1HTQA

Multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutamine synthetase
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 140
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htqA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htqA01
3ZXVA 2WHIA 2OJWA 4RF8A 4LNOA 2QC8A 1CRKA 1U6RA 4LNIA 2J1QA 4ACFA 3DRBA 4Q2RA 4LNKA 2WGSA 5J9AA 2BVCA 1HTOA 1G0WA 4GVZA 3NG0A 1F1HA 1RL9A 3JU5A 4XYCA 4RF7A 3B6RA 4S0RA 1QH4A 1VRPA 2CRKA 3M10A 4GW0A 4GVYA 4BG4A 1M15A 2LGSA 3L2EA 4RF6A 2D3AA 4AM1A 4BAXA 2D3CA 2D3BA 1I0EA 1FPYA 1BG0A 4BG4B 3JQ3A 3L2EB 5J99A 1QK1A 3L2DA 3FKYA 3JPZA 4Z9MA 4LNNA 4HPPA 1P52A 3JU6A 3ZXRA 1LGRA 2UU7A 1HTQA 1P50A 1F52A 4LNFA 4GW2A 3DREA 4BHLA 2GLSA 1SD0A 4RF9A 4S17A
chains in the Genus database with same CATH superfamily
1L0XB 2FIDA 1RFAA 4LNOA 4MM3A 1YN4A 3A9KA 1I4HA 3SU8X 2CHWA 1KTKA 4C7YA 4W9JA 3KWLA 2KDEB 4W9FA 2IDYA 2D10A 4II2B 3RPFC 2GBJA 2R2OA 3QC8B 1AW7A 2LGIA 1UUPA 3ZO5B 2KQ7A 2XN9C 2M56B 3HUIA 4ITKA 5DPRA 2O6VB 1FPYA 1KLGD 1BG0A 5DPTA 1ZDXA 4EKUA 2KZRA 2HJ8A 3JSVB 3KUZA 3ZDTA 4GDKB 5EE3A 2PTLA 4UDUC 1UGJA 4K3BA 3TEZA 4YWGG 5AUKA 1VCBA 3AM9A 4JWUC 3RCZA 2NBWB 4A9AA 2I1JA 2ZNVB 3MC8A 3QARA 1RL9A 2N7JA 1BT0A 3U2SC 3AU4A 3Q3OC 1TKGA 2BBCA 1FNUA 1VZ6A 4WQMA 4I6NB 2LD9A 1T0QC 3EFCA 4HK2A 3GB1A 2RD0A 2BGFA 4XX5A 2JX5A 2NBVB 1WX8A 3GE3C 1UZXB 2M0AA 1RM6C 1R4MI 1ROEA 2CJOA 4FHKA 1S3SG 4YTPB 1NVID 2FBWB 3QA8A 2G1EA 1C4CA 2RPVA 2G45B 2K1FA 3A1QA 2DZJA 3AE7B 4MJSB 3ABVB 1D3ZA 3DOWA 2X38A 5BYRA 1CRKA 4HKZE 1X1MA 3N30A 2WQYB 2CR5A 5CX3A 2ZCBA 4HWIB 5GMVA 4EFOA 2ZVNA 1QOAA 2LJ5A 4HXDA 3VTVA 3T3OA 2KN5A 5AEKB 4C4VB 4K3CA 4EUTA 3DDCB 1DOYA 1F0ZA 3AEBB 3APFA 1QOBA 2LWPA 2JY6A 3DVGY 4B0EA 1VZ8A 3H9DA 4IOIE 3C8YA 1G0WA 2K0PA 3Q14C 3NY5A 3AE6B 1PGXA 2ZW1A 4BG4A 4WJPA 4AM1A 2RMMA 2MA9B 1FXIA 3RUIB 1ESFA 5HHDG 1J19A 1H4RA 1XLOA 4RGMA 2DNFA 4K1RB 4NPNA 5I4DA 1OGWA 3AXCA 4GW0A 1AARA 1EF1A 3U52E 2NMQA 2YVCA 3TUOA 1F77A 2KKCA 4NJ6A 5AUIA 2KLCA 2JPHA 4Z9MA 1ET6A 5LXHA 2Z0DB 3ZXRA 3DWGC 2N4FA 4LNFA 5LLIA 3RZWC 1I35A 1M4VA 2L0TA 3HK0A 3VUXA 3PLVA 2WXNA 4W9DA 3EFUA 1P3QU 1OEYA 4K7WA 1FMAD 3L17A 4A6QA 3Q6BA 4FLHA 4M00A 1GB4A 2GBRA 4YT0B 1JRUA 1VLBA 4ICUA 1E8YA 2IO3B 1JWAD 1WRIA 4IM2A 2KJHB 2QHOA 2KK8A 1WYWB 2V3NA 3UQAA 4G0NB 4AQ7A 2K25A 3WAOA 1OEYJ 3K9OB 4KSKC 1YJJA 4WJNA 4ZHOA 3HHMA 1RYJA 3Q3MC 1GC7A 1C77A 3O13A 3T9LA 5BYSA 1FNWA 4KV2A 1QILA 1STEA 1WGKA 3VH4B 2N7DA 2E3TA 4S0RA 1JCKB 2GBNA 1J7AA 1T6BX 5MPOA 3A9JB 3L2DA 1TBEA 4NZLB 2L32A 2Z59B 2BWFA 3DBRB 4TSSA 1L2NA 3AU5A 4RF8A 1KJTA 2N1WA 3P4QB 3BYTB 2N9KA 1OQRA 2NVUI 2PPHA 1GPXA 2L3ZA 1ZW7A 2RGFA 2KD0A 4MSMB 2LXCA 3P1MA 3TEWA 5CHWA 1E8ZA 1XLPA 3DBHI 2D11A 1WH3A 1IBXB 3IG5A 3GZNI 3DPDA 3BYYB 4DBGA 1UWMA 4HVBA 3UIPB 4D2KA 3ZTCA 1KM7A 1PFDA 4URKA 4HKQA 3FKYA 3OJ3A 1UGMA 4KX6B 2NCNA 3RMKC 2CHZA 2DWQA 1MFWA 4G3XB 3ALBA 1YIWA 3H7SA 5BMIA 4PS8A 1WM3A 4JIOU 3DHGC 1YN5A 2L1AA 3I9V1 4XDCA 4XWTA 2DLBA 4JLCA 1BUIC 2I38A 4EZLA 3NS1A 1N60A 3IVFA 2WNMA 2HD5B 2LGDA 4J3OD 3VTWA 3B1LX 3PSEB 1TTNA 2ZJDA 1V1PA 1WX9A 4KSLC 3ZRCA 1L0VB 3RYTA 4C80A 4OHJA 4WWOA 4KDIC 2BTEA 4PYZA 3APDA 2O6VA 2KANA 2ONQA 3OJ4B 1ZPSA 3B0AA 4PS3A 1FCCC 5IO9A 3JSVA 2W3RA 2L8JA 1MVKA 3IBEA 3AEDB 2FCSA 3E56A 4GDKA 4TQ1A 2MBBB 1YD8U 2VH1A 3LYYA 4MEMA 2JSVX 2WX0A 2LJIA 4DQOC 2BKFA 2NS5A 2V4LA 4WAFA 4TUUA 5CHFA 3DHIC 5FR6A 1L6UA 3PREA 2WX1A 3JU6A 1C4PA 1HTQA 2AYOB 5DCNA 4GW2A 2ZVOA 5D6JB 2G4DB 2H89B 4FN2A 3I3TB 3W1SA 1WSPA 2KHWB 2KTFA 3KUDB 1T0SC 3AECB 3ZIMA 1V9JA 3DBHB 4OZAA 1P7EA 2Y5PA 3ZTDA 1A5RA 3GZNB 1HQRD 1R4NI 4RMAA 4MGKE 3KYDD 4EZJA 1HE8A 1OFFA 2KC2A 4WWMA 4JQWC 3L2EB 4DXGA 4ARCA 4MJSA 3AI5A 3QAQA 2BF8B 3ML8A 1NDDA 3ZXVA 2AX5A 3ZDMC 1ZOYB 4GXBA 2X8XX 1V6EA 4DWFA 2JVCA 1XQQA 1K8RB 4AUQC 2BPSA 1RLFA 2N0SB 3QQ8B 4ZDVA 4C4VA 4MACA 1QOGA 1NI2A 2J0KA 4P1CC 3BZDB 4XGAB 3ZNGC 2FCQA 2AL3A 3PZ8A 5FK9C 3PO0A 4MSQB 2C7NB 2LVOA 3IT4B 5HFYA 1YJ1A 1E7VA 2L05A 3PGEA 3WCQA 3SFDB 