1HTQA

Multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
477
structure length
477
Chain Sequence
b'TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutamine synthetase
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 140
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htqA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htqA01
4RF8A 4GW0A 4RF7A 1FPYA 3L2EA 3L2EB 1BG0A 3NG0A 4RF6A 4BHLA 2D3BA 4S0RA 4BAXA 4LNKA 3ZXRA 4GVYA 4LNIA 1QK1A 3DRBA 4Q2RA 4AM1A 2BVCA 4ACFA 1SD0A 3B6RA 3ZXVA 3L2DA 3M10A 2OJWA 2D3CA 1VRPA 3JPZA 2LGSA 4BG4B 4GVZA 2WHIA 1CRKA 2CRKA 4BG4A 4LNNA 1G0WA 1F52A 3DREA 5J99A 3JU6A 4S17A 1M15A 2J1QA 2WGSA 2GLSA 1U6RA 4LNFA 4XYCA 2QC8A 4HPPA 1RL9A 1P50A 4LNOA 4Z9MA 1P52A 2D3AA 4RF9A 1I0EA 3JQ3A 3FKYA 1QH4A 1LGRA 1HTQA 3JU5A 1HTOA 5J9AA 1F1HA 4GW2A 2UU7A
chains in the Genus database with same CATH superfamily
1V49A 5D3DA 1V2YA 2M0XA 3U8ZA 2O6VD 4RMAA 2L76A 1WE6A 1V4GA 5H8YE 3PRMB 1WGRA 3AEEB 1QOBA 2KACA 4HPLB 5JZEB 1E6EB 3RNGC 4XWTA 3TEXA 4BKSD 2L0TA 2ZZPB 1SGHA 4IUMB 5AZHA 4W9EA 3FILB 1KF6B 1EF5A 2DYOA 3QJZA 3ZVVA 3ABVB 3WALA 1E8YA 3DWMA 3MP9A 3U2SC 2G4DB 4KX6B 3KLSX 3ML8A 2L52A 2MJ3A 1C76A 1WXMA 3AE6B 2LUMA 1N6ZA 1F1HA 4AJYB 2AL3A 4ZOHC 3L2EB 4TSSA 4WAFA 2JXXA 2G45B 1I4HA 3APFA 4MELA 2MSED 4RM8A 4BKTA 1K53A 4KVGB 3H7PA 2QHOA 2PMVA 3LYYA 3VTWA 2K3UA 4ZHPA 4DXAB 1E7VA 1PYWD 1OGWA 3BINA 3UIOB 1E10A 1F77A 2Z0DB 4W9GA 4IDIA 2JU6X 3ZDMC 3AH7A 1WJNA 2O6VB 2QJLA 3QX1A 1M15A 2WS3B 1R4NB 4KSLC 3BVZA 3BY4B 1KTKA 3DPDA 4ZYSA 2J52A 3MC9A 1WM3A 4PT5A 2DNFA 2L0FA 2MW5A 4ANUA 2KFKA 4HK2A 1Q10A 1JWSD 1I4PA 2FAZA 3PRPB 1WXVA 3WIMA 3SHQA 3ZKJC 1VDVA 4KDIC 1WF9A 4KDLB 4E74A 1RL9A 3A4RA 4AQ7A 4JQWC 4MEMA 1CK1A 3D32A 4RF6A 2KDEB 2BW2A 5DPWA 1JMLA 1SSNA 3VRBB 3H7PB 4P1CC 1FD6A 1J8CA 1N61A 1ACCA 1EU4A 1UZXB 2K9XA 2JSVX 2DENB 2AX5A 1XLOA 2MH7A 4HPMB 3ZNHB 1TT4A 1J0GA 1SE3A 1LGRA 4LCDE 3KH0A 3L54A 1V5OA 2LVOA 2KMAA 2N9KA 1WYGA 3EA6A 1GPXA 4YTNB 2EMSA 2WXNA 3UF8A 3ML9A 1L0VB 2KKCA 1JWMD 3T3NA 3N3KB 3A33B 3Q8EA 2IDYA 4M8MA 2QEJC 3PO0A 3V3XA 3ZUNA 2WP9B 3W2DA 2K8HA 4PS3A 3ZLZA 1T5XD 2N1WA 2CJOA 3IT6B 1JWUD 3DRBA 1WXQA 2Z59B 1JW9D 1PGXA 3AE5B 5DPSA 3L0WB 1RAXA 1ZDVA 2K25A 1H8CA 3AN1A 4KKIA 3U7DA 3NZ3A 4B0EA 1U6RA 1S3SG 2JZ3B 3ZTCA 1G6JA 3UQAA 4I6PA 3I63C 2C7HA 2DX5B 2TSSA 1GJZA 5G2NA 1ZXHA 3U7ZA 3VFKA 4DHZB 3GZNI 1UF0A 2JF5A 3VTUA 2L3ZA 2D3CA 3TIXA 1E5WA 2FCMA 3I3TB 3KVFB 1V9JA 3DREA 4AOFA 1D5XC 3Q2AC 1Y8RC 5BYSA 2JXTA 2QC8A 1F2RC 5BYQA 1IBXA 2V3SA 1JRPA 3AE9B 1FO4A 4K1RB 3JU5A 5BMHA 4EOYA 3DBHI 2BYTA 1TKGA 4HKZE 2V0GA 3VUWA 2AEHA 1J19A 4DWFA 3ZXVA 2Y3AA 1H4RA 2GBMA 2CU3A 1FEHA 5MPOA 3QARA 1QF6A 4M00A 4A55A 1FXAA 2J0JA 2KWUB 4P7IA 3V62A 2V1YA 1GAQB 3HUIA 1WGGA 1EF1A 4MJSA 2LD9A 1TS2A 3OJ3A 3UINB 3B0AA 4W9JA 2FIFA 3L16A 1PDXA 2GOWA 1E8ZA 3NVWA 2HE7A 1WX8A 1K8RB 4US8A 2W3RA 2WWZA 4F8CB 1C78A 4HPPA 1XT9B 4RF1A 4Z9MA 1FFUA 1YJJA 2H88B 2MEKA 1E7PB 3LN7A 3NJTA 2QMTA 4FN2A 1RLFA 2L05A 1FCLA 1WSPA 2MP2A 4GDKA 3A9KB 3ZJVA 3N1YC 1LM8B 4JX1C 1T3QA 3ZRFA 2FCNA 2QILA 2CU1A 3AV8A 2GI9A 1NI2A 1V8CA 3RCZA 3RNBC 2FIDA 2JYTA 1J7CA 2WX1A 2KWCA 1CJEA 2KXJA 4PK1A 3PPAA 1R4MB 2HD5B 2LGXA 1I4XA 1EUVB 2IYDB 3P4PB 2WXPA 1DOYA 1MI0A 4NNJB 2ZW0A 5LXHA 3ALBA 1WXSA 3AEFB 3P4QB 1FIQA 3P4SB 4ACFA 4EKUA 1I35A 3B1LX 4GVZA 1I4QA 3DBRI 4M01A 4EZLA 3WAPA 3ZDTA 3PS6A 3VTVA 1IGCA 1WGDA 3HVDA 1DGJA 3TEYA 4LLGM 3WCQA 2E6XA 3ZNZB 3O65B 3Q8FA 4CO7A 1C77A 2J0MA 2BVCA 2WU2B 1WWTA 2AQ3B 3DHIC 5DPRA 2RSUA 3R66C 3QWZB 2MX2A 4A90A 2LZ6A 2KQSA 4ICVA 3EC8A 2J0KA 4W9CA 1FM0D 4IKGA 2BQQA 1WZ0A 2BT6A 4NQKE 2WYQA 1CZPA 4MH0E 3JPZA 3DOWA 3SU8X 2BB5A 1E8WA 3ZO5B 1WMHA 4RFBA 1A5RA 4D2KA 3JVZX 3A9JB 1GG3A 1RYJA 3OJ4B 2IO0B 4RNAA 2JX5A 2ZEQA 2BGFA 2V3NA 2MHJA 3RNAC 1ENFA 3JW0X 4C7ZA 3DWGC 2IGHA 1QK1A 5D2MB 4AM1A 3W1SC 1VR9A 4EZJA 1R8GA 4A20A 2K6DB 1IYFA 4HKQA 2QDFA 2AQ2B 2PJHA 5E6JA 1V1PB 3PZ7A 4K7SA 2KOXA 4IWOA 3R7RA 3L08A 2MA9B 1RRBA 4DHJB 