1HTQA

Multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
477
structure length
477
Chain Sequence
TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords glutamine synthetase
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 140
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htqA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htqA01
4LNNA 1HTQA 5J9AA 4GW0A 1F52A 4S17A 2BVCA 1U6RA 3JU6A 1P50A 5J99A 3ZXRA 1F1HA 4LNIA 1QK1A 1FPYA 3B6RA 1QH4A 3L2EA 4RF9A 3JU5A 3FKYA 4LNOA 4BG4B 2OJWA 1BG0A 3JPZA 1HTOA 2J1QA 2WGSA 4LNKA 4Q2RA 3DRBA 4BHLA 2LGSA 3L2EB 3M10A 4GVYA 4BAXA 1LGRA 4GW2A 1I0EA 2D3CA 3L2DA 4Z9MA 1RL9A 1P52A 1VRPA 3DREA 1SD0A 4GVZA 1CRKA 4S0RA 2CRKA 4ACFA 4RF6A 4BG4A 1M15A 4RF8A 2D3BA 2QC8A 3ZXVA 2D3AA 4HPPA 4XYCA 2UU7A 4LNFA 1G0WA 4RF7A 4AM1A 3JQ3A 2WHIA 2GLSA 3NG0A
chains in the Genus database with same CATH superfamily
2L7RA 1JW9D 1LFDA 1E0ZA 1YQBA 1D3ZA 1E7VA 3H8HA 4MSQB 2WS3B 4ZRPA 1TS2A 1SEBD 2KDMA 3ZNGC 1D5MC 3Q14C 3X0WA 3B2FA 5BO4B 3VQIA 2LEKA 3QJZA 2KT7A 1FD6A 2BYFA 1NBFC 2G3QB 3O65B 4YTPB 3RN9C 1E5WA 5H92C 3Q8CA 4GW2A 1VZ7A 2G4SA 4RGMA 3UI3A 2CS4A 2LVPA 2VZKD 2WX1A 3MHSD 2KYWA 4RF1A 3ZVVA 2ZW0A 1HEZE 4L1BA 2JUOA 4HDQA 5HI1A 2G1EA 3DWMA 3BYTB 3PVLA 2CJOA 4MGYE 4YTMB 1ZP0B 5D3IB 3PHXB 4B9KA 5CHVC 3QX1A 1UH6A 1KTKA 1MG4A 5KHQA 3V3XA 4NY0A 2LGYA 2D3AA 3A9JA 4NNJB 3ML9A 4L2YA 3RNCC 4MJSB 4ANXA 2K8CA 4BOSC 3Q8FA 3IVFA 3HRDD 1FRDA 2N0SB 1NYRA 1FPYA 3VTVA 3ZW3A 4RH6A 3QA8A 4P1CC 3DRBA 4MH8A 4JWUC 4W9FA 4YTNB 3PO0A 1FNWA 3KYDD 3EECA 1MHXA 2QEJC 1OQQA 3HVDA 4GDKB 1OGWA 2ZVNA 1KM7A 1XEEA 3ZJUA 2BF8B 3NY5A 2FIDA 5LNK1 2KWVB 2D11A 1RWSA 2NPTA 4KKJA 4KX6B 2JZPA 5DPTA 2WLBA 3MFGA 1D4BA 1UF0A 3KW5B 3DVGY 2O6VA 3PPAA 2KQ7A 3RZFA 5G55A 1F0ZA 2ZZPB 1TZOA 4KV2A 2WXLA 2MBOA 4YSXB 2GOWA 1JRPA 3M63B 4M8NA 1UZXB 2BS3B 1TKYA 1V1PB 3L0WB 1A5RA 1JWMD 4JLCA 1B9RA 2OJRA 1L0XB 4ZOHC 2M1MA 3PZ7A 1EU3A 3RNFC 3TUOA 2CHXA 1TS4A 4GB9A 3J9CA 4NPNA 3KQ4A 3PRMB 1C9FA 3VUXA 