3JU6A

Crystal structure of dimeric arginine kinase in complex with amppnp and arginine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
369
structure length
361
Chain Sequence
ANLNQKKYPAKDDFPNFEGHKSLLSKYLTADMYAKLRDVATPSGYTLDRAIQNGVDNPDFHLGLLAGDEETYTVFADLFDPVIEEYHNGFKKTDNHKTDLDASKILDDVLDPAYVISSRVRTGRNIRGMALSPHVCRSERRAIEKMVSEALNSLAADLKGKYYSLMKMDEKTQQQLIDDHFLFDRPVSRHFTSGGMARDFPDGRGIWHNDKKNFLVWINEEDHTRIISMQMGGNMKEVFERFTRGLTEVEKHIKDKTGKEFMKNDHLGFVLTCPSNLGTGVRCSVHAKLPHMAKDKRFEEICTKMRLQKRGTGGVYDISNLDRLGSSEVEQVNCVIKGVKVLIEMEKKLEKGESIDDLVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine kinase
publication title Structural basis for a reciprocating mechanism of negative cooperativity in dimeric phosphagen kinase activity
pubmed doi rcsb
source organism Apostichopus japonicus
molecule tags Transferase
total genus 112
structure length 361
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 3ju6A01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 3ju6A02
4RF9A 1RL9A 3L2EA 1G0WA 4LNNA 1F52A 1HTQA 3JPZA 1SD0A 3DRBA 5J99A 4HPPA 4AM1A 1CRKA 4RF8A 4S0RA 3B6RA 3L2EB 4GW0A 4BG4A 4GW2A 1VRPA 1QH4A 1FPYA 2GLSA 4RF6A 1HTOA 4RF7A 4BG4B 4GVZA 3NG0A 4Q2RA 3JU6A 4LNOA 4LNIA 1F1HA 2WGSA 4BHLA 3ZXRA 1QK1A 4Z9MA 3DREA 3JU5A 3JQ3A 2WHIA 4XYCA 1LGRA 1I0EA 1P50A 4ACFA 3L2DA 3ZXVA 2CRKA 1M15A 2BVCA 4GVYA 2LGSA 4LNFA 4LNKA 1BG0A 4S17A 1P52A 1U6RA 3M10A 5J9AA 2J1QA
chains in the Genus database with same CATH superfamily
4RF9A 3FKYA 4BG4A 1VRPA 1QH4A 2D3CA 3NG0A 4Q2RA 1TT4A 3IG8A 2D32A 1QK1A 2GWCA 1I0EA 3ZXVA 2BVCA 1M15A 2LGSA 4LNKA 1P52A 2D33A 4LNNA 2QC8A 4HPPA 4AM1A 4S0RA 1V4GA 4RF6A 1HTOA 4BG4B 2D3AA 2GWDA 4BAXA 4LNIA 1F1HA 2WGSA 4BHLA 3ZXRA 3DREA 3JU5A 2D3BA 3IG5A 2WHIA 1P50A 2CRKA 4GVYA 5J9AA 3LVWA 1RL9A 3L2EA 1G0WA 1F52A 1HTQA 3JPZA 5J99A 1CRKA 4RF8A 3B6RA 3LN6A 3NZTA 4GW2A 1FPYA 3LN7A 2UU7A 3JU6A 3JQ3A 4XYCA 3LVVA 4LNFA 4S17A 1BG0A 1U6RA 2J1QA 1SD0A 3DRBA 3L2EB 4GW0A 2GLSA 4RF7A 1R8GA 4GVZA 4LNOA 4Z9MA 1VA6A 1LGRA 2OJWA 4ACFA 3L2DA 3M10A
chains in the Genus database with same CATH topology