3KUDB 4AUQC 4BOSC 4DDGD 4NAMA 4KV2A 3JSVA 2D3BA 3IBEA 2ASQA 2V4LA 4FADA 3MC8A 3DDCB 3RZWC 4C4VB 3KYDD 2JWUA 1AW7A 4FJVB 4WWMA 2KT7A 5FK9C 2KTRB 1XCQL 4RGOS 1OQYA 3MHZA 1TT5B 1BXTA 3TEZA 1PQSA 3B6RA 5DPTA 3TBLD 2KC1A 2NR2A 1WI0A 2D33A 3ZXRA 4MM3A 2V4IB 4WWNA 2O2VA 2INPE 4CQNA 2KFJA 4RGMA 1UH6A 1IP9A 4NZLB 2WDVB 2GLSA 2DWQA 2K5PA 4HROA 2D2QA 1L5PA 2LMCA 2R2QA 2A5UA 1P1AA 2D5GA 2PTLA 2INCC 2PVGC 4TQ0A 4S0RA 3UQBA 1M94A 4N6EB 2I1JA 5FR6A 1MG8A 1YX6B 2JT4B 2KDMA 2NPTA 2VZKD 5E6NA 3LDZE 4M8NA 4EUTA 4S17A 1IPGA 3NZTA 3A4SC 4WQMA 4KIKA 1OFFA 2PLPA 1D3ZA 3ZGZA 1SJED 3L10B 4TMAB 2KN5A 4ZYNA 3JSVB 1Q1OA 4GDLB 4L2YA 2LEKA 4YTMB 4K3CA 3CWIA 4ZDVA 2H89B 2XNAC 2A4ZA 4FJYA 2ZCBA 1MHHE 4HDOA 3RNEC 3UGBB 5AEKB 3TJPA 3EHVA 3IVFA 2FUG1 4DXGA 3RNCC 3N32A 1ET9A 3EFCA 4HCNB 4ZHOA 5J2RA 4W9HA 2N1VA 1DOIA 1WY8A 2N9EB 2RR9A 1XCTL 2WDTB 2DZJA 3AE2B 1YOVB 2WXJA 2IGDA 1NEKB 4WQOB 1L0XB 1WX9A 5J18A 3PV1A 4XE0A 1WIAA 2JUOA 4K7UA 2EELA 4GW2A 3AU4A 1XXGA 2UYZB 4LJPB 3NG0A 3V6EB 4JPSA 4GN1A 4ANXA 1TIFA 1ZE3D 1VCBA 3OG5A 2CRKA 2ON8A 2VZKB 3SFEB 2L8JA 1TZOA 1V80A 4NAWA 4IM0A 1WX7A 3PVLA 1X1MA 2IGGA 5G5HA 3DBLB 4I6NB 4MT5A 3ZYYX 3VRAB 1KLGD 3Q3NC 1GB4A 2ZVNA 1IGDA 1K50A 5GXGB 2L7RA 2PEAA 3HRDD 1EU3A 5G55A 3LN6A 3PTFC 4OZCA 3WA0A 1UGMA 3DHGC 1EM7A 5C1ZA 1VRPA 2WHIA 2GBNA 3WANA 1Z2MA 1XLPA 2WDRB 2M8SA 1ZOYB 3PZDA 2C60A 1UBQA 2HTHA 3W9CB 2JRIB 4AJWA 2BB6A 3BK2A 3APCA 3U30A 1FNVA 1AN8A 1P0RA 3AM9A 3NUHB 2K8BA 1NBFC 2LGSA 1QILA 4ANVA 3M95A 4IG7B 1XO3A 4WWPA 3APDA 4N59A 4DDID 4FHJA 5HFYA 3C19A 5C23A 2KDIA 2IY1B 1SE9A 3ZNGC 2NBWB 2KN4A 4L23A 3LVWA 3GS2A 1HEZE 2LJIA 2M19A 2CHXA 3NRZA 3ZTDA 2JRHA 2KLCA 3GB1A 2MJDA 3B2GA 1CMXB 4OVVA 3RN9C 2LGYA 2KJRA 3MHSD 4GOCA 4IWQA 4IM3A 3Q3FA 4MGZE 2MLBA 1QT9A 2AL6A 2K22A 3DVGX 4I6LB 4XGAB 2UWQA 5JHAA 5KHQA 4P16A 2DBYA 1NENB 1YQ3B 1TKEA 4WWOA 2WXHA 3VH4B 1WGHA 4J3OD 2LJ5A 4G0NB 4ITKA 3JQ3A 3P42A 4LDTD 1SIJA 3O13A 1M4VA 4HXDA 4RGTA 4C7YA 4XZ4A 2WXIA 2KFKB 2FE8A 4W9LA 3AEDB 1TY2A 4K7WA 3I5JC 3AB5A 3ZNID 1WJUA 3BWUD 3KW5B 4II3B 3NOBA 1KRHA 3B9JA 4G11A 2L00B 4MGKE 2FNJB 1V81A 4TKNA 1WGKA 3GZNB 2D10A 3EGRA 2C5LC 4M0WA 1ZKHA 2PPHA 2KX0A 1YN3A 1ESFA 1SBBB 2M17A 2ZJDA 3RPFC 4KKJA 4HLEA 1JRUA 5T8IA 3DBHB 1VZ8A 2MBQA 3IFWB 2NVUI 4OW0A 4DQOC 5IOIA 4DBGA 2ONQA 3UI3A 2XN9C 2KLGA 1AWDA 4YT0B 3ZQ4A 2BBCA 4XX5A 1TS4A 3A1QA 4HVBA 3QIJA 5AZGA 3B08A 4LNNA 3U52E 4O1NA 2KAJA 4MSQB 1VRAB 4PYZA 1JCKB 2KANA 1FNWA 3FC4A 2KNBA 2N9XA 1CQVA 2WQYB 1BG0A 4LDTB 3N1ZC 2FBWB 3Q14C 4WAAA 3R7QA 2B3AA 3VXWA 4IM2A 3T3OA 2IO3B 2BYEA 3NVZA 3HM6X 4KGTA 1JWAD 2ZCCA 2IJ0A 1E7UA 3K9PB 1V1OA 2J7QB 3NY5A 5LXIB 1I0EA 2J42A 3U4EG 4M0WB 4GSWA 2KVRA 3OLMD 1I42A 3PREA 2DZMA 2INDC 1AARA 2KVZA 1SIFA 3KWVA 2MBHA 2KDBA 1WR6E 2LGIA 1FFVA 4JL9A 1TZ1A 5BO4B 4C00A 3GE8C 3SD5A 2N9PC 3Q6BA 2D3GA 5JXVA 1IBXB 4K81A 3BVGA 2CS4A 1T6BX 1MVKA 2PVOD 1I7HA 4ARIA 1YJIA 3N1XC 3Q3MC 2DAJA 4II2B 3RUIB 2QCZA 1T0QC 1TJEA 3P1MA 4XDCA 4J6IA 4NY0A 2I1KA 4MACA 4GIVA 4NJCA 2JQRB 5IAAC 3DVNV 2M1MA 2RPVA 1J7AA 1UBIA 1JALA 2JWZA 2WXQA 3CF6E 2DZIA 3IAM1 1LO5D 3BYTB 1QH4A 2RDBC 1ZGUB 4RF7A 3ZJUA 4B6WA 4BVUC 5D6JB 4MJSB 2MWSB 4TUUA 1Y56A 2WXGA 1T0RC 2KMMA 4HCPB 3H1UA 4QAYA 5FKAC 1B9RA 4YSXB 5D94A 2LFIA 4F7ZA 4UDUC 4DHJD 3J9CA 2YVCA 1R4MI 1BUIC 1FMAD 3AI5A 1FPYA 3AE4B 3R2IA 4CHKA 1HQRD 2W54A 4US9A 4F1SA 2ZPYA 3UIPB 3AULA 3PLVA 4MSMB 3R3MA 2GRIA 2MP2B 3L4PA 4GDKB 3RMKC 1NVID 4DK5A 3AEGB 2OOBB 5C3JB 3RD2A 2K1FA 1K51A 2BWES 1D5ZC 5CX3A 2BF8B 1YNTE 2VH1A 2CJNA 3W5UB 1P98A 4N9F4 3GP7A 1SXTA 2K8CA 2LVQA 3H7SA 1SD0A 3DVNU 2MQJA 4EZKA 1GOZA 3QA8A 4JE3B 3IG8A 5GMVA 3TCAA 2BKRB 2OHFA 4USAA 3ZRCA 3AECB 3CMMB 5TR5A 4W9IA 2Z8LA 1Q0WB 3BIID 5D7GA 4FA6A 1WJ6A 4P1BC 1RFKA 2AQ1B 4GXBA 4Q2JA 4A3OA 2EKEC 3HM3A 2G4SA 2XBBC 2RD0A 1YN4A 4A6QA 5IP4D 2M56B 1ZXIA 2XK5A 1AYFA 4LJOB 4KZ0A 2WXLA 4FJZA 2XEWA 2M4NA 1T0YA 2KJHB 2YLMA 2KX3A 2EKIA 3FKYA 3TEWA 1MHXA 3C0RB 1P3QU 2W9NA 3LXFA 5HG2A 1N63A 1QOGA 2IO2B 