2ICIA 4HRSA 4J6IA 4W9CA 3X23A 4UDUC 1CZPA 1I4HA 2JPHA 3PTFC 3U30A 4LLGM 2WXFA 4HKQA 5EE3A 4NAWA 1A70A 4GGQA 2KJHB 2MLBA 4D2KA 3L16A 3VAWA 3EHVA 4MH0E 1WMHB 1WWTA 1Q1OA 2TSSA 3AEBB 2L3ZA 2L83A 1C1YB 4DQOC 2M17A 2V4LA 3Q3JA 3B9JA 3B6RA 1L6VA 2Y5PA 1IGCA 2PIAA 1WJNA 2W9NA 1XD3B 1ZDXA 2M19A 2PEAA 3LVWA 4HKZE 4TSSA 4ZDVA 2WXGA 1G0WA 3C19A 1E8WA 2WDRB 1HE8A 2CJNA 4NZLB 1ZKHA 2INNE 2LWPA 2INPE 3BY4B 4W9KA 4EEWA 3U7ZA 3A9KB 1V4GA 2GMIC 2D07B 3B08A 3ABVB 1TZ1A 4FA6A 1KLGD 1BT0A 2WU5B 4EFOA 3IAM1 1TJEA 1VZ8A 2JSVX 1IYFA 2D3BA 1N63A 2PMVA 1PYWD 1V97A 2KMMA 4E3CA 1UBQA 1C76A 2KFJA 2V3NA 3NZTA 3AU5A 1C4CA 4IOIE 4US9A 2LFIA 4LNKA 2BYEA 4DHJD 3QARA 3W1YA 3N1YC 3KUZA 2BTEA 1D5ZC 3GB1A 1WXVA 3DCGA 2HE7A 4BKGA 5JZEB 1N61A 3NS8A 2GLSA 3L2EA 3ZGZA 3ECIA 4FHJA 1F52A 1WRIA 1GPXA 4ICVA 3RI7C 3L10B 3AEEB 2DZKA 4IM0A 2JXXA 3T8MA 2WGSA 3JYUA 3DPDA 4JIOU 1GAQB 2DYMA 2Y5CA 1U4AA 3OAWA 3LN6A 3N20C 4XX5A 1Z2MA 2JVCA 2WXNA 4M8MA 2O2VB 2BT6A 1SIJA 2ONQA 3DWGC 2MJEA 2MP2A 2L76A 1SE2A 1WR1A 4PT5A 1GNUA 1K53A 4X57B 2KJ6A 1SBBB 2KANA 4BG4A 4E71A 3T3OA 3P4SB 1ZGUB 5D2MB 2OEDA 2C7MB 1GC6A 1ZXIA 4MT5A 4RF9A 3PLUA 2SAKA 1L4DB 3TMPB 2IO1B 3W2DA 3BK1A 2GWCA 3RT3B 1HQRD 4IWPA 2WDTB 3Q8EA 5AZFA 3A4SC 2IO2B 3M3JA 3ZO5B 2JYEA 4DXAB 4GMVA 3MC0B 3JU6A 1PGXA 2XK5A 2KAJA 4HXDA 4N58A 4RGNA 2MBEA 2N7DA 5FKAC 3EA6A 2AQ3B 1PFDA 4ZHOA 1N5WA 2ZJDA 1J7BA 1WYWB 2JRIB 2GWDA 4IDIA 4K1RB 4W9DA 1UELA 2FIFA 2MJ3A 5HKHA 4F8CB 4BBNC 1TY0A 3AE8B 4WWNA 2KX3A 1VA6A 1TKEA 2D2QA 2N7JA 4GDLB 1EO6A 1UD7A 1TT4A 1WGGA 3L54A 2CHZA 4XE0A 4GOCA 4M0WA 5CHFA 1I7HA 4ZYNA 4WJOA 2DZIA 1T3QA 5AZHA 1QOAA 2DENB 2KHWB 4A3OA 2L1AA 2AQ2B 5EE1A 1J7AA 1P7FA 1YQ4B 3DQVA 3C8YA 3JSVA 3R2IA 1SGHA 1WX7A 1T0RC 2VRRB 1L2NA 2KWUB 2D33A 3PHWB 3N3KB 1N5XA 3NHEB 4OZBA 3B1LX 1Q10A 3Q8BA 3HM6X 4YT0B 2HD5B 1WRDB 2FAZA 3RD2A 4L23A 2LXAA 2DAFA 3AULA 3AU4A 3H7PA 4BOZB 4OHJA 2W3SA 2WXOA 2KWDA 2NMQA 1DGJA 1WE6A 3KVFB 2KX0A 2MEKA 2KOXA 1JRUA 2N9KA 3ZQ4A 2JU6X 1NYQA 3P4QB 4USAA 3U52E 