4RF9A 1RL9A 3L2EA 1G0WA 4LNNA 1F52A 1HTQA 3JPZA 1SD0A 3DRBA 5J99A 4HPPA 4AM1A 1CRKA 4RF8A 4S0RA 3B6RA 3L2EB 4GW0A 4BG4A 4GW2A 1VRPA 1QH4A 1FPYA 2GLSA 4RF6A 1HTOA 4RF7A 4BG4B 4GVZA 3NG0A 4Q2RA 3JU6A 4LNOA 4LNIA 1F1HA 2WGSA 4BHLA 3ZXRA 1QK1A 4Z9MA 3DREA 3JU5A 3JQ3A 2WHIA 4XYCA 1LGRA 1I0EA 1P50A 4ACFA 3L2DA 3ZXVA 2CRKA 1M15A 2BVCA 4GVYA 2LGSA 4LNFA 4LNKA 1BG0A 4S17A 1P52A 1U6RA 3M10A 5J9AA 2J1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF9 A;  1RL9 A;  3L2E A;  1G0W A;  4LNN A;  1F52 A;  1HTQ A;  3JPZ A;  1SD0 A;  3DRB A;  5J99 A;  4HPP A;  4AM1 A;  1CRK A;  4RF8 A;  4S0R A;  3B6R A;  3L2E B;  4GW0 A;  4BG4 A;  4GW2 A;  1VRP A;  1QH4 A;  1FPY A;  2GLS A;  4RF6 A;  1HTO A;  4RF7 A;  4BG4 B;  4GVZ A;  3NG0 A;  4Q2R A;  3JU6 A;  4LNO A;  4LNI A;  1F1H A;  2WGS A;  4BHL A;  3ZXR A;  1QK1 A;  4Z9M A;  3DRE A;  3JU5 A;  3JQ3 A;  2WHI A;  4XYC A;  1LGR A;  1I0E A;  1P50 A;  4ACF A;  3L2D A;  3ZXV A;  2CRK A;  1M15 A;  2BVC A;  4GVY A;  2LGS A;  4LNF A;  4LNK A;  1BG0 A;  4S17 A;  1P52 A;  1U6R A;  3M10 A;  5J9A A;  2J1Q A; 
#chains in the Genus database with same CATH topology
 4RF9 A;  3FKY A;  4BG4 A;  1VRP A;  1QH4 A;  2D3C A;  3NG0 A;  4Q2R A;  1TT4 A;  3IG8 A;  2D32 A;  1QK1 A;  2GWC A;  1I0E A;  3ZXV A;  2BVC A;  1M15 A;  2LGS A;  4LNK A;  1P52 A;  2D33 A;  4LNN A;  2QC8 A;  4HPP A;  4AM1 A;  4S0R A;  1V4G A;  4RF6 A;  1HTO A;  4BG4 B;  2D3A A;  2GWD A;  4BAX A;  4LNI A;  1F1H A;  2WGS A;  4BHL A;  3ZXR A;  3DRE A;  3JU5 A;  2D3B A;  3IG5 A;  2WHI A;  1P50 A;  2CRK A;  4GVY A;  5J9A A;  3LVW A;  1RL9 A;  3L2E A;  1G0W A;  1F52 A;  1HTQ A;  3JPZ A;  5J99 A;  1CRK A;  4RF8 A;  3B6R A;  3LN6 A;  3NZT A;  4GW2 A;  1FPY A;  3LN7 A;  2UU7 A;  3JU6 A;  3JQ3 A;  4XYC A;  3LVV A;  4LNF A;  4S17 A;  1BG0 A;  1U6R A;  2J1Q A;  1SD0 A;  3DRB A;  3L2E B;  4GW0 A;  2GLS A;  4RF7 A;  1R8G A;  4GVZ A;  4LNO A;  4Z9M A;  1VA6 A;  1LGR A;  2OJW A;  4ACF A;  3L2D A;  3M10 A; 
#chains in the Genus database with same CATH homology
 4RF9 A;  1RL9 A;  3L2E A;  1G0W A;  4LNN A;  1F52 A;  1HTQ A;  3JPZ A;  1SD0 A;  3DRB A;  5J99 A;  4HPP A;  4AM1 A;  1CRK A;  4RF8 A;  4S0R A;  3B6R A;  3L2E B;  4GW0 A;  4BG4 A;  4GW2 A;  1VRP A;  1QH4 A;  1FPY A;  2GLS A;  4RF6 A;  1HTO A;  4RF7 A;  4BG4 B;  4GVZ A;  3NG0 A;  4Q2R A;  3JU6 A;  4LNO A;  4LNI A;  1F1H A;  2WGS A;  4BHL A;  3ZXR A;  1QK1 A;  4Z9M A;  3DRE A;  3JU5 A;  3JQ3 A;  2WHI A;  4XYC A;  1LGR A;  1I0E A;  1P50 A;  4ACF A;  3L2D A;  3ZXV A;  2CRK A;  1M15 A;  2BVC A;  4GVY A;  2LGS A;  4LNF A;  4LNK A;  1BG0 A;  4S17 A;  1P52 A;  1U6R A;  3M10 A;  5J9A A;  2J1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...