3IT4B 1YX5B 1XLNA 1BT0A 4M02A 2VRRB 4BFRA 1PFDA 2W55A 1P9DU 5AUIA 1UGJA 3ZJTA 4NQLB 5FR3A 4MH8A 2LRWA 2Y5BB 4H2AA 1EWYC 1E0ZA 4W9DA 4ZRKA 2BWFA 4MGYE 2WXFA 1QKZA 3PGEA 1RFAA 3Q3JA 1C1YB 3IAS1 3DVGY 3IG5A 3I9V1 1STEA 3M62B 2FUHB 4OZBA 5EE9A 2SEBD 1WMHB 2WGSA 4EEWA 5E6PA 1WR1A 5BYRA 5HKHA 4RF9A 1GUAB 3W5VB 3CSFA 4HJKA 1TBEA 3P2BA 2NBUA 2N7JA 2IZVB 4RH6A 4L1BA 5CHWA 2HJ1A 3ENEA 2NBVB 4IW0A 2I38A 1CRKA 1NYRA 3RFZB 1MG4A 5L83A 3L17A 3W1YA 1XF5L 4IWPA 3V60A 5J9AA 2JVCA 3X23A 1ISNA 3FILA 4BHLA 1L6UA 3K9OB 4GVYA 5IO9A 4JIOU 3AE1B 2BKFA 2BPSA 2J4XA 4JLCA 2WXKA 3H6NA 4PS8A 4XC2A 2BS3B 3MFGA 1JWBD 4WJNA 2SAKA 3HIZA 3ZIMA 4KSKC 1TYGB 3P4RB 2KMCA 1ZPSA 4TV3A 4GMVA 5E6OA 3L2EA 1DYQA 1TS3A 2KZRA 1UWMA 4LNKA 3PT2B 2D32A 4MM3B 3PZ8A 2O2VB 3VUYA 1B1ZA 3OWEB 4BG4A 1DOXA 4FBJB 5JHBA 2GB1A 1TS5A 2PKOA 1NI3A 4LNOA 2MBEA 3AE7B 4YTPB 2EMTA 4IOIE 2AYOB 4WURA 2NPTB 4HWIB 2O6VA 4WJOA 1OTRB 2YEPF 4HDQA 4BBNF 4KZCA 3VUXA 1FNUA 3HHMA 5BMIA 2OJRA 4ICUA 4KIKB 4GB9A 1L6VA 2L83A 1C4AA 4BKSA 1N60A 1C79A 2Q5WD 4YL8A 4OVZA 4FHKA 2NTSA 2N0SB 4LNIA 1C4PA 3V6CB 1FXIA 1OQRA 2KD0A 5CHFA 1R7SA 1KFYB 3GOEA 3Q8BA 4LK0M 3QK0A 2N9LA 5EDSA 5EE1A 2NTTA 4PYUA 1KOTA 2MBBB 3NS8A 3DBLI 4Q2RA 2MRPA 1EO6A 2GBJA 2RPQA 3T9LA 2RDGA 4BG4B 4ZRIA 3AE8B 2V9HA 1WGYA 3T8MA 3MTNB 2C7MB 3Q8CA 1D4BA 3N30A 5JH5C 1ZUD2 1V97A 2GMIC 4BBNC 1HZ6A 4BAXA 1NDDA 4DHZE 1KH0A 3MJ5A 3PRZA 1D6EC 2OJWA 4NPNA 2X8XX 2GBKA 2LRUA 2WNMA 2J1QA 1VZ6A 3ETRA 1FRDA 4NAWB 2MCNB 1WZ3A 2KC2A 3NS1A 1R4NI 3VR8B 2LXAA 4WJPA 5D3IB 2DYBA 3P63A 1NYQA 4ARCA 1J7BA 1I4GA 1PGAA 4RGNA 1YMHE 3DHHC 1FRRA 4YXDB 1WH3A 1V86A 3NZSA 2DAFA 2L32A 2KDFB 2JY6A 3CIRB 1TY0A 4GLSC 1E90A 3IXSA 2YEPB 4K3BA 1SE4A 3FAHA 1RWSA 5AZFA 1GB1A 4HEA1 2N7DA 2D11A 4X57B 2B76B 3QAQA 5G5GA 1QOFA 2NMQA 2GBRA 3M63B 1N5XA 1L4DB 2G3QB 3RZFA 4A8XC 1WJ4A 4RM9A 1UWXA 3SR6A 1WYWB 5CHVC 3R8BA 2RDHA 1N5WA 4R3DA 3AXCA 3VH3B 3SEBA 3TSSA 1SE2A 3HVZA 2JZZA 4JWSC 3DQVA 4YWGG 2Z0EB 3PSEB 4W9KA 1YIWA 2R61A 3TL5A 5EE0A 2AWTA 1L2NA 5LLIA 1GC7A 2JYEA 1LFDA 3MJWA 2FCQA 4GGQA 3RT3B 1D5MC 5I4DA 2WDQB 4LNFA 1EWCA 2N7EA 2RMMA 3C8YA 1C4CA 4C56C 3VAWA 1E9MA 2JPHA 2GWCA 1WE7A 3RULA 3ZW3A 1V5TA 1ZDXA 3A9KA 2DZKA 3JU6A 1KM7A 3BVMA 1Z5SB 1HTOA 1ZW7A 4W9FA 4B9KA 3SFDB 2IPKD 4OHJA 3L2DA 1KJTA 1TKYA 2BYVE 2PIAA 1S1QB 3OAWA 4NJ7A 2BTEA 2Y5PA 2LI5A 1SB3C 2LHDA 2ZVOA 3VVWB 1QLBB 1MPEA 1K52A 2NS5A 3QHTA 2LASA 2BS2B 3EFUA 1C9FA 4BOZB 3GE3C 2L1AA 3NVYA 1A70A 3I57A 5DCNA 1KLVA 2CHZA 2HJ8A 1TTNA 4WJQA 2QSDA 2WX0A 5L95C 3ONSA 1ET6A 1UNSA 3RYTA 2KJ6A 5C2TB 5J99A 1QZEA 3IG3A 2KYWA 3Q8AA 3BZDB 3VDZA 4E3CA 1I4RA 1PGBA 1ZP0B 2KK8A 1YN5A 1PUTA 2GWDA 3H8HA 2JZPA 3PLUA 3ECIA 3H9DA 1YJ1A 3AEBB 1LXDA 2J53A 2IO1B 4A3PA 1L4ZB 4B95A 1UELA 3A1QB 1LQBA 1F2RI 4FULA 1WFYA 3LJ3A 3DBSA 3QQ8B 1SJHD 1YQ4B 2C7NB 4C80A 5HI1A 2VH2A 2G1EA 5HHDG 3M3JA 1VA6A 1TGZB 5BMGA 4DXFA 3NVVA 1T0SC 3SDLC 3AEAB 2K6QA 5CTRC 4URKA 1P7EA 1OQQA 2E3TA 2DLBA 2LHEA 3KUZA 4LTUA 3DBRB 1JROA 1HE8A 2MJEA 4G50A 5IA7A 2KWVB 2M0AA 1XD3B 3A9JA 1SEBD 3V05A 2KO3A 2KTFA 2ICIA 2ACZB 4MGIE 1F0ZA 2WXOA 1OEYA 2PW9A 2RGFA 2N4FA 4G3XB 1OEYJ 4JGHB 3M10A 2CR5A 4AWJA 2INNE 4WIPA 1V1PA 2NCNA 3L13A 1P50A 1P52A 5EE3A 1RM6C 3RI7C 3JYUA 2DYMA 3KWLA 1V6EA 4C4VA 1L7YA 3LVVA 1L0YB 3N9YC 1F52A 4WH4A 4BZAA 2KQ4X 4BKGA 3B2FA 1QQRA 4P6VF 2KTRA 2WLBA 2ZNVC 3WAOA 1N62A 1XQQA 4CYEA 4HRSA 4ASWC 2LUEA 4ANWA 2R2OA 2OEDA 1IUEA 2IY0B 4AS1A 4B0MA 1VZ7A 3KUCB 2V3PA 3URYA 4JWUC 3W1SA 2ZPNA 1VLBA 5TSSA 4XDDA 4FLHA 1VD2A 2BS4B 4RF0A 1U4AA 4NJ6A 4RF8A 3HK0A 4AP4C 2HDEA 1C3TA 3BYYB 4KGRA 4YSZB 3QC8B 5LNK1 3VR9B 4GU2A 3TUOA 3QCAA 5AUKA 4TQ1A 4IC7B 3IHPC 1WM2A 3N20C 3KYCD 3Q69A 3EECA 4E71A 2PE6B 2UU7A 2MBOA 2K39A 4GDLA 3EUB2 4ZRJA 3S2AA 2ZNVB 4OZAA 3RNFC 2WXMA 2LVPA 4KGSA 1P7FA 1FXTB 3KQ4A 3MC0B 2LGDA 4EFOA 5IKCM 1UUPA 3AMZA 1ROEA 1KLUD 4ZRPA 4XYCA 2C9WB 2WU5B 2CHWA 3DCGA 3V61A 3VQIA 2LXCA 3E9SA 3LB8C 1QOAA 4ZRQA 2ZW1A 3PHWB 4HJGE 2KWDA 3CSTA 2XK5B 2G9HD 4YSYB 1HA5A 1XEEA 2KHWB 2CKHB 2D3AA 3BK1A 1HTQA 4A9AA 5KHOA 2REXA 4GW0A 1FCCC 1E8XA 4FXCA 1WXAA 2HTME 1JQ4A 1MFWA 4N58A 2LWPA 4MDKE 1GC6A 3X0WA 3AU5A 2W82A 2WXRA 2BYFA 3E56A 3R2TA 1MJDA 4REZA 3WAMA 1YQBA 1VJKA 3AE3B 1HZ5A 3NZUA 1HXYD 3TMPB 2IBIB 4XWWA 2K0PA 2W3SA 5H92C 4EE2A 5IN7A 1WRDB 3PHXB 1SF0A 5J17A 3VHTC 4OVUA 1Q5WB 2D07B 1XLQA 1G0WA 1BMLC 4RCOA 2DHZA 2X38A 2KQ7A 2PE9A 2QIEB 1GNUA 3Q3OC 1F9JA 2Y5CA 1WRIA 2FCSA 1UD7A 4PS7A 2I2YA 3NHEB 1YD8U
