1VRPA

The 2.1 structure of t. californica creatine kinase complexed with the transition-state analogue complex, adp-mg 2+ /no3-/creatine
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
LNYSAAEEFPDLSKHNNHMAKALTLDIYKKLRDKETPSGFTLDDIIQTGVDNPGHPFIMTVGCVAGDEECYEVFKDLFDPVIEDRHGGYKPTDKHKTDLNQENLKGGDDLDPNYVLSSRVRTGRSIKGIALPPHCSRGERRLVEKLCIDGLATLTGEFQGKYYPLSSMSDAEQQQLIDDHFLFDKPISPLLLASGMARDWPDGRGIWHNNDKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLKKIEDIFVKAGRGFMWNEHLGYVLTCPSNLGTGLRGGVHVKIPHLCKHEKFSEVLKRTRLQKRGTGGVDTAAVGSIYDISNADRLGFSEVEQVQMVVDGVKLMVEMEKRLENGKSIDDLMPAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.1 A Structure of Torpedo californica Creatine Kinase Complexed with the ADP-Mg(2+)-NO3(-)-Creatine Transition-State Analogue Complex
pubmed doi rcsb
source organism Torpedo californica
molecule tags Transferase
molecule keywords Creatine Kinase, M chain
total genus 124
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 2.7.3.2: Creatine kinase.
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
A PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 1vrpA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1vrpA02
2J1QA 4RF6A 4GW2A 3NG0A 1HTOA 4XYCA 1VRPA 3JPZA 1FPYA 3ZXRA 1LGRA 4AM1A 4BG4B 1RL9A 4S17A 3DRBA 4GW0A 1BG0A 1G0WA 1QH4A 4RF8A 2WGSA 4BHLA 2LGSA 1P50A 5J9AA 2CRKA 3JQ3A 3L2EA 4Q2RA 4GVYA 1I0EA 3L2DA 1SD0A 4GVZA 1U6RA 1QK1A 3JU6A 1CRKA 1F52A 4LNIA 3ZXVA 3JU5A 3DREA 4LNFA 1F1HA 4LNNA 2GLSA 1M15A 4ACFA 3B6RA 3L2EB 4HPPA 4LNOA 3M10A 4Z9MA 5J99A 2WHIA 2BVCA 4BG4A 4LNKA 1HTQA 4RF7A 1P52A 4RF9A 4S0RA
chains in the Genus database with same CATH superfamily
4GW2A 3NG0A 1VRPA 1V4GA 4S17A 1BG0A 3LN6A 4RF8A 3LN7A 3JQ3A 2UU7A 3L2DA 3ZXVA 1CRKA 4Z9MA 4RF7A 3LVVA 3JPZA 1FPYA 1LGRA 1R8GA 4AM1A 4BG4B 4BAXA 2D33A 2WGSA 4BHLA 1P50A 5J9AA 3IG8A 1SD0A 1U6RA 4LNIA 3JU5A 2D3CA 1F1HA 4ACFA 3B6RA 4HPPA 4LNOA 2GWDA 4BG4A 4S0RA 3FKYA 1VA6A 1RL9A 4GW0A 2OJWA 3LVWA 2QC8A 2D3BA 2LGSA 3NZTA 1TT4A 3L2EA 4GVZA 1QK1A 3JU6A 3DREA 4LNFA 4LNNA 3L2EB 4LNKA 5J99A 4RF9A 2J1QA 4RF6A 1HTOA 4XYCA 3DRBA 1G0WA 1QH4A 2CRKA 2D3AA 4Q2RA 2GWCA 4GVYA 1I0EA 1F52A 3IG5A 2GLSA 1M15A 2D32A 3M10A 2WHIA 2BVCA 1HTQA 1P52A 3ZXRA
chains in the Genus database with same CATH topology