3PS6A 3V61A 3N32A 2D3AA 3LJ3A 3KWVA 4W9HA 3TJPA 3H8HA 1FXTB 5LXIB 4RCOA 1DOIA 2K8BA 3VFKA 2GOWA 3DWMA 1XLNA 4OW0A 1WGDA 2DZIA 3CWIA 3KH0A 3ZJTA 3Q3NC 3H7PB 5TR5A 1V80A 4PK1A 2C60A 2WU2B 3PV1A 2NTSA 2N7EA 3AEAB 3GP7A 2DZMA 3JPZA 4LNNA 4NAWB 2UU7A 3AE1B 2EKIA 1T0YA 3BINA 4ASWC 2BB6A 2WXHA 4BKTA 3ZNHB 1U6RA 2W3SA 1A70A 3BWUD 3SD5A 2WU5B 2M17A 4JL9A 3BIID 4PT5A 2K5PA 1YQ3B 1D5MC 4A20A 3W9CB 2HE7A 2ZNVC 3W2DA 3ML9A 3VHTC 2KQSA 1R4NB 5GXGB 3NVWA 4HPPA 3PRPB 2AL6A 1UELA 2BS3B 4RFBA 1PGAA 1P0RA 5HI1A 1F9JA 4LNKA 2MLBA 3IAM1 3UI3A 4NJCA 3W1SC 1UH6A 3ZGZA 4EOYA 2LUEA 3NZSA 4A55A 2ICIA 2EMSA 2W82A 1P98A 4RGNA 4XWWA 3HM3A 1MI0A 1AN8A 5D3IB 4GB9A 3TIXA 4WH4A 1K52A 4TMAB 2FUG1 3P4RB 2INPE 1KOTA 3A9JA 5BMGA 1CZPA 4E3CA 3QWZB 2LGSA 1ZXHA 4X57B 4OZCA 1PUTA 1NYQA 4OZBA 3W1YA 1K53A 1L7YA 2L00B 2QEJC 5E6JA 4RNAA 3RT3B 1BMLC 1TKYA 2MJDA 3R7QA 3U8ZA 4DHZE 3CSFA 2I2YA 2WXOA 1V1PB 1GG3A 4RGOS 4JWSC 3VUYA 1TS5A 2BS4B 2K8HA 2KMMA 1YN3A 3ZUNA 1YQBA 2C5LC 4EZKA 4IG7B 1PGBA 2HJ1A 2KMCA 3R3MA 3VQIA 5KHOA 1IBXA 1XCQL 4BKSD 2RPQA 3B9JA 1Q1OA 3C0RB 2KWCA 4US9A 3APCA 1YX6B 3VRAB 1F1HA 1GAQB 4A90A 3B6RA 3DHHC 5EE1A 2R61A 1H8CA 4ANWA 3JQ3A 4CQNA 4IM3A 2UWQA 1NI3A 2V1YA 1P52A 4N6EB 1L6VA 5J18A 4RGTA 4S17A 5AZGA 1RFKA 2GWDA 1WMHB 3M62B 4KIKB 3TCAA 3A4RA 3BK1A 3Q2AC 4ZHPA 5IA7A 4IW0A 3JVZX 4YTMB 1V49A 2MJ3A 3RNBC 3SR6A 3E9SA 4DXFA 2IBIB 2LMCA 1WR6E 1J7BA 3ZNID 4BHLA 4P6VF 5J17A 3SFEB 4AS1A 1N6ZA 3M63B 3H6NA 1EWCA 2XK5B 4MDKE 3HRDD 1JMLA 3RN9C 2FCMA 3DQVA 4F8CB 1FIQA 3ETRA 1XLQA 4P16A 1KFYB 4L1BA 1QF6A 2J0MA 3B2FA 3DCGA 4FJYA 3DBLB 2G9HD 4K7SA 2IO1B 2OHFA 4F7ZA 1WWTA 1KLUD 2WXIA 4XC2A 4FULA 1L4DB 4KDLB 4LJOB 1EU4A 2LZ6A 3TEXA 3DBSA 2ZPYA 2JUOA 1WE7A 1BXTA 3OAWA 3HIZA 3DBRI 4KGRA 3NJTA 2GMIC 4E71A 2LVPA 2KVZA 3MC0B 4H2AA 4RF9A 5JXVA 3OLMD 2DAJA 4W9KA 2V0GA 2OEDA 4A3OA 5DPWA 4HCPB 3L2EA 5KHQA 4KGTA 1WYGA 2LASA 4I6LB 2L83A 2DYOA 2O6VD 4KVGB 2L76A 3VDZA 4DXAB 1Q5WB 5CHVC 1Z2MA 4FXCA 3DVGX 3R7RA 1FRRA 2KJ6A 3A4SC 4NY0A 1TZ1A 3MJ5A 4AJYB 3Q8EA 4ZRJA 1J8CA 2ZPNA 2D33A 1E8XA 4PS7A 1I4QA 4BVUC 1DOXA 3Q3FA 3AE2B 2FIFA 1EU3A 5JH5C 4B6WA 3NZ3A 1T0RC 2JYEA 2GRIA 2UYZB 3X23A 2WXPA 4KZ0A 3NUHB 1UD7A 2WP9B 1PDXA 5G5HA 4C56C 4DHJD 1V2YA 3N1ZC 1OTRB 3H7PA 2D32A 2JZPA 1HTOA 4AJWA 2MBOA 1WM2A 2QCZA 2W55A 5E6PA 2DHZA 1P1AA 4ZOHC 5FR3A 3KUCB 3RULA 4DDGD 1XF5L 4NAWA 2BKRB 2KVRA 3KQ4A 3T8MA 1IGCA 1TS3A 3L10B 2IZVB 2SEBD 2TSSA 1UBQA 2A5UA 3PLUA 1WXAA 1IPGA 3BVMA 4AP4C 2GI9A 3NS8A 2JF5A 1MJDA 2FUHB 1JWMD 5D94A 4YXDB 1Q10A 4GU2A 3LVWA 4GVYA 2K8CA 3JYUA 4WWNA 2AWTA 3PVLA 1XT9B 1WXSA 4PYUA 2NBUA 5C23A 4HEA1 2K22A 3RD2A 5C1ZA 4QAYA 1Y56A 1WJUA 1ACCA 4W9GA 3MHSD 4KZCA 2I1KA 1D6EC 1LQBA 2J7QB 2PVGC 3PHXB 4JE3B 3AE8B 2J52A 2V3PA 2K39A 1TGZB 4GIVA 2GWCA 3LXFA 4JPSA 1YJIA 3LN7A 3ZLZA 2HTME 4ARIA 4ZRPA 2KLGA 4K81A 1JQ4A 2MX2A 1WZ3A 5BO4B 4OVUA 3VR9B 1SE9A 2CRKA 2LGXA 3X0WA 3QK0A 2DX5B 1JWBD 4Q2JA 4AWJA 1WE6A 4IC7B 4C7ZA 2JZZA 2B76B 1WJNA 5FKAC 4G11A 4B9KA 4HROA 5BMHA 3U7DA 1J7CA 3KLSX 1FNVA 2PIAA 3GOEA 1GUAB 4BOSC 2VZKB 1QQRA 1SSNA 1T5XD 1WJ4A 4W9CA 3S2AA 2PLPA 1GB1A 2K9XA 2CHXA 4BZAA 3VRBB 4YSZB 3ZRFA 2PMVA 3BK2A 1LO5D 1CQVA 2AQ1B 3AULA 3J9CA 4BBNC 2V3SA 2W54A 1E0ZA 2G4SA 4USAA 2YEPB 3FC4A 5EDSA 4RM8A 1WXQA 1HXYD 1VD2A 3L54A 1EM7A 4G50A 2DAFA 2D3GA 3VVWB 2LRWA 5IAAC 4DDID 4LK0M 2KDBA 1WMHA 2WXLA 3P4SB 5IOIA 4P7IA 4KIKA 3QJZA 1JRPA 1FXAA 2Y3AA 3NOBA 2Z0EB 5CTRC 1C3TA 2D3BA 3ZVVA 4BKGA 1WX7A 4LTUA 3LVVA 3WALA 1WRDB 1K50A 3Q8BA 1RRBA 2WXQA 4MGYE 4HDQA 2XK5A 1KH0A 1YMHE 5C3JB 1E9MA 2HTHA 2CJNA 1R8GA 2WDTB 5HKHA 4LDTD 2N9XA 2LI5A 1I0EA 4FJZA 1JWUD 1ZP0B 4CHKA 2KFJA 1F52A 1C9FA 2EELA 1N5WA 1V5OA 1MG4A 3SDLC 1I4RA 4Q2RA 2WGSA 3BVZA 5DPSA 2INCC 1V1OA 2D5GA 2Q5WD 1V86A 2EMTA 3CSTA 3NZUA 1I7HA 2D3CA 3RI7C 2WLBA 4F1SA 3RNCC 1C79A 1EUVB 3VXWA 4EEWA 2WDQB 3U7ZA 3U4EG 3V60A 2PJHA 3NHEB 2SAKA 4TV3A 1IP9A 2JRIB 2A4ZA 2WDVB 5J99A 3EGRA 3PHWB 2BW2A 3HM6X 1RAXA 1TS4A 