chains in the Genus database with same CATH topology
4RF8A 4GW0A 4RF7A 1FPYA 3L2EA 3L2EB 1BG0A 3NG0A 4RF6A 4BHLA 2D3BA 4S0RA 4BAXA 4LNKA 3ZXRA 4GVYA 4LNIA 1QK1A 3DRBA 4Q2RA 4AM1A 2BVCA 4ACFA 1SD0A 3B6RA 3ZXVA 3L2DA 3M10A 2OJWA 2D3CA 1VRPA 3JPZA 2LGSA 4BG4B 4GVZA 2WHIA 1CRKA 2CRKA 4BG4A 4LNNA 1G0WA 1F52A 3DREA 5J99A 3JU6A 4S17A 1M15A 2J1QA 2WGSA 2GLSA 1U6RA 4LNFA 4XYCA 2QC8A 4HPPA 1RL9A 1P50A 4LNOA 4Z9MA 1P52A 2D3AA 4RF9A 1I0EA 3JQ3A 3FKYA 1QH4A 1LGRA 1HTQA 3JU5A 1HTOA 5J9AA 1F1HA 4GW2A 2UU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF8 A;  4GW0 A;  4RF7 A;  1FPY A;  3L2E A;  3L2E B;  1BG0 A;  3NG0 A;  4RF6 A;  4BHL A;  2D3B A;  4S0R A;  4BAX A;  4LNK A;  3ZXR A;  4GVY A;  4LNI A;  1QK1 A;  3DRB A;  4Q2R A;  4AM1 A;  2BVC A;  4ACF A;  1SD0 A;  3B6R A;  3ZXV A;  3L2D A;  3M10 A;  2OJW A;  2D3C A;  1VRP A;  3JPZ A;  2LGS A;  4BG4 B;  4GVZ A;  2WHI A;  1CRK A;  2CRK A;  4BG4 A;  4LNN A;  1G0W A;  1F52 A;  3DRE A;  5J99 A;  3JU6 A;  4S17 A;  1M15 A;  2J1Q A;  2WGS A;  2GLS A;  1U6R A;  4LNF A;  4XYC A;  2QC8 A;  4HPP A;  1RL9 A;  1P50 A;  4LNO A;  4Z9M A;  1P52 A;  2D3A A;  4RF9 A;  1I0E A;  3JQ3 A;  3FKY A;  1QH4 A;  1LGR A;  1HTQ A;  3JU5 A;  1HTO A;  5J9A A;  1F1H A;  4GW2 A;  2UU7 A; 
#chains in the Genus database with same CATH topology
 1V49 A;  5D3D A;  1V2Y A;  2M0X A;  3U8Z A;  2O6V D;  4RMA A;  2L76 A;  1WE6 A;  1V4G A;  5H8Y E;  3PRM B;  1WGR A;  3AEE B;  1QOB A;  2KAC A;  4HPL B;  5JZE B;  1E6E B;  3RNG C;  4XWT A;  3TEX A;  4BKS D;  2L0T A;  2ZZP B;  1SGH A;  4IUM B;  5AZH A;  4W9E A;  3FIL B;  1KF6 B;  1EF5 A;  2DYO A;  3QJZ A;  3ZVV A;  3ABV B;  3WAL A;  1E8Y A;  3DWM A;  3MP9 A;  3U2S C;  2G4D B;  4KX6 B;  3KLS X;  3ML8 A;  2L52 A;  2MJ3 A;  1C76 A;  1WXM A;  3AE6 B;  2LUM A;  1N6Z A;  1F1H A;  4AJY B;  2AL3 A;  4ZOH C;  3L2E B;  4TSS A;  4WAF A;  2JXX A;  2G45 B;  1I4H A;  3APF A;  4MEL A;  2MSE D;  4RM8 A;  4BKT A;  1K53 A;  4KVG B;  3H7P A;  2QHO A;  2PMV A;  3LYY A;  3VTW A;  2K3U A;  4ZHP A;  4DXA B;  1E7V A;  1PYW D;  1OGW A;  3BIN A;  3UIO B;  1E10 A;  1F77 A;  2Z0D B;  4W9G A;  4IDI A;  2JU6 X;  3ZDM C;  3AH7 A;  1WJN A;  2O6V B;  2QJL A;  3QX1 A;  1M15 A;  2WS3 B;  1R4N B;  4KSL C;  3BVZ A;  3BY4 B;  1KTK A;  3DPD A;  4ZYS A;  2J52 A;  3MC9 A;  1WM3 A;  4PT5 A;  2DNF A;  2L0F A;  2MW5 A;  4ANU A;  2KFK A;  4HK2 A;  1Q10 A;  1JWS D;  1I4P A;  2FAZ A;  3PRP B;  1WXV A;  3WIM A;  3SHQ A;  3ZKJ C;  1VDV A;  4KDI C;  1WF9 A;  4KDL B;  4E74 A;  1RL9 A;  3A4R A;  4AQ7 A;  4JQW C;  4MEM A;  1CK1 A;  3D32 A;  4RF6 A;  2KDE B;  2BW2 A;  5DPW A;  1JML A;  1SSN A;  3VRB B;  3H7P B;  4P1C C;  1FD6 A;  1J8C A;  1N61 A;  1ACC A;  1EU4 A;  1UZX B;  2K9X A;  2JSV X;  2DEN B;  2AX5 A;  1XLO A;  2MH7 A;  4HPM B;  3ZNH B;  1TT4 A;  1J0G A;  1SE3 A;  1LGR A;  4LCD E;  3KH0 A;  3L54 A;  1V5O A;  2LVO A;  2KMA A;  2N9K A;  1WYG A;  3EA6 A;  1GPX A;  4YTN B;  2EMS A;  2WXN A;  3UF8 A;  3ML9 A;  1L0V B;  2KKC A;  1JWM D;  3T3N A;  3N3K B;  3A33 B;  3Q8E A;  2IDY A;  4M8M A;  2QEJ C;  3PO0 A;  3V3X A;  3ZUN A;  2WP9 B;  3W2D A;  2K8H A;  4PS3 A;  3ZLZ A;  1T5X D;  2N1W A;  2CJO A;  3IT6 B;  1JWU D;  3DRB A;  1WXQ A;  2Z59 B;  1JW9 D;  1PGX A;  3AE5 B;  5DPS A;  3L0W B;  1RAX A;  1ZDV A;  2K25 A;  1H8C A;  3AN1 A;  4KKI A;  3U7D A;  3NZ3 A;  4B0E A;  1U6R A;  1S3S G;  2JZ3 B;  3ZTC A;  1G6J A;  3UQA A;  4I6P A;  3I63 C;  2C7H A;  2DX5 B;  2TSS A;  