4BG4B

Crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
356
structure length
355
Chain Sequence
b'MADAAVIEKLEAGFKKLEAATDCRSLLKKYLTKDVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANARYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE KINASE
publication title Crystal Structure of Shrimp Arginine Kinase in Binary Complex with Arginine-A Molecular View of the Phosphagen Precursor Binding to the Enzyme.
pubmed doi rcsb
molecule tags Transferase
total genus 125
structure length 355
sequence length 356
ec nomenclature ec 2.7.3.3: Arginine kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00217 ATP-gua_Ptrans ATP:guanido phosphotransferase, C-terminal catalytic domain
B PF02807 ATP-gua_PtransN ATP:guanido phosphotransferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.135.10 Mainly Alpha Orthogonal Bundle Transferase Creatine Kinase; Chain A, domain 1 ATP:guanido phosphotransferase, N-terminal domain 4bg4B01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4bg4B02
3L2DA 1HTQA 3ZXRA 1P52A 4BG4B 5J99A 4Z9MA 2WGSA 1VRPA 4RF8A 1F52A 3ZXVA 4GW0A 1LGRA 1CRKA 2WHIA 4XYCA 1HTOA 3L2EB 1QK1A 2LGSA 4GVYA 1BG0A 1M15A 4BG4A 4BHLA 1RL9A 4RF9A 4AM1A 2J1QA 3JU5A 4GW2A 4LNNA 4LNOA 3DREA 4S0RA 1G0WA 3L2EA 4LNFA 3NG0A 4Q2RA 1FPYA 4ACFA 4GVZA 3JQ3A 1I0EA 4RF7A 1QH4A 2BVCA 4HPPA 4S17A 3M10A 1SD0A 4LNKA 2CRKA 1P50A 3DRBA 2GLSA 3JPZA 1F1HA 4LNIA 1U6RA 3JU6A 4RF6A 5J9AA 3B6RA
chains in the Genus database with same CATH superfamily
4BG4B 4XYCA 1QK1A 4GVYA 4BHLA 4RF9A 2D33A 2D32A 2OJWA 2J1QA 3IG8A 3JU5A 4GW2A 4LNNA 3L2EA 4LNFA 4Q2RA 4BAXA 3M10A 1R8GA 2CRKA 2GLSA 4LNIA 1U6RA 2QC8A 2GWDA 1V4GA 1HTQA 4RF8A 1VA6A 3LVWA 4BG4A 1M15A 1RL9A 3IG5A 4LNOA 3DREA 1G0WA 2UU7A 1I0EA 4S17A 3NZTA 4LNKA 3LVVA 3JPZA 5J9AA 2GWCA 3LN6A 3L2DA 5J99A 2WGSA 3ZXVA 4GW0A 1LGRA 1CRKA 2D3CA 1HTOA 3FKYA 4AM1A 4S0RA 4ACFA 3NG0A 1FPYA 2D3AA 1TT4A 1SD0A 1P50A 1F1HA 3JU6A 4RF6A 3ZXRA 1P52A 4Z9MA 1VRPA 1F52A 2WHIA 3L2EB 2LGSA 1BG0A 2D3BA 4GVZA 3JQ3A 2BVCA 4RF7A 1QH4A 4HPPA 3LN7A 3DRBA 3B6RA
chains in the Genus database with same CATH topology