2KFKB 1FO4A 4WWPA 1E90A 2ASQA 2KNBA 2DYMA 2VRRB 1OQYA 3P4PB 1TS2A 3IAS1 4RF1A 4A3PA 3ONSA 1E8WA 1LM8B 2R2QA 3NG0A 3ZW3A 1MHHE 2WS3B 3H1UA 1DGJA 4ZYSA 5D3DA 4MGIE 2IO2B 2LFIA 1WGHA 1WXMA 3DVNU 3HVDA 1QKZA 2IGGA 3VH3B 2VH2A 3PRMB 3UF8A 1VRAB 1FFUA 2WXGA 2RDHA 3MFGA 3RNAC 1RWSA 4IWQA 2FAZA 1YX5B 1TY2A 3KYCD 2KTRB 1MPEA 4XYCA 3MP9A 4FHJA 1V97A 3IG8A 2KJRA 1VR9A 3AEFB 2XBBC 3R8BA 2CKHB 1TY0A 3Q8FA 4CO7A 4IM0A 3MJWA 2WWZA 5G2NA 1V8CA 5EE9A 1TT5B 2WDRB 4JX1C 2BB5A 3OWEB 4HLEA 1NBFC 4K7UA 1XEEA 1Y8RC 2J53A 1WI0A 1ZXIA 1IYFA 2DENB 2W9NA 1ZUD2 3DBLI 2KDIA 4GGQA 2V9HA 2IO0B 3IFWB 5E6OA 2WYQA 2OJRA 3NVVA 3CMMB 3U30A 2ACZB 2M1MA 2IPKD 4ANVA 4GOCA 2PE6B 4GLSC 4MH0E 2GBKA 3HVZA 3I63C 4ZRKA 2QMTA 5G5GA 3I5JC 5IKCM 3N20C 1B1ZA 2ZZPB 2CS4A 2IGHA 5H92C 1YOVB 3DVNV 4XZ4A 3NVZA 4L2YA 3OG5A 1LFDA 4ICVA 2JQRB 4M0WB 2BYEA 1HZ5A 1B9RA 4I6PA 4NAMA 2N9EB 4WIPA 2KACA 3AEEB 1WXVA 3EHVA 2KDMA 3P2BA 2QC8A 2HDEA 1E7UA 3R2IA 2QDFA 4MELA 3O65B 2QSDA 3P42A 3NZTA 3AN1A 1ZDVA 2JWUA 3A33B 3K9PB 2KQ4X 2N9PC 1LGRA 3FILB 4IUMB 4GDLB 2KC1A 5J9AA 5D2MB 4RF0A 3TL5A 1U4AA 3C19A 2JYTA 4BBNF 3M95A 2FCNA 1SE4A 3LB8C 4GN1A 3PZDA 1SJHD 4DHJB 2JXTA 3I57A 2DYBA 2IJ0A 1EO6A 3L13A 1FM0D 3ZJVA 1ET9A 4NQLB 2FNJB 2JU6X 3WA0A 4M8MA 3IT6B 1JWSD 2J0JA 4TQ0A 2IYDB 1QLBB 3W5VB 1NYRA 3T3NA 4XE0A 5J2RA 2REXA 4RM9A 1D5ZC 3N1YC 1FEHA 1OQQA 3B2GA 3N1XC 5G55A 1R7SA 2BQQA 2K3UA 3VUWA 3R66C 2BT6A 1CJEA 3IXSA 1WY8A 2Y5CA 5JHAA 4GVZA 1TZOA 1YNTE 2WXRA 2NTTA 4AOFA 2IGDA 2MP2B 3RZFA 4KGSA 1D4BA 3MHZA 2RDBC 1NEKB 4HJGE 3R2TA 3PTFC 1ISNA 2NPTB 4A8XC 1XO3A 3CIRB 1TYGB 4NQKE 1P9DU 1C78A 2WXMA 4KKIA 4GMVA 2CU3A 2J1QA 2GB1A 2QIEB 2J4XA 3NVYA 2DZKA 2PKOA 1M94A 2BYTA 4L23A 2MCNB 3ENEA 1KRHA 4MGZE 2JRHA 3RFZB 3LDZE 2KXJA 2KO3A 4FJVB 5LNK1 1E7PB 2JWZA 1MHXA 2MEKA 1TIFA 4IKGA 1GNUA 1WF9A 2V4IB 2NR2A 5JHBA 2KAJA 2L7RA 4YSYB 2CU1A 1QT9A 1ZE3D 1R4MB 4N59A 1L4ZB 5IP4D 1I4GA 2XEWA 2BYFA 2IY1B 4O1NA 1SEBD 4W9LA 4M02A 2GLSA 3AMZA 3PPAA 4WJQA 1LXDA 3VTUA 4M01A 3MC9A 1SGHA 4OVZA 1VJKA 3L08A 2O2VB 1N63A 1CMXB 3PT2B 4FADA 4WQOB 4BKSA 1JALA 4RF6A 1AWDA 1WIAA 3UIOB 3ZQ4A 2KFKA 2MH7A 2LHEA 3N9YC 1SXTA 5JZEB 4C00A 1FFVA 4M8NA 3AE4B 1GJZA 2GBMA 3V3XA 1TKEA 2MBEA 1CK1A 3B08A 4MH8A 4MM3B 4KKJA 2KYWA 3KVFB 2D2QA 3QHTA 1IUEA 3A9KB 3Q8CA 3ZNZB 4R3DA 2INNE 2B3AA 2K6DB 2MWSB 3RNGC 1VDVA 2PW9A 3N3KB 3GE8C 3KW5B 1SE2A 1SD0A 4WJOA 2ZW0A 2OOBB 2KTRA 1S1QB 3Q8AA 4LLGM 1VZ7A 3DRBA 4EE2A 1L0YB 2WXKA 4FBJB 2WXJA 3URYA 3NRZA 2KN4A 1E6EB 1I4XA 1J0GA 3Q69A 4XDDA 4B0MA 5C2TB 3IHPC 2RSUA 2Y5BB 1SE3A 1P7FA 2M8SA 2WHIA 2MRPA 3AB5A 4LDTB 1N62A 4ZRIA 2LEKA 4OVVA 4NJ7A 4N58A 3TBLD 2ZCCA 3ZYYX 2INDC 2RR9A 4ZRQA 2MSED 2KWUB 4ZYNA 3EECA 1T3QA 4LJPB 1KF6B 3CF6E 3AE9B 2LUMA 2BWES 4CYEA 1V5TA 4HCNB 4W9IA 1WR1A 1WGRA 5IN7A 3ECIA 3UQBA 1G6JA 1XD3B 3V6CB 4BAXA 3QCAA 3QIJA 3PZ7A 2C7MB 3ZJUA 2XNAC 5E6NA 4MT5A 2AQ3B 2M0XA 1JROA 1WJ6A 2LRUA 3L4PA 1ZGUB 5BYQA 1AYFA 3A1QB 3DREA 4P1BC 3WAPA 2KX0A 5AZHA 2YLMA 3IG3A 1XCTL 4FA6A 4TKNA 4WAAA 2DBYA 4BOZB 1K51A 4M0WA 5HG2A 4IDIA 1DYQA 2N1VA 4BFRA 1VA6A 3LN6A 1I42A 3AH7A 3TMPB 1C76A 3WIMA 2L52A 4RH6A 1HZ6A 1QK1A 3VR8B 3AV8A 1SIJA 3Q3JA 2E6XA 2MQJA 2MW5A 4HDOA 2LVQA 1N61A 2OJWA 2QILA 4HRSA 1NENB 4WURA 2M4NA 1C1YB 3RNFC 5T8IA 2PE9A 3SEBA 3V62A 2KX3A 2KT7A 2LGYA 4HJKA 4BG4B 3FILA 1WGGA 4GDLA 4ANUA 3WAMA 3PRZA 4YTNB 1C4AA 5EE0A 4YSXB 2KMAA 3GS2A 2JT4B 2ON8A 3RNEC 4NNJB 3AE3B 1EWYC 1L5PA 4RF7A 4B95A 2LHDA 3M10A 3AEGB 3UGBB 2PVOD 1TJEA 2KDFB 5L95C 1FRDA 4E74A 1V4GA 2AEHA 2ZEQA 4LCDE 3EA6A 3TSSA 1JW9D 3L0WB 2BS2B 2WXFA 4IWOA 4ANXA 1SIFA 2EKEC 1ZKHA 3JW0X 1F2RI 1QH4A 4US8A 3WANA 5D7GA 2MBQA 1PQSA 3P63A 3QX1A 4W9EA 1F2RC 3V05A 3L16A 1WFYA 3D32A 1N5XA 4JGHB 2L0FA 2KWDA 2MP2A 2FE8A 2BVCA 3FAHA 1SBBB 1FD6A 1HA5A 2H88B 1UNSA 2VZKD 1HEZE 2NPTA 3M3JA 2KOXA 4GSWA 3EUB2 3BVGA 1WZ0A 1ENFA 3EC8A 1E10A 3ZKJC 4J6IA 2C9WB 2QJLA 2BYVE 3JU5A 1UWXA 3SHQA 4HPLB 4N9F4 2JZ3B 3VAWA 4DK5A 1M15A 1SJED 1PYWD 2RDGA 5TSSA 5H8YE 1MG8A 3AE5B 1UBIA 1Z5SB 2MJEA 3UINB 1GOZA 1I4PA 1E5WA 2MBHA 1UF0A 1QOFA 2D07B 4ACFA 2JXXA 5AZFA 4DHZB 2C7HA 1YQ4B 2LXAA 1D5XC 1TT4A 1V81A 1GC6A 1P50A 4II3B 2MHJA 1XXGA 2Z8LA 2G3QB 2J42A 4HPMB 2K6QA 2N9LA 2O2VA 2PEAA 1SF0A 2M19A 4REZA 4LNIA 1KLVA 3W5UB 1QZEA 1VRPA 4YL8A 3BY4B 3TEYA 1WGYA 2IY0B 2KWVB 2YEPF 2AQ2B 3MTNB 1Q0WB 1IGDA 3V6EB 1EF5A 4IWPA 1SB3C 1FCLA 5L83A