1GJZ A;  5G2N A;  1ZXH A;  3U7Z A;  3VFK A;  4DHZ B;  3GZN I;  1UF0 A;  2JF5 A;  3VTU A;  2L3Z A;  2D3C A;  3TIX A;  1E5W A;  2FCM A;  3I3T B;  3KVF B;  1V9J A;  3DRE A;  4AOF A;  1D5X C;  3Q2A C;  1Y8R C;  5BYS A;  2JXT A;  2QC8 A;  1F2R C;  5BYQ A;  1IBX A;  2V3S A;  1JRP A;  3AE9 B;  1FO4 A;  4K1R B;  3JU5 A;  5BMH A;  4EOY A;  3DBH I;  2BYT A;  1TKG A;  4HKZ E;  2V0G A;  3VUW A;  2AEH A;  1J19 A;  4DWF A;  3ZXV A;  2Y3A A;  1H4R A;  2GBM A;  2CU3 A;  1FEH A;  5MPO A;  3QAR A;  1QF6 A;  4M00 A;  4A55 A;  1FXA A;  2J0J A;  2KWU B;  4P7I A;  3V62 A;  2V1Y A;  1GAQ B;  3HUI A;  1WGG A;  1EF1 A;  4MJS A;  2LD9 A;  1TS2 A;  3OJ3 A;  3UIN B;  3B0A A;  4W9J A;  2FIF A;  3L16 A;  1PDX A;  2GOW A;  1E8Z A;  3NVW A;  2HE7 A;  1WX8 A;  1K8R B;  4US8 A;  2W3R A;  2WWZ A;  4F8C B;  1C78 A;  4HPP A;  1XT9 B;  4RF1 A;  4Z9M A;  1FFU A;  1YJJ A;  2H88 B;  2MEK A;  1E7P B;  3LN7 A;  3NJT A;  2QMT A;  4FN2 A;  1RLF A;  2L05 A;  1FCL A;  1WSP A;  2MP2 A;  4GDK A;  3A9K B;  3ZJV A;  3N1Y C;  1LM8 B;  4JX1 C;  1T3Q A;  3ZRF A;  2FCN A;  2QIL A;  2CU1 A;  3AV8 A;  2GI9 A;  1NI2 A;  1V8C A;  3RCZ A;  3RNB C;  2FID A;  2JYT A;  1J7C A;  2WX1 A;  2KWC A;  1CJE A;  2KXJ A;  4PK1 A;  3PPA A;  1R4M B;  2HD5 B;  2LGX A;  1I4X A;  1EUV B;  2IYD B;  3P4P B;  2WXP A;  1DOY A;  1MI0 A;  4NNJ B;  2ZW0 A;  5LXH A;  3ALB A;  1WXS A;  3AEF B;  3P4Q B;  1FIQ A;  3P4S B;  4ACF A;  4EKU A;  1I35 A;  3B1L X;  4GVZ A;  1I4Q A;  3DBR I;  4M01 A;  4EZL A;  3WAP A;  3ZDT A;  3PS6 A;  3VTV A;  1IGC A;  1WGD A;  3HVD A;  1DGJ A;  3TEY A;  4LLG M;  3WCQ A;  2E6X A;  3ZNZ B;  3O65 B;  3Q8F A;  4CO7 A;  1C77 A;  2J0M A;  2BVC A;  2WU2 B;  1WWT A;  2AQ3 B;  3DHI C;  5DPR A;  2RSU A;  3R66 C;  3QWZ B;  2MX2 A;  4A90 A;  2LZ6 A;  2KQS A;  4ICV A;  3EC8 A;  2J0K A;  4W9C A;  1FM0 D;  4IKG A;  2BQQ A;  1WZ0 A;  2BT6 A;  4NQK E;  2WYQ A;  1CZP A;  4MH0 E;  3JPZ A;  3DOW A;  3SU8 X;  2BB5 A;  1E8W A;  3ZO5 B;  1WMH A;  4RFB A;  1A5R A;  4D2K A;  3JVZ X;  3A9J B;  1GG3 A;  1RYJ A;  3OJ4 B;  2IO0 B;  4RNA A;  2JX5 A;  2ZEQ A;  2BGF A;  2V3N A;  2MHJ A;  3RNA C;  1ENF A;  3JW0 X;  4C7Z A;  3DWG C;  2IGH A;  1QK1 A;  5D2M B;  4AM1 A;  3W1S C;  1VR9 A;  4EZJ A;  1R8G A;  4A20 A;  2K6D B;  1IYF A;  4HKQ A;  2QDF A;  2AQ2 B;  2PJH A;  5E6J A;  1V1P B;  3PZ7 A;  4K7S A;  2KOX A;  4IWO A;  3R7R A;  3L08 A;  2MA9 B;  1RRB A;  4DHJ B;  3KUD B;  4AUQ C;  4BOS C;  4DDG D;  4NAM A;  4KV2 A;  3JSV A;  2D3B A;  3IBE A;  2ASQ A;  2V4L A;  4FAD A;  3MC8 A;  3DDC B;  3RZW C;  4C4V B;  3KYD D;  2JWU A;  1AW7 A;  4FJV B;  4WWM A;  2KT7 A;  5FK9 C;  2KTR B;  1XCQ L;  4RGO S;  1OQY A;  3MHZ A;  1TT5 B;  1BXT A;  3TEZ A;  1PQS A;  3B6R A;  5DPT A;  3TBL D;  2KC1 A;  2NR2 A;  1WI0 A;  2D33 A;  3ZXR A;  4MM3 A;  2V4I B;  4WWN A;  2O2V A;  2INP E;  4CQN A;  2KFJ A;  4RGM A;  1UH6 A;  1IP9 A;  4NZL B;  2WDV B;  2GLS A;  2DWQ A;  2K5P A;  4HRO A;  2D2Q A;  1L5P A;  2LMC A;  2R2Q A;  2A5U A;  1P1A A;  2D5G A;  2PTL A;  2INC C;  2PVG C;  4TQ0 A;  4S0R A;  3UQB A;  1M94 A;  4N6E B;  2I1J A;  5FR6 A;  1MG8 A;  1YX6 B;  2JT4 B;  2KDM A;  2NPT A;  2VZK D;  5E6N A;  3LDZ E;  4M8N A;  4EUT A;  4S17 A;  1IPG A;  3NZT A;  3A4S C;  4WQM A;  4KIK A;  1OFF A;  2PLP A;  1D3Z A;  3ZGZ A;  1SJE D;  3L10 B;  4TMA B;  2KN5 A;  4ZYN A;  3JSV B;  1Q1O A;  4GDL B;  4L2Y A;  2LEK A;  4YTM B;  4K3C A;  3CWI A;  4ZDV A;  2H89 B;  2XNA C;  2A4Z A;  4FJY A;  2ZCB A;  1MHH E;  4HDO A;  3RNE C;  3UGB B;  5AEK B;  3TJP A;  3EHV A;  3IVF A;  2FUG 1;  4DXG A;  3RNC C;  3N32 A;  1ET9 A;  3EFC A;  4HCN B;  4ZHO A;  5J2R A;  4W9H A;  2N1V A;  1DOI A;  1WY8 A;  2N9E B;  2RR9 A;  1XCT L;  2WDT B;  2DZJ A;  3AE2 B;  1YOV B;  2WXJ A;  2IGD A;  1NEK B;  4WQO B;  1L0X B;  1WX9 A;  5J18 A;  3PV1 A;  4XE0 A;  1WIA A;  2JUO A;  4K7U A;  2EEL A;  4GW2 A;  3AU4 A;  1XXG A;  2UYZ B;  4LJP B;  3NG0 A;  3V6E B;  4JPS