2J1QA 4RF6A 4GW2A 3NG0A 1HTOA 4XYCA 1VRPA 3JPZA 1FPYA 3ZXRA 1LGRA 4AM1A 4BG4B 1RL9A 4S17A 3DRBA 4GW0A 1BG0A 1G0WA 1QH4A 4RF8A 2WGSA 4BHLA 2LGSA 1P50A 5J9AA 2CRKA 3JQ3A 3L2EA 4Q2RA 4GVYA 1I0EA 3L2DA 1SD0A 4GVZA 1U6RA 1QK1A 3JU6A 1CRKA 1F52A 4LNIA 3ZXVA 3JU5A 3DREA 4LNFA 1F1HA 4LNNA 2GLSA 1M15A 4ACFA 3B6RA 3L2EB 4HPPA 4LNOA 3M10A 4Z9MA 5J99A 2WHIA 2BVCA 4BG4A 4LNKA 1HTQA 4RF7A 1P52A 4RF9A 4S0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1Q A;  4RF6 A;  4GW2 A;  3NG0 A;  1HTO A;  4XYC A;  1VRP A;  3JPZ A;  1FPY A;  3ZXR A;  1LGR A;  4AM1 A;  4BG4 B;  1RL9 A;  4S17 A;  3DRB A;  4GW0 A;  1BG0 A;  1G0W A;  1QH4 A;  4RF8 A;  2WGS A;  4BHL A;  2LGS A;  1P50 A;  5J9A A;  2CRK A;  3JQ3 A;  3L2E A;  4Q2R A;  4GVY A;  1I0E A;  3L2D A;  1SD0 A;  4GVZ A;  1U6R A;  1QK1 A;  3JU6 A;  1CRK A;  1F52 A;  4LNI A;  3ZXV A;  3JU5 A;  3DRE A;  4LNF A;  1F1H A;  4LNN A;  2GLS A;  1M15 A;  4ACF A;  3B6R A;  3L2E B;  4HPP A;  4LNO A;  3M10 A;  4Z9M A;  5J99 A;  2WHI A;  2BVC A;  4BG4 A;  4LNK A;  1HTQ A;  4RF7 A;  1P52 A;  4RF9 A;  4S0R A; 
#chains in the Genus database with same CATH topology
 4GW2 A;  3NG0 A;  1VRP A;  1V4G A;  4S17 A;  1BG0 A;  3LN6 A;  4RF8 A;  3LN7 A;  3JQ3 A;  2UU7 A;  3L2D A;  3ZXV A;  1CRK A;  4Z9M A;  4RF7 A;  3LVV A;  3JPZ A;  1FPY A;  1LGR A;  1R8G A;  4AM1 A;  4BG4 B;  4BAX A;  2D33 A;  2WGS A;  4BHL A;  1P50 A;  5J9A A;  3IG8 A;  1SD0 A;  1U6R A;  4LNI A;  3JU5 A;  2D3C A;  1F1H A;  4ACF A;  3B6R A;  4HPP A;  4LNO A;  2GWD A;  4BG4 A;  4S0R A;  3FKY A;  1VA6 A;  1RL9 A;  4GW0 A;  2OJW A;  3LVW A;  2QC8 A;  2D3B A;  2LGS A;  3NZT A;  1TT4 A;  3L2E A;  4GVZ A;  1QK1 A;  3JU6 A;  3DRE A;  4LNF A;  4LNN A;  3L2E B;  4LNK A;  5J99 A;  4RF9 A;  2J1Q A;  4RF6 A;  1HTO A;  4XYC A;  3DRB A;  1G0W A;  1QH4 A;  2CRK A;  2D3A A;  4Q2R A;  2GWC A;  4GVY A;  1I0E A;  1F52 A;  3IG5 A;  2GLS A;  1M15 A;  2D32 A;  3M10 A;  2WHI A;  2BVC A;  1HTQ A;  1P52 A;  3ZXR A; 
#chains in the Genus database with same CATH homology
 2J1Q A;  4RF6 A;  4GW2 A;  3NG0 A;  1HTO A;  4XYC A;  1VRP A;  3JPZ A;  1FPY A;  3ZXR A;  1LGR A;  4AM1 A;  4BG4 B;  1RL9 A;  4S17 A;  3DRB A;  4GW0 A;  1BG0 A;  1G0W A;  1QH4 A;  4RF8 A;  2WGS A;  4BHL A;  2LGS A;  1P50 A;  5J9A A;  2CRK A;  3JQ3 A;  3L2E A;  4Q2R A;  4GVY A;  1I0E A;  3L2D A;  1SD0 A;  4GVZ A;  1U6R A;  1QK1 A;  3JU6 A;  1CRK A;  1F52 A;  4LNI A;  3ZXV A;  3JU5 A;  3DRE A;  4LNF A;  1F1H A;  4LNN A;  2GLS A;  1M15 A;  4ACF A;  3B6R A;  3L2E B;  4HPP A;  4LNO A;  3M10 A;  4Z9M A;  5J99 A;  2WHI A;  2BVC A;  4BG4 A;  4LNK A;  1HTQ A;  4RF7 A;  1P52 A;  4RF9 A;  4S0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...