chains in the Genus database with same CATH topology
3ZXVA 2WHIA 2OJWA 4RF8A 4LNOA 2QC8A 1CRKA 1U6RA 4LNIA 2J1QA 4ACFA 3DRBA 4Q2RA 4LNKA 2WGSA 5J9AA 2BVCA 1HTOA 1G0WA 4GVZA 3NG0A 1F1HA 1RL9A 3JU5A 4XYCA 4RF7A 3B6RA 4S0RA 1QH4A 1VRPA 2CRKA 3M10A 4GW0A 4GVYA 4BG4A 1M15A 2LGSA 3L2EA 4RF6A 2D3AA 4AM1A 4BAXA 2D3CA 2D3BA 1I0EA 1FPYA 1BG0A 4BG4B 3JQ3A 3L2EB 5J99A 1QK1A 3L2DA 3FKYA 3JPZA 4Z9MA 4LNNA 4HPPA 1P52A 3JU6A 3ZXRA 1LGRA 2UU7A 1HTQA 1P50A 1F52A 4LNFA 4GW2A 3DREA 4BHLA 2GLSA 1SD0A 4RF9A 4S17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXV A;  2WHI A;  2OJW A;  4RF8 A;  4LNO A;  2QC8 A;  1CRK A;  1U6R A;  4LNI A;  2J1Q A;  4ACF A;  3DRB A;  4Q2R A;  4LNK A;  2WGS A;  5J9A A;  2BVC A;  1HTO A;  1G0W A;  4GVZ A;  3NG0 A;  1F1H A;  1RL9 A;  3JU5 A;  4XYC A;  4RF7 A;  3B6R A;  4S0R A;  1QH4 A;  1VRP A;  2CRK A;  3M10 A;  4GW0 A;  4GVY A;  4BG4 A;  1M15 A;  2LGS A;  3L2E A;  4RF6 A;  2D3A A;  4AM1 A;  4BAX A;  2D3C A;  2D3B A;  1I0E A;  1FPY A;  1BG0 A;  4BG4 B;  3JQ3 A;  3L2E B;  5J99 A;  1QK1 A;  3L2D A;  3FKY A;  3JPZ A;  4Z9M A;  4LNN A;  4HPP A;  1P52 A;  3JU6 A;  3ZXR A;  1LGR A;  2UU7 A;  1HTQ A;  1P50 A;  1F52 A;  4LNF A;  4GW2 A;  3DRE A;  4BHL A;  2GLS A;  1SD0 A;  4RF9 A;  4S17 A; 
#chains in the Genus database with same CATH topology
 1L0X B;  2FID A;  1RFA A;  4LNO A;  4MM3 A;  1YN4 A;  3A9K A;  1I4H A;  3SU8 X;  2CHW A;  1KTK A;  4C7Y A;  4W9J A;  3KWL A;  2KDE B;  4W9F A;  2IDY A;  2D10 A;  4II2 B;  3RPF C;  2GBJ A;  2R2O A;  3QC8 B;  1AW7 A;  2LGI A;  1UUP A;  3ZO5 B;  2KQ7 A;  2XN9 C;  2M56 B;  3HUI A;  4ITK A;  5DPR A;  2O6V B;  1FPY A;  1KLG D;  1BG0 A;  5DPT A;  1ZDX A;  4EKU A;  2KZR A;  2HJ8 A;  3JSV B;  3KUZ A;  3ZDT A;  4GDK B;  5EE3 A;  2PTL A;  4UDU C;  1UGJ A;  4K3B A;  3TEZ A;  4YWG G;  5AUK A;  1VCB A;  3AM9 A;  4JWU C;  3RCZ A;  2NBW B;  4A9A A;  2I1J A;  2ZNV B;  3MC8 A;  3QAR A;  1RL9 A;  2N7J A;  1BT0 A;  3U2S C;  3AU4 A;  3Q3O C;  1TKG A;  2BBC A;  1FNU A;  1VZ6 A;  4WQM A;  4I6N B;  2LD9 A;  1T0Q C;  3EFC A;  4HK2 A;  3GB1 A;  2RD0 A;  2BGF A;  4XX5 A;  2JX5 A;  2NBV B;  1WX8 A;  3GE3 C;  1UZX B;  2M0A A;  1RM6 C;  1R4M I;  1ROE A;  2CJO A;  4FHK A;  1S3S G;  4YTP B;  1NVI D;  2FBW B;  3QA8 A;  2G1E A;  1C4C A;  2RPV A;  2G45 B;  2K1F A;  3A1Q A;  2DZJ A;  3AE7 B;  4MJS B;  3ABV B;  1D3Z A;  3DOW A;  2X38 A;  5BYR A;  1CRK A;  4HKZ E;  1X1M A;  3N30 A;  2WQY B;  2CR5 A;  5CX3 A;  2ZCB A;  4HWI B;  5GMV A;  4EFO A;  2ZVN A;  1QOA A;  2LJ5 A;  4HXD A;  3VTV A;  3T3O A;  2KN5 A;  5AEK B;  4C4V B;  4K3C A;  4EUT A;  3DDC B;  1DOY A;  1F0Z A;  3AEB B;  3APF A;  1QOB A;  2LWP A;  2JY6 A;  3DVG Y;  4B0E A;  1VZ8 A;  3H9D A;  4IOI E;  3C8Y A;  1G0W A;  2K0P A;  3Q14 C;  3NY5 A;  3AE6 B;  1PGX A;  2ZW1 A;  4BG4 A;  4WJP A;  4AM1 A;  2RMM A;  2MA9 B;  1FXI A;  3RUI B;  1ESF A;  5HHD G;  1J19 A;  1H4R A;  1XLO A;  4RGM A;  2DNF A;  4K1R B;  4NPN A;  5I4D A;  1OGW A;  3AXC A;  4GW0 A;  1AAR A;  1EF1 A;  3U52 E;  2NMQ A;  2YVC A;  3TUO A;  1F77 A;  2KKC A;  4NJ6 A;  5AUI A;  2KLC A;  2JPH A;  4Z9M A;  1ET6 A;  5LXH A;  2Z0D B;  3ZXR A;  3DWG C;  2N4F A;  4LNF A;  5LLI A;  3RZW C;  1I35 A;  1M4V A;  2L0T A;  3HK0 A;  3VUX A;  3PLV A;  2WXN A;  4W9D A;  3EFU A;  1P3Q U;  1OEY A;  4K7W A;  1FMA D;  3L17 A;  4A6Q A;  3Q6B A;  4FLH A;  4M00 A;  1GB4 A;  2GBR A;  4YT0 B;  1JRU A;  1VLB A;  4ICU A;  1E8Y A;  2IO3 B;  1JWA D;  1WRI A;  4IM2 A;  2KJH B;  2QHO A;  2KK8 A;  1WYW B;  