A;  4GN1 A;  4ANX A;  1TIF A;  1ZE3 D;  1VCB A;  3OG5 A;  2CRK A;  2ON8 A;  2VZK B;  3SFE B;  2L8J A;  1TZO A;  1V80 A;  4NAW A;  4IM0 A;  1WX7 A;  3PVL A;  1X1M A;  2IGG A;  5G5H A;  3DBL B;  4I6N B;  4MT5 A;  3ZYY X;  3VRA B;  1KLG D;  3Q3N C;  1GB4 A;  2ZVN A;  1IGD A;  1K50 A;  5GXG B;  2L7R A;  2PEA A;  3HRD D;  1EU3 A;  5G55 A;  3LN6 A;  3PTF C;  4OZC A;  3WA0 A;  1UGM A;  3DHG C;  1EM7 A;  5C1Z A;  1VRP A;  2WHI A;  2GBN A;  3WAN A;  1Z2M A;  1XLP A;  2WDR B;  2M8S A;  1ZOY B;  3PZD A;  2C60 A;  1UBQ A;  2HTH A;  3W9C B;  2JRI B;  4AJW A;  2BB6 A;  3BK2 A;  3APC A;  3U30 A;  1FNV A;  1AN8 A;  1P0R A;  3AM9 A;  3NUH B;  2K8B A;  1NBF C;  2LGS A;  1QIL A;  4ANV A;  3M95 A;  4IG7 B;  1XO3 A;  4WWP A;  3APD A;  4N59 A;  4DDI D;  4FHJ A;  5HFY A;  3C19 A;  5C23 A;  2KDI A;  2IY1 B;  1SE9 A;  3ZNG C;  2NBW B;  2KN4 A;  4L23 A;  3LVW A;  3GS2 A;  1HEZ E;  2LJI A;  2M19 A;  2CHX A;  3NRZ A;  3ZTD A;  2JRH A;  2KLC A;  3GB1 A;  2MJD A;  3B2G A;  1CMX B;  4OVV A;  3RN9 C;  2LGY A;  2KJR A;  3MHS D;  4GOC A;  4IWQ A;  4IM3 A;  3Q3F A;  4MGZ E;  2MLB A;  1QT9 A;  2AL6 A;  2K22 A;  3DVG X;  4I6L B;  4XGA B;  2UWQ A;  5JHA A;  5KHQ A;  4P16 A;  2DBY A;  1NEN B;  1YQ3 B;  1TKE A;  4WWO A;  2WXH A;  3VH4 B;  1WGH A;  4J3O D;  2LJ5 A;  4G0N B;  4ITK A;  3JQ3 A;  3P42 A;  4LDT D;  1SIJ A;  3O13 A;  1M4V A;  4HXD A;  4RGT A;  4C7Y A;  4XZ4 A;  2WXI A;  2KFK B;  2FE8 A;  4W9L A;  3AED B;  1TY2 A;  4K7W A;  3I5J C;  3AB5 A;  3ZNI D;  1WJU A;  3BWU D;  3KW5 B;  4II3 B;  3NOB A;  1KRH A;  3B9J A;  4G11 A;  2L00 B;  4MGK E;  2FNJ B;  1V81 A;  4TKN A;  1WGK A;  3GZN B;  2D10 A;  3EGR A;  2C5L C;  4M0W A;  1ZKH A;  2PPH A;  2KX0 A;  1YN3 A;  1ESF A;  1SBB B;  2M17 A;  2ZJD A;  3RPF C;  4KKJ A;  4HLE A;  1JRU A;  5T8I A;  3DBH B;  1VZ8 A;  2MBQ A;  3IFW B;  2NVU I;  4OW0 A;  4DQO C;  5IOI A;  4DBG A;  2ONQ A;  3UI3 A;  2XN9 C;  2KLG A;  1AWD A;  4YT0 B;  3ZQ4 A;  2BBC A;  4XX5 A;  1TS4 A;  3A1Q A;  4HVB A;  3QIJ A;  5AZG A;  3B08 A;  4LNN A;  3U52 E;  4O1N A;  2KAJ A;  4MSQ B;  1VRA B;  4PYZ A;  1JCK B;  2KAN A;  1FNW A;  3FC4 A;  2KNB A;  2N9X A;  1CQV A;  2WQY B;  1BG0 A;  4LDT B;  3N1Z C;  2FBW B;  3Q14 C;  4WAA A;  3R7Q A;  2B3A A;  3VXW A;  4IM2 A;  3T3O A;  2IO3 B;  2BYE A;  3NVZ A;  3HM6 X;  4KGT A;  1JWA D;  2ZCC A;  2IJ0 A;  1E7U A;  3K9P B;  1V1O A;  2J7Q B;  3NY5 A;  5LXI B;  1I0E A;  2J42 A;  3U4E G;  4M0W B;  4GSW A;  2KVR A;  3OLM D;  1I42 A;  3PRE A;  2DZM A;  2IND C;  1AAR A;  2KVZ A;  1SIF A;  3KWV A;  2MBH A;  2KDB A;  1WR6 E;  2LGI A;  1FFV A;  4JL9 A;  1TZ1 A;  5BO4 B;  4C00 A;  3GE8 C;  3SD5 A;  2N9P C;  3Q6B A;  2D3G A;  5JXV A;  1IBX B;  4K81 A;  3BVG A;  2CS4 A;  1T6B X;  1MVK A;  2PVO D;  1I7H A;  4ARI A;  1YJI A;  3N1X C;  3Q3M C;  2DAJ A;  4II2 B;  3RUI B;  2QCZ A;  1T0Q C;  1TJE A;  3P1M A;  4XDC A;  4J6I A;  4NY0 A;  2I1K A;  4MAC A;  4GIV A;  4NJC A;  2JQR B;  5IAA C;  3DVN V;  2M1M A;  2RPV A;  1J7A A;  1UBI A;  1JAL A;  2JWZ A;  2WXQ A;  3CF6 E;  2DZI A;  3IAM 1;  1LO5 D;  3BYT B;  1QH4 A;  2RDB C;  1ZGU B;  4RF7 A;  3ZJU A;  4B6W A;  4BVU C;  5D6J B;  4MJS B;  2MWS B;  4TUU A;  1Y56 A;  2WXG A;  1T0R C;  2KMM A;  4HCP B;  3H1U A;  4QAY A;  5FKA C;  1B9R A;  4YSX B;  5D94 A;  2LFI A;  4F7Z A;  4UDU C;  4DHJ D;  3J9C A;  2YVC A;  1R4M I;  1BUI C;  1FMA D;  3AI5 A;  1FPY A;  3AE4 B;  3R2I A;  4CHK A;  1HQR D;  2W54 A;  4US9 A;  4F1S A;  2ZPY A;  3UIP B;  3AUL A;  3PLV A;  4MSM B;  3R3M A;  2GRI A;  2MP2 B;  3L4P A;  4GDK B;  3RMK C;  1NVI D;  4DK5 A;  3AEG B;  2OOB B;  5C3J B;  3RD2 A;  2K1F A;  1K51 A;  2BWE S;  1D5Z C;  5CX3 A;  2BF8 B;  1YNT E;  2VH1 A;  2CJN A;  3W5U B;  1P98 A;  4N9F 4;  3GP7 A;  1SXT A;  2K8C A;  2LVQ A;  3H7S A;  1SD0 A;  3DVN U;  2MQJ A;  4EZK A;  1GOZ A;  3QA8 A;  4JE3 B;  3IG8 A;  5GMV A;  3TCA A;  2BKR B;  2OHF A;  4USA A;  3ZRC A;  3AEC B;  3CMM