4XZ4A 4II3B 2IY0B 1WYGA 2V9HA 5TR5A 3P4PB 1GUAB 2AEHA 2O6VB 5E6JA 3HK0A 4JX1C 2M4NA 2MCNB 2CHWA 1WJ6A 1ZPSA 3NZ3A 4EZLA 3AEAB 2NVUI 1LM8B 1QT9A 4P6VF 4ICUA 4GN1A 3TJPA 2MBQA 3VRAB 1KLUD 2PVOD 4OVZA 3GP7A 2MJDA 2MSED 1HTOA 1ET6A 1RLFA 2J42A 2FCQA 1PGBA 3BVZA 1AYFA 3HIZA 4AOFA 5D94A 1K52A 1L7YA 4KGRA 3NS1A 1TY2A 1V9JA 4YWGG 3NZSA 3V6EB 2QDFA 2VH1A 3NJTA 1QH4A 1M94A 1P98A 1QOBA 1LQBA 2K1FA 2X38A 3L4PA 1WXSA 5IO9A 4HDOA 4RF6A 4ANUA 4HPMB 3R8BA 1D6EC 1SE3A 1KJTA 3I57A 1E7PB 4ANWA 1SSNA 3NG0A 4GW0A 1HXYD 2OOBB 3DHGC 4YL8A 2GI9A 1VRAB 2BYVE 4WH4A 1F77A 4IUMB 2KK8A 2N1WA 4BKSA 4BKSD 3ZDTA 2CKHB 1CMXB 1IBXA 4GIVA 2JXTA 3OG5A 1YD8U 1YN5A 3T9LA 2M0XA 5D7GA 1F1HA 3ML8A 3GZNB 2BYTA 1TS3A 4IC7B 2ZPNA 3P2BA 4OW0A 3SFDB 1R4NI 4KGSA 4RNAA 5C1ZA 5EE9A 3O13A 2KTRA 1SJED 2ZNVB 2QC8A 4HPPA 2RD0A 4ASWC 4MEMA 2J4XA 1WXMA 1P3QU 3Q3FA 4WAFA 3U2SC 3DDCB 3DBHI 2G4DB 5E6OA 2INCC 2N7EA 2GBKA 1KRHA 2UWQA 3I9V1 4FJZA 4LCDE 4BAXA 4CO7A 2INDC 4GSWA 4TQ0A 3UQAA 3V61A 4M00A 1NENB 5L83A 5KHOA 4EKUA 4WQOB 4B0EA 4MGIE 1UGJA 1QQRA 2L8JA 4BBNF 3DBRB 2N9EB 3ZLZA 2C60A 1JMLA 4ZRJA 3V6CB 2R2QA 2NS5A 3L2EB 3UGBB 4KKIA 3W5UB 3Q69A 3VUYA 4HVBA 1QOGA 2HDEA 3NVVA 2N9LA 2EKEC 3ENEA 1ISNA 1S3SG 4H2AA 4NAMA 4W9EA 1PUTA 4XDCA 5DCNA 3UINB 3PRZA 1IP9A 1QLBB 1C4PA 3WAPA 1AWDA 3UIOB 4ITKA 3IFWB 1JQ4A 5BMIA 3H9DA 2WXJA 1I35A 4RF8A 2FNJB 4HK2A 2WHIA 2HTHA 2KDEB 4LDTB 3KWVA 1L4ZB 1E8ZA 3NVZA 1WGYA 1LXDA 2BB5A 1OTRB 3LXFA 2CU3A 3VR9B 2LGSA 3ZIMA 2I1JA 1F2RC 2K9XA 3IT4B 5LXHA 4K7UA 4ACFA 3Q2AC 1L5PA 5IP4D 1TIFA 2G45B 4LNNA 1SIFA 1P9DU 3IBEA 1ROEA 5IA7A 1SE9A 5J99A 4MGZE 2V4IB 2WXPA 4EE2A 1YN4A 3RMKC 1YOVB 3OLMD 3BK2A 4DWFA 2KLGA 2R2OA 3WAMA 1KLVA 3BYYB 2LI5A 2KQ4X 2W3RA 3ZUNA 2NTSA 2BWFA 2J7QB 2RGFA 2C5LC 4URKA 5IN7A 2KWCA 3TEZA 4R3DA 4US8A 2NR2A 2Z59B 3ZNZB 2WDVB 1V8CA 3DBHB 4DXGA 2VH2A 5G2NA 2K39A 4AWJA 2Z0EB 4FLHA 1EU4A 1CK1A 4OZCA 2LASA 1I42A 1V5TA 4LJOB 3W9CB 3P4RB 3N30A 4XGAB 1HTQA 4PS8A 2KMCA 1L6UA 4F7ZA 1CQVA 3PZ8A 3VTUA 1BUIC 