3L2DA 1HTQA 3ZXRA 1P52A 4BG4B 5J99A 4Z9MA 2WGSA 1VRPA 4RF8A 1F52A 3ZXVA 4GW0A 1LGRA 1CRKA 2WHIA 4XYCA 1HTOA 3L2EB 1QK1A 2LGSA 4GVYA 1BG0A 1M15A 4BG4A 4BHLA 1RL9A 4RF9A 4AM1A 2J1QA 3JU5A 4GW2A 4LNNA 4LNOA 3DREA 4S0RA 1G0WA 3L2EA 4LNFA 3NG0A 4Q2RA 1FPYA 4ACFA 4GVZA 3JQ3A 1I0EA 4RF7A 1QH4A 2BVCA 4HPPA 4S17A 3M10A 1SD0A 4LNKA 2CRKA 1P50A 3DRBA 2GLSA 3JPZA 1F1HA 4LNIA 1U6RA 3JU6A 4RF6A 5J9AA 3B6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2D A;  1HTQ A;  3ZXR A;  1P52 A;  4BG4 B;  5J99 A;  4Z9M A;  2WGS A;  1VRP A;  4RF8 A;  1F52 A;  3ZXV A;  4GW0 A;  1LGR A;  1CRK A;  2WHI A;  4XYC A;  1HTO A;  3L2E B;  1QK1 A;  2LGS A;  4GVY A;  1BG0 A;  1M15 A;  4BG4 A;  4BHL A;  1RL9 A;  4RF9 A;  4AM1 A;  2J1Q A;  3JU5 A;  4GW2 A;  4LNN A;  4LNO A;  3DRE A;  4S0R A;  1G0W A;  3L2E A;  4LNF A;  3NG0 A;  4Q2R A;  1FPY A;  4ACF A;  4GVZ A;  3JQ3 A;  1I0E A;  4RF7 A;  1QH4 A;  2BVC A;  4HPP A;  4S17 A;  3M10 A;  1SD0 A;  4LNK A;  2CRK A;  1P50 A;  3DRB A;  2GLS A;  3JPZ A;  1F1H A;  4LNI A;  1U6R A;  3JU6 A;  4RF6 A;  5J9A A;  3B6R A; 
#chains in the Genus database with same CATH topology
 4BG4 B;  4XYC A;  1QK1 A;  4GVY A;  4BHL A;  4RF9 A;  2D33 A;  2D32 A;  2OJW A;  2J1Q A;  3IG8 A;  3JU5 A;  4GW2 A;  4LNN A;  3L2E A;  4LNF A;  4Q2R A;  4BAX A;  3M10 A;  1R8G A;  2CRK A;  2GLS A;  4LNI A;  1U6R A;  2QC8 A;  2GWD A;  1V4G A;  1HTQ A;  4RF8 A;  1VA6 A;  3LVW A;  4BG4 A;  1M15 A;  1RL9 A;  3IG5 A;  4LNO A;  3DRE A;  1G0W A;  2UU7 A;  1I0E A;  4S17 A;  3NZT A;  4LNK A;  3LVV A;  3JPZ A;  5J9A A;  2GWC A;  3LN6 A;  3L2D A;  5J99 A;  2WGS A;  3ZXV A;  4GW0 A;  1LGR A;  1CRK A;  2D3C A;  1HTO A;  3FKY A;  4AM1 A;  4S0R A;  4ACF A;  3NG0 A;  1FPY A;  2D3A A;  1TT4 A;  1SD0 A;  1P50 A;  1F1H A;  3JU6 A;  4RF6 A;  3ZXR A;  1P52 A;  4Z9M A;  1VRP A;  1F52 A;  2WHI A;  3L2E B;  2LGS A;  1BG0 A;  2D3B A;  4GVZ A;  3JQ3 A;  2BVC A;  4RF7 A;  1QH4 A;  4HPP A;  3LN7 A;  3DRB A;  3B6R A; 
#chains in the Genus database with same CATH homology
 3L2D A;  1HTQ A;  3ZXR A;  1P52 A;  4BG4 B;  5J99 A;  4Z9M A;  2WGS A;  1VRP A;  4RF8 A;  1F52 A;  3ZXV A;  4GW0 A;  1LGR A;  1CRK A;  2WHI A;  4XYC A;  1HTO A;  3L2E B;  1QK1 A;  2LGS A;  4GVY A;  1BG0 A;  1M15 A;  4BG4 A;  4BHL A;  1RL9 A;  4RF9 A;  4AM1 A;  2J1Q A;  3JU5 A;  4GW2 A;  4LNN A;  4LNO A;  3DRE A;  4S0R A;  1G0W A;  3L2E A;  4LNF A;  3NG0 A;  4Q2R A;  1FPY A;  4ACF A;  4GVZ A;  3JQ3 A;  1I0E A;  4RF7 A;  1QH4 A;  2BVC A;  4HPP A;  4S17 A;  3M10 A;  1SD0 A;  4LNK A;  2CRK A;  1P50 A;  3DRB A;  2GLS A;  3JPZ A;  1F1H A;  4LNI A;  1U6R A;  3JU6 A;  4RF6 A;  5J9A A;  3B6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...