2V3N A;  3UQA A;  4G0N B;  4AQ7 A;  2K25 A;  3WAO A;  1OEY J;  3K9O B;  4KSK C;  1YJJ A;  4WJN A;  4ZHO A;  3HHM A;  1RYJ A;  3Q3M C;  1GC7 A;  1C77 A;  3O13 A;  3T9L A;  5BYS A;  1FNW A;  4KV2 A;  1QIL A;  1STE A;  1WGK A;  3VH4 B;  2N7D A;  2E3T A;  4S0R A;  1JCK B;  2GBN A;  1J7A A;  1T6B X;  5MPO A;  3A9J B;  3L2D A;  1TBE A;  4NZL B;  2L32 A;  2Z59 B;  2BWF A;  3DBR B;  4TSS A;  1L2N A;  3AU5 A;  4RF8 A;  1KJT A;  2N1W A;  3P4Q B;  3BYT B;  2N9K A;  1OQR A;  2NVU I;  2PPH A;  1GPX A;  2L3Z A;  1ZW7 A;  2RGF A;  2KD0 A;  4MSM B;  2LXC A;  3P1M A;  3TEW A;  5CHW A;  1E8Z A;  1XLP A;  3DBH I;  2D11 A;  1WH3 A;  1IBX B;  3IG5 A;  3GZN I;  3DPD A;  3BYY B;  4DBG A;  1UWM A;  4HVB A;  3UIP B;  4D2K A;  3ZTC A;  1KM7 A;  1PFD A;  4URK A;  4HKQ A;  3FKY A;  3OJ3 A;  1UGM A;  4KX6 B;  2NCN A;  3RMK C;  2CHZ A;  2DWQ A;  1MFW A;  4G3X B;  3ALB A;  1YIW A;  3H7S A;  5BMI A;  4PS8 A;  1WM3 A;  4JIO U;  3DHG C;  1YN5 A;  2L1A A;  3I9V 1;  4XDC A;  4XWT A;  2DLB A;  4JLC A;  1BUI C;  2I38 A;  4EZL A;  3NS1 A;  1N60 A;  3IVF A;  2WNM A;  2HD5 B;  2LGD A;  4J3O D;  3VTW A;  3B1L X;  3PSE B;  1TTN A;  2ZJD A;  1V1P A;  1WX9 A;  4KSL C;  3ZRC A;  1L0V B;  3RYT A;  4C80 A;  4OHJ A;  4WWO A;  4KDI C;  2BTE A;  4PYZ A;  3APD A;  2O6V A;  2KAN A;  2ONQ A;  3OJ4 B;  1ZPS A;  3B0A A;  4PS3 A;  1FCC C;  5IO9 A;  3JSV A;  2W3R A;  2L8J A;  1MVK A;  3IBE A;  3AED B;  2FCS A;  3E56 A;  4GDK A;  4TQ1 A;  2MBB B;  1YD8 U;  2VH1 A;  3LYY A;  4MEM A;  2JSV X;  2WX0 A;  2LJI A;  4DQO C;  2BKF A;  2NS5 A;  2V4L A;  4WAF A;  4TUU A;  5CHF A;  3DHI C;  5FR6 A;  1L6U A;  3PRE A;  2WX1 A;  3JU6 A;  1C4P A;  1HTQ A;  2AYO B;  5DCN A;  4GW2 A;  2ZVO A;  5D6J B;  2G4D B;  2H89 B;  4FN2 A;  3I3T B;  3W1S A;  1WSP A;  2KHW B;  2KTF A;  3KUD B;  1T0S C;  3AEC B;  3ZIM A;  1V9J A;  3DBH B;  4OZA A;  1P7E A;  2Y5P A;  3ZTD A;  1A5R A;  3GZN B;  1HQR D;  1R4N I;  4RMA A;  4MGK E;  3KYD D;  4EZJ A;  1HE8 A;  1OFF A;  2KC2 A;  4WWM A;  4JQW C;  3L2E B;  4DXG A;  4ARC A;  4MJS A;  3AI5 A;  3QAQ A;  2BF8 B;  3ML8 A;  1NDD A;  3ZXV A;  2AX5 A;  3ZDM C;  1ZOY B;  4GXB A;  2X8X X;  1V6E A;  4DWF A;  2JVC A;  1XQQ A;  1K8R B;  4AUQ C;  2BPS A;  1RLF A;  2N0S B;  3QQ8 B;  4ZDV A;  4C4V A;  4MAC A;  1QOG A;  1NI2 A;  2J0K A;  4P1C C;  3BZD B;  4XGA B;  3ZNG C;  2FCQ A;  2AL3 A;  3PZ8 A;  5FK9 C;  3PO0 A;  4MSQ B;  2C7N B;  2LVO A;  3IT4 B;  5HFY A;  1YJ1 A;  1E7V A;  2L05 A;  3PGE A;  3WCQ A;  3SFD B;  3PS6 A;  3V61 A;  3N32 A;  2D3A A;  3LJ3 A;  3KWV A;  4W9H A;  3TJP A;  3H8H A;  1FXT B;  5LXI B;  4RCO A;  1DOI A;  2K8B A;  3VFK A;  2GOW A;  3DWM A;  1XLN A;  4OW0 A;  1WGD A;  2DZI A;  3CWI A;  3KH0 A;  3ZJT A;  3Q3N C;  3H7P B;  5TR5 A;  1V80 A;  4PK1 A;  2C60 A;  2WU2 B;  3PV1 A;  2NTS A;  2N7E A;  3AEA B;  3GP7 A;  2DZM A;  3JPZ A;  4LNN A;  4NAW B;  2UU7 A;  3AE1 B;  2EKI A;  1T0Y A;  3BIN A;  4ASW C;  2BB6 A;  2WXH A;  4BKT A;  3ZNH B;  1U6R A;  2W3S A;  1A70 A;  3BWU D;  3SD5 A;  2WU5 B;  2M17 A;  4JL9 A;  3BII D;  4PT5 A;  2K5P A;  1YQ3 B;  1D5M C;  4A20 A;  3W9C B;  2HE7 A;  2ZNV C;  3W2D A;  3ML9 A;  3VHT C;  2KQS A;  1R4N B;  5GXG B;  3NVW A;  4HPP A;  3PRP B;  2AL6 A;  1UEL A;  2BS3 B;  4RFB A;  1PGA A;  1P0R A;  5HI1 A;  1F9J A;  4LNK A;  2MLB A;  3IAM 1;  3UI3 A;  4NJC A;  3W1S C;  1UH6 A;  3ZGZ A;  4EOY A;  2LUE A;  3NZS A;  4A55 A;  2ICI A;  2EMS A;  2W82 A;  1P98 A;  4RGN A;  4XWW A;  3HM3 A;  1MI0 A;  1AN8 A;  5D3I B;  4GB9 A;  3TIX A;  4WH4 A;  1K52 A;  4TMA B;  2FUG 1;  3P4R B;  2INP E;  1KOT A;  3A9J A;  5BMG A;  1CZP A;  4E3C A;  3QWZ B;  2LGS A;  1ZXH A;  4X57 B;  4OZC A;  1PUT A;  1NYQ A;  4OZB A;  3W1Y A;  1K53 A;  1L7Y A;  2L00 B;  2QEJ C;  5E6J A;  4RNA A;  3RT3 B;  1BML C;  1TKY A;  2MJD A;  3R7Q A;  3U8Z A;  4DHZ E;  3CSF A;  2I2Y A;  2WXO A;  1V1P B;  1GG3 A;  4RGO S;  4JWS C;  3VUY A;  1TS5 A;  2BS4 