4LNOA 1ZW7A 2ZCCA 5J17A 2MQJA 3B2GA 1T6BX 2JZZA 4REZA 1Q5WB 3A4RA 5BMGA 2EKIA 3ONSA 1I4RA 4YSYB 1I4XA 4JQWC 3HVZA 3AM9A 1YQ3B 3N1XC 4W9IA 1T5XD 2KLCA 4M02A 1QKZA 5CX3A 3WAOA 1R8GA 2B3AA 1K51A 4OZAA 3PGEA 2IY1B 1JALA 2A5UA 3AE1B 2M0AA 4AM1A 4HCPB 1WX8A 5HG2A 2L32A 3ZRFA 2LZ6A 2KQSA 1V6EA 2PE9A 3MTNB 3PLVA 1FCLA 2KJRA 3ETRA 5EE0A 2JQRB 3PREA 4MDKE 4TKNA 1FMAD 2KKCA 3A1QB 3EFUA 3DBLI 1R7SA 4C4VA 1MI0A 3R3MA 3TEWA 4TQ1A 2LD9A 1R4MI 1Y8RC 5LLIA 5IKCM 3RNBC 1YNTE 1UGMA 4MSMB 3JU5A 3APCA 3L08A 1GOZA 3Q3NC 1TS5A 4MJSA 4GVYA 1RM6C 4RFBA 1TBEA 1M4VA 4RMAA 1AARA 3IG8A 4FADA 4MELA 2RPVA 1H4RA 2C7HA 4PYUA 4KIKB 3AN1A 4LNIA 1PDXA 1GB1A 2Z0DB 2QJLA 5MPOA 4DK5A 1XCQL 3ZYYX 2KXJA 1SXTA 2QSDA 2R61A 2KD0A 3DVNU 3FILA 2PE6B 2JT4B 1M15A 3H1UA 1WGKA 4ZRIA 4KDLB 3WIMA 5C3JB 2LVQA 2N4FA 2JX5A 3EC8A 2K25A 3AE9B 2QMTA 4I6LB 3TBLD 3DHHC 2BS2B 3K9PB 2AQ1B 3RNGC 3R7RA 2M8SA 2PKOA 2ACZB 4MM3B 4EZKA 1V49A 5JXVA 2J1QA 2RR9A 2H89B 3IT6B 4LDTD 1HZ5A 4K3BA 2AL6A 5GXGB 4A55A 1H8CA 1GG3A 3JW0X 3TIXA 2PW9A 3BVMA 4IM2A 2Z8LA 4II2B 1WF9A 2WQYB 5EDSA 2WWZA 4KGTA 4TMAB 3DVGX 2MBBB 4ARIA 1MPEA 1WY8A 4G50A 1V1PA 1P7EA 3APDA 2D5GA 4FN2A 4N59A 3P63A 2FCSA 1C4AA 1BMLC 4RGTA 2BW2A 2WXRA 2V0GA 1YN3A 1L0YB 1N62A 2NBVB 2KTRB 3ZJTA 1V5OA 3AECB 4BHLA 2BKRB 2MH7A 3IAS1 3NVYA 3U8ZA 3ZKJC 2LRWA 5E6PA 3N32A 2D3CA 1RFKA 4KZ0A 1RFAA 3DBLB 1IGDA 3GE8C 4PS3A 3KYCD 2GRIA 4WAAA 2L0TA 4ZHPA 4EZJA 1WMHA 1KOTA 3EFCA 4ANVA 1RAXA 3JPZA 3A9JB 2WXQA 1DYQA 5IAAC 1EF5A 3PSEB 3VHTC 1T0SC 3MC9A 3W5VB 1STEA 2D10A 3HM3A 3DHIC 4JPSA 2KNBA 3AH7A 2DLBA 1AN8A 2KACA 4NQLB 3AV8A 2WX0A 2Y5BB 5JHBA 4K7WA 2WU2B 1E7UA 2KDIA 2BB6A 3APFA 4K3CA 5DPRA 1KFYB 4B95A 3KLSX 1VZ6A 5BYRA 1XLPA 4FBJB 4HJGE 3A9KA 3LDZE 2I38A 4W9GA 1NI2A 4DHZB 3BIID 3AI5A 2NTTA 5AZGA 1WSPA 4RM8A 2QCZA 4RM9A 2ZVOA 3L13A 2NPTB 2IO3B 2K3UA 2DAJA 1Z5SB 4OVVA 3ZDMC 4A3PA 5E6NA 3K9OB 2GBMA 4A8XC 2LGDA 1OEYJ 2DZJA 1CRKA 3ZRCA 1WIAA 4HROA 3JQ3A 3B0AA 2ZPYA 1EF1A 3RYTA 4B6WA 4J3OD 1HZ6A 2JYTA 