B;  5TR5 A;  4W9I A;  2Z8L A;  1Q0W B;  3BII D;  5D7G A;  4FA6 A;  1WJ6 A;  4P1B C;  1RFK A;  2AQ1 B;  4GXB A;  4Q2J A;  4A3O A;  2EKE C;  3HM3 A;  2G4S A;  2XBB C;  2RD0 A;  1YN4 A;  4A6Q A;  5IP4 D;  2M56 B;  1ZXI A;  2XK5 A;  1AYF A;  4LJO B;  4KZ0 A;  2WXL A;  4FJZ A;  2XEW A;  2M4N A;  1T0Y A;  2KJH B;  2YLM A;  2KX3 A;  2EKI A;  3FKY A;  3TEW A;  1MHX A;  3C0R B;  1P3Q U;  2W9N A;  3LXF A;  5HG2 A;  1N63 A;  1QOG A;  2IO2 B;  3IT4 B;  1YX5 B;  1XLN A;  1BT0 A;  4M02 A;  2VRR B;  4BFR A;  1PFD A;  2W55 A;  1P9D U;  5AUI A;  1UGJ A;  3ZJT A;  4NQL B;  5FR3 A;  4MH8 A;  2LRW A;  2Y5B B;  4H2A A;  1EWY C;  1E0Z A;  4W9D A;  4ZRK A;  2BWF A;  4MGY E;  2WXF A;  1QKZ A;  3PGE A;  1RFA A;  3Q3J A;  1C1Y B;  3IAS 1;  3DVG Y;  3IG5 A;  3I9V 1;  1STE A;  3M62 B;  2FUH B;  4OZB A;  5EE9 A;  2SEB D;  1WMH B;  2WGS A;  4EEW A;  5E6P A;  1WR1 A;  5BYR A;  5HKH A;  4RF9 A;  1GUA B;  3W5V B;  3CSF A;  4HJK A;  1TBE A;  3P2B A;  2NBU A;  2N7J A;  2IZV B;  4RH6 A;  4L1B A;  5CHW A;  2HJ1 A;  3ENE A;  2NBV B;  4IW0 A;  2I38 A;  1CRK A;  1NYR A;  3RFZ B;  1MG4 A;  5L83 A;  3L17 A;  3W1Y A;  1XF5 L;  4IWP A;  3V60 A;  5J9A A;  2JVC A;  3X23 A;  1ISN A;  3FIL A;  4BHL A;  1L6U A;  3K9O B;  4GVY A;  5IO9 A;  4JIO U;  3AE1 B;  2BKF A;  2BPS A;  2J4X A;  4JLC A;  2WXK A;  3H6N A;  4PS8 A;  4XC2 A;  2BS3 B;  3MFG A;  1JWB D;  4WJN A;  2SAK A;  3HIZ A;  3ZIM A;  4KSK C;  1TYG B;  3P4R B;  2KMC A;  1ZPS A;  4TV3 A;  4GMV A;  5E6O A;  3L2E A;  1DYQ A;  1TS3 A;  2KZR A;  1UWM A;  4LNK A;  3PT2 B;  2D32 A;  4MM3 B;  3PZ8 A;  2O2V B;  3VUY A;  1B1Z A;  3OWE B;  4BG4 A;  1DOX A;  4FBJ B;  5JHB A;  2GB1 A;  1TS5 A;  2PKO A;  1NI3 A;  4LNO A;  2MBE A;  3AE7 B;  4YTP B;  2EMT A;  4IOI E;  2AYO B;  4WUR A;  2NPT B;  4HWI B;  2O6V A;  4WJO A;  1OTR B;  2YEP F;  4HDQ A;  4BBN F;  4KZC A;  3VUX A;  1FNU A;  3HHM A;  5BMI A;  2OJR A;  4ICU A;  4KIK B;  4GB9 A;  1L6V A;  2L83 A;  1C4A A;  4BKS A;  1N60 A;  1C79 A;  2Q5W D;  4YL8 A;  4OVZ A;  4FHK A;  2NTS A;  2N0S B;  4LNI A;  1C4P A;  3V6C B;  1FXI A;  1OQR A;  2KD0 A;  5CHF A;  1R7S A;  1KFY B;  3GOE A;  3Q8B A;  4LK0 M;  3QK0 A;  2N9L A;  5EDS A;  5EE1 A;  2NTT A;  4PYU A;  1KOT A;  2MBB B;  3NS8 A;  3DBL I;  4Q2R A;  2MRP A;  1EO6 A;  2GBJ A;  2RPQ A;  3T9L A;  2RDG A;  4BG4 B;  4ZRI A;  3AE8 B;  2V9H A;  1WGY A;  3T8M A;  3MTN B;  2C7M B;  3Q8C A;  1D4B A;  3N30 A;  5JH5 C;  1ZUD 2;  1V97 A;  2GMI C;  4BBN C;  1HZ6 A;  4BAX A;  1NDD A;  4DHZ E;  1KH0 A;  3MJ5 A;  3PRZ A;  1D6E C;  2OJW A;  4NPN A;  2X8X X;  2GBK A;  2LRU A;  2WNM A;  2J1Q A;  1VZ6 A;  3ETR A;  1FRD A;  4NAW B;  2MCN B;  1WZ3 A;  2KC2 A;  3NS1 A;  1R4N I;  3VR8 B;  2LXA A;  4WJP A;  5D3I B;  2DYB A;  3P63 A;  1NYQ A;  4ARC A;  1J7B A;  1I4G A;  1PGA A;  4RGN A;  1YMH E;  3DHH C;  1FRR A;  4YXD B;  1WH3 A;  1V86 A;  3NZS A;  2DAF A;  2L32 A;  2KDF B;  2JY6 A;  3CIR B;  1TY0 A;  4GLS C;  1E90 A;  3IXS A;  2YEP B;  4K3B A;  1SE4 A;  3FAH A;  1RWS A;  5AZF A;  1GB1 A;  4HEA 1;  2N7D A;  2D11 A;  4X57 B;  2B76 B;  3QAQ A;  5G5G A;  1QOF A;  2NMQ A;  2GBR A;  3M63 B;  1N5X A;  1L4D B;  2G3Q B;  3RZF A;  4A8X C;  1WJ4 A;  4RM9 A;  1UWX A;  3SR6 A;  1WYW B;  5CHV C;  3R8B A;  2RDH A;  1N5W A;  4R3D A;  3AXC A;  3VH3 B;  3SEB A;  3TSS A;  1SE2 A;  3HVZ A;  2JZZ A;  4JWS C;  3DQV A;  4YWG G;  2Z0E B;  3PSE B;  4W9K A;  1YIW A;  2R61 A;  3TL5 A;  5EE0 A;  2AWT A;  1L2N A;  5LLI A;  1GC7 A;  2JYE A;  1LFD A;  3MJW A;  2FCQ A;  4GGQ A;  3RT3 B;  1D5M C;  5I4D A;  2WDQ B;  4LNF A;  1EWC A;  2N7E A;  2RMM A;  3C8Y A;  1C4C A;  4C56 C;  3VAW A;  1E9M A;  2JPH A;  2GWC A;  1WE7 A;  3RUL A;  3ZW3 A;  1V5T A;  1ZDX A;  3A9K A;  2DZK A;  3JU6 A;  1KM7 A;  3BVM A;  1Z5S B;  1HTO A;  1ZW7 A;  4W9F A;  4B9K A;  3SFD B;  2IPK D;  4OHJ A;  3L2D A;  1KJT A;  1TKY A;  2BYV E;  2PIA A;  1S1Q B;  3OAW A;  4NJ7 A;  2BTE A;  2Y5P A;  