B;  2K8H A;  2KMM A;  1YN3 A;  3ZUN A;  1YQB A;  2C5L C;  4EZK A;  4IG7 B;  1PGB A;  2HJ1 A;  2KMC A;  3R3M A;  3VQI A;  5KHO A;  1IBX A;  1XCQ L;  4BKS D;  2RPQ A;  3B9J A;  1Q1O A;  3C0R B;  2KWC A;  4US9 A;  3APC A;  1YX6 B;  3VRA B;  1F1H A;  1GAQ B;  4A90 A;  3B6R A;  3DHH C;  5EE1 A;  2R61 A;  1H8C A;  4ANW A;  3JQ3 A;  4CQN A;  4IM3 A;  2UWQ A;  1NI3 A;  2V1Y A;  1P52 A;  4N6E B;  1L6V A;  5J18 A;  4RGT A;  4S17 A;  5AZG A;  1RFK A;  2GWD A;  1WMH B;  3M62 B;  4KIK B;  3TCA A;  3A4R A;  3BK1 A;  3Q2A C;  4ZHP A;  5IA7 A;  4IW0 A;  3JVZ X;  4YTM B;  1V49 A;  2MJ3 A;  3RNB C;  3SR6 A;  3E9S A;  4DXF A;  2IBI B;  2LMC A;  1WR6 E;  1J7B A;  3ZNI D;  4BHL A;  4P6V F;  5J17 A;  3SFE B;  4AS1 A;  1N6Z A;  3M63 B;  3H6N A;  1EWC A;  2XK5 B;  4MDK E;  3HRD D;  1JML A;  3RN9 C;  2FCM A;  3DQV A;  4F8C B;  1FIQ A;  3ETR A;  1XLQ A;  4P16 A;  1KFY B;  4L1B A;  1QF6 A;  2J0M A;  3B2F A;  3DCG A;  4FJY A;  3DBL B;  2G9H D;  4K7S A;  2IO1 B;  2OHF A;  4F7Z A;  1WWT A;  1KLU D;  2WXI A;  4XC2 A;  4FUL A;  1L4D B;  4KDL B;  4LJO B;  1EU4 A;  2LZ6 A;  3TEX A;  3DBS A;  2ZPY A;  2JUO A;  1WE7 A;  1BXT A;  3OAW A;  3HIZ A;  3DBR I;  4KGR A;  3NJT A;  2GMI C;  4E71 A;  2LVP A;  2KVZ A;  3MC0 B;  4H2A A;  4RF9 A;  5JXV A;  3OLM D;  2DAJ A;  4W9K A;  2V0G A;  2OED A;  4A3O A;  5DPW A;  4HCP B;  3L2E A;  5KHQ A;  4KGT A;  1WYG A;  2LAS A;  4I6L B;  2L83 A;  2DYO A;  2O6V D;  4KVG B;  2L76 A;  3VDZ A;  4DXA B;  1Q5W B;  5CHV C;  1Z2M A;  4FXC A;  3DVG X;  3R7R A;  1FRR A;  2KJ6 A;  3A4S C;  4NY0 A;  1TZ1 A;  3MJ5 A;  4AJY B;  3Q8E A;  4ZRJ A;  1J8C A;  2ZPN A;  2D33 A;  1E8X A;  4PS7 A;  1I4Q A;  4BVU C;  1DOX A;  3Q3F A;  3AE2 B;  2FIF A;  1EU3 A;  5JH5 C;  4B6W A;  3NZ3 A;  1T0R C;  2JYE A;  2GRI A;  2UYZ B;  3X23 A;  2WXP A;  4KZ0 A;  3NUH B;  1UD7 A;  2WP9 B;  1PDX A;  5G5H A;  4C56 C;  4DHJ D;  1V2Y A;  3N1Z C;  1OTR B;  3H7P A;  2D32 A;  2JZP A;  1HTO A;  4AJW A;  2MBO A;  1WM2 A;  2QCZ A;  2W55 A;  5E6P A;  2DHZ A;  1P1A A;  4ZOH C;  5FR3 A;  3KUC B;  3RUL A;  4DDG D;  1XF5 L;  4NAW A;  2BKR B;  2KVR A;  3KQ4 A;  3T8M A;  1IGC A;  1TS3 A;  3L10 B;  2IZV B;  2SEB D;  2TSS A;  1UBQ A;  2A5U A;  3PLU A;  1WXA A;  1IPG A;  3BVM A;  4AP4 C;  2GI9 A;  3NS8 A;  2JF5 A;  1MJD A;  2FUH B;  1JWM D;  5D94 A;  4YXD B;  1Q10 A;  4GU2 A;  3LVW A;  4GVY A;  2K8C A;  3JYU A;  4WWN A;  2AWT A;  3PVL A;  1XT9 B;  1WXS A;  4PYU A;  2NBU A;  5C23 A;  4HEA 1;  2K22 A;  3RD2 A;  5C1Z A;  4QAY A;  1Y56 A;  1WJU A;  1ACC A;  4W9G A;  3MHS D;  4KZC A;  2I1K A;  1D6E C;  1LQB A;  2J7Q B;  2PVG C;  3PHX B;  4JE3 B;  3AE8 B;  2J52 A;  2V3P A;  2K39 A;  1TGZ B;  4GIV A;  2GWC A;  3LXF A;  4JPS A;  1YJI A;  3LN7 A;  3ZLZ A;  2HTM E;  4ARI A;  4ZRP A;  2KLG A;  4K81 A;  1JQ4 A;  2MX2 A;  1WZ3 A;  5BO4 B;  4OVU A;  3VR9 B;  1SE9 A;  2CRK A;  2LGX A;  3X0W A;  3QK0 A;  2DX5 B;  1JWB D;  4Q2J A;  4AWJ A;  1WE6 A;  4IC7 B;  4C7Z A;  2JZZ A;  2B76 B;  1WJN A;  5FKA C;  4G11 A;  4B9K A;  4HRO A;  5BMH A;  3U7D A;  1J7C A;  3KLS X;  1FNV A;  2PIA A;  3GOE A;  1GUA B;  4BOS C;  2VZK B;  1QQR A;  1SSN A;  1T5X D;  1WJ4 A;  4W9C A;  3S2A A;  2PLP A;  1GB1 A;  2K9X A;  2CHX A;  4BZA A;  3VRB B;  4YSZ B;  3ZRF A;  2PMV A;  3BK2 A;  1LO5 D;  1CQV A;  2AQ1 B;  3AUL A;  3J9C A;  4BBN C;  2V3S A;  2W54 A;  1E0Z A;  2G4S A;  4USA A;  2YEP B;  3FC4 A;  5EDS A;  4RM8 A;  1WXQ A;  1HXY D;  1VD2 A;  3L54 A;  1EM7 A;  4G50 A;  2DAF A;  2D3G A;  3VVW B;  2LRW A;  5IAA C;  4DDI D;  4LK0 M;  2KDB A;  1WMH A;  2WXL A;  3P4S B;  5IOI A;  4P7I A;  4KIK A;  3QJZ A;  1JRP A;  1FXA A;  2Y3A A;  3NOB A;  2Z0E B;  5CTR C;  1C3T A;  2D3B A;  3ZVV A;  4BKG A;  1WX7 A;  4LTU A;  3LVV A;  3WAL A;  1WRD B;  1K50 A;  3Q8B A;  1RRB A;  2WXQ A;  4MGY E;  4HDQ A;  2XK5 A;  1KH0 A;  1YMH E;  5C3J B;  1E9M A;  2HTH A;  2CJN A;  1R8G A;  2WDT B;  5HKH A;  4LDT