAKDDFPNFEGHKSLLSKYLTADMYAKLRDVATPSGYTLDRAIQNGVDNPDFHLGLLAGDEETYTVFADLFDPVIEEYHNGFKKTDNHKTDLDASKILDDVLDPAYVISSRVRTGRNIRGMALSPHVCRSERRAIEKMVSEALNSLAADLKGKYYSLMKMDEKTQQQLIDDHFLFDRPVSRHFTSGGMARDFPDGRGIWHNDKKNFLVWINEEDHTRIISMQMGGNMKEVFERFTRGLTEVEKHIKDKTGKEFMKNDHLGFVLTCPSNLGTGVRCSVHAKLPHMAKDKRFEEICTKMRLQKRGTGGVYDISNLDRLGSSEVEQVNCVIKGVKVLIEMEKKLEKGESIDDLVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a reciprocating mechanism of negative cooperativity in dimeric phosphagen kinase activity
pubmed doi rcsb
source organism Apostichopus japonicus
molecule tags Transferase
molecule keywords Arginine kinase
total genus 112
structure length 361
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3ju6A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3ju6A02
1BG0A 1QH4A 1F52A 1FPYA 2BVCA 4LNKA 1LGRA 4AM1A 3L2DA 3JQ3A 3JPZA 1G0WA 1VRPA 4XYCA 4BG4A 1SD0A 5J99A 1M15A 1P52A 1QK1A 4GVYA 4ACFA 3L2EA 3ZXRA 1HTOA 1F1HA 3L2EB 3M10A 1CRKA 1RL9A 3B6RA 4BG4B 4GVZA 1P50A 3DREA 3JU5A 1HTQA 1I0EA 2CRKA 4HPPA 4RF6A 5J9AA 4RF7A 4LNIA 3JU6A 4LNNA 3NG0A 3DRBA 4GW2A 3ZXVA 4LNFA 2J1QA 4S17A 4Z9MA 4RF8A 4LNOA 1U6RA 2GLSA 4RF9A 2WHIA 4S0RA 4GW0A 2LGSA 2WGSA 4Q2RA 4BHLA
chains in the Genus database with same CATH superfamily
1BG0A 3LN7A 4LNKA 4AM1A 3JPZA 1M15A 1P52A 1HTOA 1VA6A 1CRKA 4BG4B 2OJWA 3JU6A 3DRBA 2D33A 4Z9MA 1U6RA 2WHIA 4GW0A 1LGRA 3L2DA 3LVWA 1SD0A 3NZTA 1QK1A 4GVYA 3ZXRA 2D3AA 3M10A 3B6RA 4GVZA 3DREA 1HTQA 1I0EA 4HPPA 4RF6A 4GW2A 2D32A 2GWDA 4LNOA 2UU7A 4RF9A 4S0RA 4Q2RA 1F52A 1QH4A 1FPYA 2BVCA 3LN6A 3JQ3A 3LVVA 1VRPA 4BG4A 5J99A 4ACFA 1F1HA 3JU5A 2CRKA 4LNNA 4RF7A 4LNIA 3NG0A 3ZXVA 4S17A 3IG8A 4BAXA 3IG5A 1R8GA 2D3BA 2QC8A 3FKYA 1G0WA 4XYCA 2D3CA 3L2EA 3L2EB 1RL9A 1V4GA 1TT4A 1P50A 5J9AA 4LNFA 2J1QA 4RF8A 2GLSA 2GWCA 2LGSA 2WGSA 4BHLA
chains in the Genus database with same CATH topology
1BG0A 1QH4A 1F52A 1FPYA 2BVCA 4LNKA 1LGRA 4AM1A 3L2DA 3JQ3A 3JPZA 1G0WA 1VRPA 4XYCA 4BG4A 1SD0A 5J99A 1M15A 1P52A 1QK1A 4GVYA 4ACFA 3L2EA 3ZXRA 1HTOA 1F1HA 3L2EB 3M10A 1CRKA 1RL9A 3B6RA 4BG4B 4GVZA 1P50A 3DREA 3JU5A 1HTQA 1I0EA 2CRKA 4HPPA 4RF6A 5J9AA 4RF7A 4LNIA 3JU6A 4LNNA 3NG0A 3DRBA 4GW2A 3ZXVA 4LNFA 2J1QA 4S17A 4Z9MA 4RF8A 4LNOA 1U6RA 2GLSA 4RF9A 2WHIA 4S0RA 4GW0A 2LGSA 2WGSA 4Q2RA 4BHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG0 A;  1QH4 A;  1F52 A;  1FPY A;  2BVC A;  4LNK A;  1LGR A;  4AM1 A;  3L2D A;  3JQ3 A;  3JPZ A;  1G0W A;  1VRP A;  4XYC A;  4BG4 A;  1SD0 A;  5J99 A;  1M15 A;  1P52 A;  1QK1 A;  4GVY A;  4ACF A;  3L2E A;  3ZXR A;  1HTO A;  1F1H A;  3L2E B;  3M10 A;  1CRK A;  1RL9 A;  3B6R A;  4BG4 B;  4GVZ A;  1P50 A;  3DRE A;  3JU5 A;  1HTQ A;  1I0E A;  2CRK A;  4HPP A;  4RF6 A;  5J9A A;  4RF7 A;  4LNI A;  3JU6 A;  4LNN A;  3NG0 A;  3DRB A;  4GW2 A;  3ZXV A;  4LNF A;  2J1Q A;  4S17 A;  4Z9M A;  4RF8 A;  4LNO A;  1U6R A;  2GLS A;  4RF9 A;  2WHI A;  4S0R A;  4GW0 A;  2LGS A;  2WGS A;  4Q2R A;  4BHL A; 
#chains in the Genus database with same CATH topology
 1BG0 A;  3LN7 A;  4LNK A;  4AM1 A;  3JPZ A;  1M15 A;  1P52 A;  1HTO A;  1VA6 A;  1CRK A;  4BG4 B;  2OJW A;  3JU6 A;  3DRB A;  2D33 A;  4Z9M A;  1U6R A;  2WHI A;  4GW0 A;  1LGR A;  3L2D A;  3LVW A;  1SD0 A;  3NZT A;  1QK1 A;  4GVY A;  3ZXR A;  2D3A A;  3M10 A;  3B6R A;  4GVZ A;  3DRE A;  1HTQ A;  1I0E A;  4HPP A;  4RF6 A;  4GW2 A;  2D32 A;  2GWD A;  4LNO A;  2UU7 A;  4RF9 A;  4S0R A;  4Q2R A;  1F52 A;  1QH4 A;  1FPY A;  2BVC A;  3LN6 A;  3JQ3 A;  3LVV A;  1VRP A;  4BG4 A;  5J99 A;  4ACF A;  1F1H A;  3JU5 A;  2CRK A;  4LNN A;  4RF7 A;  4LNI A;  3NG0 A;  3ZXV A;  4S17 A;  3IG8 A;  4BAX A;  3IG5 A;  1R8G A;  2D3B A;  2QC8 A;  3FKY A;  1G0W A;  4XYC A;  2D3C A;  3L2E A;  3L2E B;  1RL9 A;  1V4G A;  1TT4 A;  1P50 A;  5J9A A;  4LNF A;  2J1Q A;  4RF8 A;  2GLS A;  2GWC A;  2LGS A;  2WGS A;  4BHL A; 
#chains in the Genus database with same CATH homology
 1BG0 A;  1QH4 A;  1F52 A;  1FPY A;  2BVC A;  4LNK A;  1LGR A;  4AM1 A;  3L2D A;  3JQ3 A;  3JPZ A;  1G0W A;  1VRP A;  4XYC A;  4BG4 A;  1SD0 A;  5J99 A;  1M15 A;  1P52 A;  1QK1 A;  4GVY A;  4ACF A;  3L2E A;  3ZXR A;  1HTO A;  1F1H A;  3L2E B;  3M10 A;  1CRK A;  1RL9 A;  3B6R A;  4BG4 B;  4GVZ A;  1P50 A;  3DRE A;  3JU5 A;  1HTQ A;  1I0E A;  2CRK A;  4HPP A;  4RF6 A;  5J9A A;  4RF7 A;  4LNI A;  3JU6 A;  4LNN A;  3NG0 A;  3DRB A;  4GW2 A;  3ZXV A;  4LNF A;  2J1Q A;  4S17 A;  4Z9M A;  4RF8 A;  4LNO A;  1U6R A;  2GLS A;  4RF9 A;  2WHI A;  4S0R A;  4GW0 A;  2LGS A;  2WGS A;  4Q2R A;  4BHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...