2LI5 A;  1SB3 C;  2LHD A;  2ZVO A;  3VVW B;  1QLB B;  1MPE A;  1K52 A;  2NS5 A;  3QHT A;  2LAS A;  2BS2 B;  3EFU A;  1C9F A;  4BOZ B;  3GE3 C;  2L1A A;  3NVY A;  1A70 A;  3I57 A;  5DCN A;  1KLV A;  2CHZ A;  2HJ8 A;  1TTN A;  4WJQ A;  2QSD A;  2WX0 A;  5L95 C;  3ONS A;  1ET6 A;  1UNS A;  3RYT A;  2KJ6 A;  5C2T B;  5J99 A;  1QZE A;  3IG3 A;  2KYW A;  3Q8A A;  3BZD B;  3VDZ A;  4E3C A;  1I4R A;  1PGB A;  1ZP0 B;  2KK8 A;  1YN5 A;  1PUT A;  2GWD A;  3H8H A;  2JZP A;  3PLU A;  3ECI A;  3H9D A;  1YJ1 A;  3AEB B;  1LXD A;  2J53 A;  2IO1 B;  4A3P A;  1L4Z B;  4B95 A;  1UEL A;  3A1Q B;  1LQB A;  1F2R I;  4FUL A;  1WFY A;  3LJ3 A;  3DBS A;  3QQ8 B;  1SJH D;  1YQ4 B;  2C7N B;  4C80 A;  5HI1 A;  2VH2 A;  2G1E A;  5HHD G;  3M3J A;  1VA6 A;  1TGZ B;  5BMG A;  4DXF A;  3NVV A;  1T0S C;  3SDL C;  3AEA B;  2K6Q A;  5CTR C;  4URK A;  1P7E A;  1OQQ A;  2E3T A;  2DLB A;  2LHE A;  3KUZ A;  4LTU A;  3DBR B;  1JRO A;  1HE8 A;  2MJE A;  4G50 A;  5IA7 A;  2KWV B;  2M0A A;  1XD3 B;  3A9J A;  1SEB D;  3V05 A;  2KO3 A;  2KTF A;  2ICI A;  2ACZ B;  4MGI E;  1F0Z A;  2WXO A;  1OEY A;  2PW9 A;  2RGF A;  2N4F A;  4G3X B;  1OEY J;  4JGH B;  3M10 A;  2CR5 A;  4AWJ A;  2INN E;  4WIP A;  1V1P A;  2NCN A;  3L13 A;  1P50 A;  1P52 A;  5EE3 A;  1RM6 C;  3RI7 C;  3JYU A;  2DYM A;  3KWL A;  1V6E A;  4C4V A;  1L7Y A;  3LVV A;  1L0Y B;  3N9Y C;  1F52 A;  4WH4 A;  4BZA A;  2KQ4 X;  4BKG A;  3B2F A;  1QQR A;  4P6V F;  2KTR A;  2WLB A;  2ZNV C;  3WAO A;  1N62 A;  1XQQ A;  4CYE A;  4HRS A;  4ASW C;  2LUE A;  4ANW A;  2R2O A;  2OED A;  1IUE A;  2IY0 B;  4AS1 A;  4B0M A;  1VZ7 A;  3KUC B;  2V3P A;  3URY A;  4JWU C;  3W1S A;  2ZPN A;  1VLB A;  5TSS A;  4XDD A;  4FLH A;  1VD2 A;  2BS4 B;  4RF0 A;  1U4A A;  4NJ6 A;  4RF8 A;  3HK0 A;  4AP4 C;  2HDE A;  1C3T A;  3BYY B;  4KGR A;  4YSZ B;  3QC8 B;  5LNK 1;  3VR9 B;  4GU2 A;  3TUO A;  3QCA A;  5AUK A;  4TQ1 A;  4IC7 B;  3IHP C;  1WM2 A;  3N20 C;  3KYC D;  3Q69 A;  3EEC A;  4E71 A;  2PE6 B;  2UU7 A;  2MBO A;  2K39 A;  4GDL A;  3EUB 2;  4ZRJ A;  3S2A A;  2ZNV B;  4OZA A;  3RNF C;  2WXM A;  2LVP A;  4KGS A;  1P7F A;  1FXT B;  3KQ4 A;  3MC0 B;  2LGD A;  4EFO A;  5IKC M;  1UUP A;  3AMZ A;  1ROE A;  1KLU D;  4ZRP A;  4XYC A;  2C9W B;  2WU5 B;  2CHW A;  3DCG A;  3V61 A;  3VQI A;  2LXC A;  3E9S A;  3LB8 C;  1QOA A;  4ZRQ A;  2ZW1 A;  3PHW B;  4HJG E;  2KWD A;  3CST A;  2XK5 B;  2G9H D;  4YSY B;  1HA5 A;  1XEE A;  2KHW B;  2CKH B;  2D3A A;  3BK1 A;  1HTQ A;  4A9A A;  5KHO A;  2REX A;  4GW0 A;  1FCC C;  1E8X A;  4FXC A;  1WXA A;  2HTM E;  1JQ4 A;  1MFW A;  4N58 A;  2LWP A;  4MDK E;  1GC6 A;  3X0W A;  3AU5 A;  2W82 A;  2WXR A;  2BYF A;  3E56 A;  3R2T A;  1MJD A;  4REZ A;  3WAM A;  1YQB A;  1VJK A;  3AE3 B;  1HZ5 A;  3NZU A;  1HXY D;  3TMP B;  2IBI B;  4XWW A;  2K0P A;  2W3S A;  5H92 C;  4EE2 A;  5IN7 A;  1WRD B;  3PHX B;  1SF0 A;  5J17 A;  3VHT C;  4OVU A;  1Q5W B;  2D07 B;  1XLQ A;  1G0W A;  1BML C;  4RCO A;  2DHZ A;  2X38 A;  2KQ7 A;  2PE9 A;  2QIE B;  1GNU A;  3Q3O C;  1F9J A;  2Y5C A;  1WRI A;  2FCS A;  1UD7 A;  4PS7 A;  2I2Y A;  3NHE B;  1YD8 U; 
#chains in the Genus database with same CATH homology
 4RF8 A;  4GW0 A;  4RF7 A;  1FPY A;  3L2E A;  3L2E B;  1BG0 A;  3NG0 A;  4RF6 A;  4BHL A;  2D3B A;  4S0R A;  4BAX A;  4LNK A;  3ZXR A;  4GVY A;  4LNI A;  1QK1 A;  3DRB A;  4Q2R A;  4AM1 A;  2BVC A;  4ACF A;  1SD0 A;  3B6R A;  3ZXV A;  3L2D A;  3M10 A;  2OJW A;  2D3C A;  1VRP A;  3JPZ A;  2LGS A;  4BG4 B;  4GVZ A;  2WHI A;  1CRK A;  2CRK A;  4BG4 A;  4LNN A;  1G0W A;  1F52 A;  3DRE A;  5J99 A;  3JU6 A;  4S17 A;  1M15 A;  2J1Q A;  2WGS A;  2GLS A;  1U6R A;  4LNF A;  4XYC A;  2QC8 A;  4HPP A;  1RL9 A;  1P50 A;  4LNO A;  4Z9M A;  1P52 A;  2D3A A;  4RF9 A;  1I0E A;  3JQ3 A;  3FKY A;  1QH4 A;  1LGR A;  1HTQ A;  3JU5 A;  1HTO A;  5J9A A;  1F1H A;  4GW2 A;  2UU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...