D;  2N9X A;  2LI5 A;  1I0E A;  4FJZ A;  1JWU D;  1ZP0 B;  4CHK A;  2KFJ A;  1F52 A;  1C9F A;  2EEL A;  1N5W A;  1V5O A;  1MG4 A;  3SDL C;  1I4R A;  4Q2R A;  2WGS A;  3BVZ A;  5DPS A;  2INC C;  1V1O A;  2D5G A;  2Q5W D;  1V86 A;  2EMT A;  3CST A;  3NZU A;  1I7H A;  2D3C A;  3RI7 C;  2WLB A;  4F1S A;  3RNC C;  1C79 A;  1EUV B;  3VXW A;  4EEW A;  2WDQ B;  3U7Z A;  3U4E G;  3V60 A;  2PJH A;  3NHE B;  2SAK A;  4TV3 A;  1IP9 A;  2JRI B;  2A4Z A;  2WDV B;  5J99 A;  3EGR A;  3PHW B;  2BW2 A;  3HM6 X;  1RAX A;  1TS4 A;  2KFK B;  1FO4 A;  4WWP A;  1E90 A;  2ASQ A;  2KNB A;  2DYM A;  2VRR B;  1OQY A;  3P4P B;  1TS2 A;  3IAS 1;  4RF1 A;  4A3P A;  3ONS A;  1E8W A;  1LM8 B;  2R2Q A;  3NG0 A;  3ZW3 A;  1MHH E;  2WS3 B;  3H1U A;  1DGJ A;  4ZYS A;  5D3D A;  4MGI E;  2IO2 B;  2LFI A;  1WGH A;  1WXM A;  3DVN U;  3HVD A;  1QKZ A;  2IGG A;  3VH3 B;  2VH2 A;  3PRM B;  3UF8 A;  1VRA B;  1FFU A;  2WXG A;  2RDH A;  3MFG A;  3RNA C;  1RWS A;  4IWQ A;  2FAZ A;  1YX5 B;  1TY2 A;  3KYC D;  2KTR B;  1MPE A;  4XYC A;  3MP9 A;  4FHJ A;  1V97 A;  3IG8 A;  2KJR A;  1VR9 A;  3AEF B;  2XBB C;  3R8B A;  2CKH B;  1TY0 A;  3Q8F A;  4CO7 A;  4IM0 A;  3MJW A;  2WWZ A;  5G2N A;  1V8C A;  5EE9 A;  1TT5 B;  2WDR B;  4JX1 C;  2BB5 A;  3OWE B;  4HLE A;  1NBF C;  4K7U A;  1XEE A;  1Y8R C;  2J53 A;  1WI0 A;  1ZXI A;  1IYF A;  2DEN B;  2W9N A;  1ZUD 2;  3DBL I;  2KDI A;  4GGQ A;  2V9H A;  2IO0 B;  3IFW B;  5E6O A;  2WYQ A;  2OJR A;  3NVV A;  3CMM B;  3U30 A;  2ACZ B;  2M1M A;  2IPK D;  4ANV A;  4GOC A;  2PE6 B;  4GLS C;  4MH0 E;  2GBK A;  3HVZ A;  3I63 C;  4ZRK A;  2QMT A;  5G5G A;  3I5J C;  5IKC M;  3N20 C;  1B1Z A;  2ZZP B;  2CS4 A;  2IGH A;  5H92 C;  1YOV B;  3DVN V;  4XZ4 A;  3NVZ A;  4L2Y A;  3OG5 A;  1LFD A;  4ICV A;  2JQR B;  4M0W B;  2BYE A;  1HZ5 A;  1B9R A;  4I6P A;  4NAM A;  2N9E B;  4WIP A;  2KAC A;  3AEE B;  1WXV A;  3EHV A;  2KDM A;  3P2B A;  2QC8 A;  2HDE A;  1E7U A;  3R2I A;  2QDF A;  4MEL A;  3O65 B;  2QSD A;  3P42 A;  3NZT A;  3AN1 A;  1ZDV A;  2JWU A;  3A33 B;  3K9P B;  2KQ4 X;  2N9P C;  1LGR A;  3FIL B;  4IUM B;  4GDL B;  2KC1 A;  5J9A A;  5D2M B;  4RF0 A;  3TL5 A;  1U4A A;  3C19 A;  2JYT A;  4BBN F;  3M95 A;  2FCN A;  1SE4 A;  3LB8 C;  4GN1 A;  3PZD A;  1SJH D;  4DHJ B;  2JXT A;  3I57 A;  2DYB A;  2IJ0 A;  1EO6 A;  3L13 A;  1FM0 D;  3ZJV A;  1ET9 A;  4NQL B;  2FNJ B;  2JU6 X;  3WA0 A;  4M8M A;  3IT6 B;  1JWS D;  2J0J A;  4TQ0 A;  2IYD B;  1QLB B;  3W5V B;  1NYR A;  3T3N A;  4XE0 A;  5J2R A;  2REX A;  4RM9 A;  1D5Z C;  3N1Y C;  1FEH A;  1OQQ A;  3B2G A;  3N1X C;  5G55 A;  1R7S A;  2BQQ A;  2K3U A;  3VUW A;  3R66 C;  2BT6 A;  1CJE A;  3IXS A;  1WY8 A;  2Y5C A;  5JHA A;  4GVZ A;  1TZO A;  1YNT E;  2WXR A;  2NTT A;  4AOF A;  2IGD A;  2MP2 B;  3RZF A;  4KGS A;  1D4B A;  3MHZ A;  2RDB C;  1NEK B;  4HJG E;  3R2T A;  3PTF C;  1ISN A;  2NPT B;  4A8X C;  1XO3 A;  3CIR B;  1TYG B;  4NQK E;  1P9D U;  1C78 A;  2WXM A;  4KKI A;  4GMV A;  2CU3 A;  2J1Q A;  2GB1 A;  2QIE B;  2J4X A;  3NVY A;  2DZK A;  2PKO A;  1M94 A;  2BYT A;  4L23 A;  2MCN B;  3ENE A;  1KRH A;  4MGZ E;  2JRH A;  3RFZ B;  3LDZ E;  2KXJ A;  2KO3 A;  4FJV B;  5LNK 1;  1E7P B;  2JWZ A;  1MHX A;  2MEK A;  1TIF A;  4IKG A;  1GNU A;  1WF9 A;  2V4I B;  2NR2 A;  5JHB A;  2KAJ A;  2L7R A;  4YSY B;  2CU1 A;  1QT9 A;  1ZE3 D;  1R4M B;  4N59 A;  1L4Z B;  5IP4 D;  1I4G A;  2XEW A;  2BYF A;  2IY1 B;  4O1N A;  1SEB D;  4W9L A;  4M02 A;  2GLS A;  3AMZ A;  3PPA A;  4WJQ A;  1LXD A;  3VTU A;  4M01 A;  3MC9 A;  1SGH A;  4OVZ A;  1VJK A;  3L08 A;  2O2V B;  1N63 A;  1CMX B;  3PT2 B;  4FAD A;  4WQO B;  4BKS A;  1JAL A;  4RF6 A;  1AWD A;  1WIA A;  3UIO B;  3ZQ4 A;  2KFK A;  2MH7 A;  2LHE A;  3N9Y C;  1SXT A;  5JZE B;  4C00 A;  1FFV A;  4M8N A;  3AE4 B;  1GJZ A;  2GBM A;  3V3X A;  1TKE A;  2MBE A;  1CK1 A;  3B08 A;  4MH8 A;  4MM3 B;  4KKJ A;  2KYW A;  3KVF B;  2D2Q A;  3QHT A;  1IUE A;  3A9K B;  3Q8C A;  3ZNZ B;  4R3D A;  2INN E;  2B3A A;  2K6D B;  2MWS B;  3RNG C;  1VDV A;  2PW9 A;  3N3K B;  3GE8 C;  3KW5 B;  1SE2 A;  1SD0 A;  4WJO A;  2ZW0 A;  2OOB B;  2KTR A;  1S1Q B;  3Q8A A;  4LLG M;  1VZ7 A;  3DRB A;  4EE2 A;  1L0Y B;  2WXK A;  4FBJ B;  2WXJ A;  3URY A;  3NRZ A;  2KN4 A;  1E6E B;  1I4X A;  1J0G A;  3Q69 A;  4XDD A;  4B0M A;  5C2T B;  3IHP C;  2RSU A;  2Y5B B;  1SE3 A;  1P7F A;  2M8S A;  2WHI A;  2MRP A;  3AB5 A;  4LDT B;  1N62 A;  4ZRI A;  2LEK A;  4OVV A;  4NJ7 A;  4N58 A;  3TBL D;  2ZCC A;  3ZYY X;  2IND C;  2RR9 A;  4ZRQ A;  2MSE D;  2KWU B;  4ZYN A;  3EEC A;  1T3Q A;  4LJP B;  1KF6 B;  3CF6 E;  3AE9 B;  2LUM A;  2BWE S;  4CYE A;  1V5T A;  4HCN B;  4W9I A;  1WR1 A;  1WGR A;  5IN7 A;  3ECI A;  3UQB A;  1G6J A;  1XD3 B;  3V6C B;  4BAX A;  3QCA A;  3QIJ A;  3PZ7 A;  2C7M B;  3ZJU A;  2XNA C;  5E6N A;  4MT5 A;  2AQ3 B;  2M0X A;  1JRO A;  1WJ6 A;  2LRU A;  3L4P A;  1ZGU B;  5BYQ A;  1AYF A;  3A1Q B;  3DRE A;  4P1B C;  3WAP A;  2KX0 A;  5AZH A;  2YLM A;  3IG3 A;  1XCT L;  4FA6 A;  4TKN A;  4WAA A;  2DBY A;  4BOZ B;  1K51 A;  4M0W A;  5HG2 A;  4IDI A;  1DYQ A;  2N1V A;  4BFR A;  1VA6 A;  3LN6 A;  1I42 A;  3AH7 A;  3TMP B;  1C76 A;  3WIM A;  2L52 A;  4RH6 A;  1HZ6 A;  1QK1 A;  3VR8 B;  3AV8 A;  1SIJ A;  3Q3J A;  2E6X A;  2MQJ A;  2MW5 A;  4HDO A;  2LVQ A;  1N61 A;  2OJW A;  2QIL A;  4HRS A;  1NEN B;  4WUR A;  2M4N A;  1C1Y B;  3RNF C;  5T8I A;  2PE9 A;  3SEB A;  3V62 A;  2KX3 A;  2KT7 A;  2LGY A;  4HJK A;  4BG4 B;  3FIL A;  1WGG A;  4GDL A;  4ANU A;  3WAM A;  3PRZ A;  4YTN B;  1C4A A;  5EE0 A;  4YSX B;  2KMA A;  3GS2 A;  2JT4 B;  2ON8 A;  3RNE C;  4NNJ B;  3AE3 B;  1EWY C;  1L5P A;  4RF7 A;  4B95 A;  2LHD A;  3M10 A;  3AEG B;  3UGB B;  2PVO D;  1TJE A;  2KDF B;  5L95 C;  1FRD A;  4E74 A;  1V4G A;  2AEH A;  2ZEQ A;  4LCD E;  3EA6 A;  3TSS A;  1JW9 D;  3L0W B;  2BS2 B;  2WXF A;  4IWO A;  4ANX A;  1SIF A;  2EKE C;  1ZKH A;  3JW0 X;  1F2R I;  1QH4 A;  4US8 A;  3WAN A;  5D7G A;  2MBQ A;  1PQS A;  3P63 A;  3QX1 A;  4W9E A;  1F2R C;  3V05 A;  3L16 A;  1WFY A;  3D32 A;  1N5X A;  4JGH B;  2L0F A;  2KWD A;  2MP2 A;  2FE8 A;  2BVC A;  3FAH A;  1SBB B;  1FD6 A;  1HA5 A;  2H88 B;  1UNS A;  2VZK D;  1HEZ E;  2NPT A;  3M3J A;  2KOX A;  4GSW A;  3EUB 2;  3BVG A;  1WZ0 A;  1ENF A;  3EC8 A;  1E10 A;  3ZKJ C;  4J6I A;  2C9W B;  2QJL A;  2BYV E;  3JU5 A;  1UWX A;  3SHQ A;  4HPL B;  4N9F 4;  2JZ3 B;  3VAW A;  4DK5 A;  1M15 A;  1SJE D;  1PYW D;  2RDG A;  5TSS A;  5H8Y E;  1MG8 A;  3AE5 B;  1UBI A;  1Z5S B;  2MJE A;  3UIN B;  1GOZ A;  1I4P A;  1E5W A;  2MBH A;  1UF0 A;  1QOF A;  2D07 B;  4ACF A;  2JXX A;  5AZF A;  4DHZ B;  2C7H A;  1YQ4 B;  2LXA A;  1D5X C;  1TT4 A;  1V81 A;  1GC6 A;  1P50 A;  4II3 B;  2MHJ A;  1XXG A;  2Z8L A;  2G3Q B;  2J42 A;  4HPM B;  2K6Q A;  2N9L A;  2O2V A;  2PEA A;  1SF0 A;  2M19 A;  4REZ A;  4LNI A;  1KLV A;  3W5U B;  1QZE A;  1VRP A;  4YL8 A;  3BY4 B;  3TEY A;  1WGY A;  2IY0 B;  2KWV B;  2YEP F;  2AQ2 B;  3MTN B;  1Q0W B;  1IGD A;  3V6E B;  1EF5 A;  4IWP A;  1SB3 C;  1FCL A;  5L83 A; 
#chains in the Genus database with same CATH homology
 3ZXV A;  2WHI A;  2OJW A;  4RF8 A;  4LNO A;  2QC8 A;  1CRK A;  1U6R A;  4LNI A;  2J1Q A;  4ACF A;  3DRB A;  4Q2R A;  4LNK A;  2WGS A;  5J9A A;  2BVC A;  1HTO A;  1G0W A;  4GVZ A;  3NG0 A;  1F1H A;  1RL9 A;  3JU5 A;  4XYC A;  4RF7 A;  3B6R A;  4S0R A;  1QH4 A;  1VRP A;  2CRK A;  3M10 A;  4GW0 A;  4GVY A;  4BG4 A;  1M15 A;  2LGS A;  3L2E A;  4RF6 A;  2D3A A;  4AM1 A;  4BAX A;  2D3C A;  2D3B A;  1I0E A;  1FPY A;  1BG0 A;  4BG4 B;  3JQ3 A;  3L2E B;  5J99 A;  1QK1 A;  3L2D A;  3FKY A;  3JPZ A;  4Z9M A;  4LNN A;  4HPP A;  1P52 A;  3JU6 A;  3ZXR A;  1LGR A;  2UU7 A;  1HTQ A;  1P50 A;  1F52 A;  4LNF A;  4GW2 A;  3DRE A;  4BHL A;  2GLS A;  1SD0 A;  4RF9 A;  4S17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...