2LHDA 4HJKA 1ZXHA 3D32A 2JWZA 5J18A 5CTRC 2V3SA 1RRBA 4Q2RA 1T0YA 3EUB2 1T0QC 2YLMA 1TT5B 4RF7A 3UIPB 4C7ZA 3CWIA 3AE7B 1FNUA 1S1QB 1ET9A 1WXQA 2JY6A 3CSTA 5D6JB 2K8BA 3CIRB 2O2VA 4JE3B 4FULA 2WXMA 3H7SA 3QIJA 4IWQA 5DPSA 4AJYB 4DDGD 4KSKC 5I4DA 3DREA 2J0JA 3TEXA 1WFYA 2QILA 3AEDB 1C79A 1MJDA 2IGDA 1JWSD 1J8CA 2ZEQA 2E6XA 3E56A 1QK1A 4NAWB 2KZRA 2OHFA 2LRUA 2Y3AA 3S2AA 2OJWA 5H8YE 1E8YA 1IPGA 2K6DB 2IO0B 4W9HA 3Q6BA 3LVVA 3PS6A 3VH4B 3AB5A 4B0MA 3NUHB 2MHJA 4NJ7A 3QHTA 4RF0A 4ZRQA 4M01A 2EMTA 3TSSA 3AEGB 3HUIA 3WCQA 4WJQA 2FCNA 2BGFA 3RCZA 3IHPC 1NI3A 2WP9B 4WWMA 3KWLA 3ZTCA 1XLOA 1I4PA 3AE3B 5TSSA 2ZW1A 4N9F4 1JWAD 2N9XA 1TYGB 1JWBD 4HCNB 1VCBA 1VR9A 4C7YA 5J9AA 2DYOA 1P50A 4EOYA 3ZJVA 1TGZB 4HPLB 4BVUC 4HWIB 3FKYA 1J0GA 2PVGC 1QF6A 4N6EB 3ALBA 1ZOYB 1FCCC 1YJ1A 4WURA 2J52A 2KC2A 1F2RI 4GDLA 2A4ZA 4LK0M 4S0RA 4P16A 1WI0A 4WIPA 2LJIA 4P7IA 1Y56A 3UF8A 4DHJB 1GB4A 4KZCA 2DX5B 1U6RA 2IJ0A 2BKFA 4C4VB 1YJJA 2W54A 2H88B 3SR6A 3MC8A 2YVCA 4WWOA 2LUMA 5C23A 2WYQA 1SD0A 2XBBC 2PTLA 2KN4A 5AEKB 2LVOA 4YXDB 5LXIB 2LHEA 2WNMA 2RSUA 4BFRA 4TUUA 2LXCA 2DWQA 3ZXRA 3TCAA 2D3GA 2N1VA 5IOIA 1WE7A 2YEPF 3RUIB 1E8XA 4MACA 1FNVA 4HEA1 1EUVB 2XEWA 1XO3A 1DOYA 1D5XC 1I4QA 2FCMA 4A9AA 2XNAC 1WGDA 1WZ0A 1VDVA 2MP2B 4AS1A 4RGOS 2IBIB 1F9JA 3AMZA 2D32A 4NQKE 2FE8A 2K5PA 3FILB 2W55A 1E90A 2HJ8A 1KH0A 3N9YC 4WJNA 2KDFB 4BG4B 2BQQA 1V80A 1ZUD2 2SEBD 4XC2A 2LGIA 2LMCA 1K50A 1YIWA 3GS2A 3SHQA 4I6NB 2CRKA 3FC4A 2EMSA 1DOXA 1E6EB 2KFKA 1SJHD 2AL3A 1FXIA 1XXGA 1XLNA 2Q5WD 1WGRA 2MW5A 2O6VD 2QIEB 3Q3OC 1VLBA 3QQ8B 2FBWB 3I63C 3JVZX 2DBYA 1I4GA 4C00A 3R66C 1UWMA 4WQMA 4Z9MA 2ON8A 2XK5B 3SEBA 4XWTA 2IZVB 3QWZB 4CYEA 2L0FA 1N6ZA 3AEFB 2J0KA 2KVRA 3W1SA 5T8IA 1R4NB 3ZNID 1MVKA 4O1NA 2AX5A 2BPSA 4K7SA 2BVCA 2I2YA 3MJWA 2PJHA 3OWEB 1UUPA 1KF6B 1Q0WB 4FJYA 3UQBA 1V81A 2KVZA 4P1BC 1FFUA 2MWSB 4PYZA 2HTME 2REXA 1YMHE 4C56C 1WX9A 1V2YA 3IG5A 2PPHA 3MJ5A 4DXFA 4EUTA 2IYDB 4M0WB 3RPFC 1N60A 4PK1A 3AE4B 4IW0A 2BWES 1GJZA 2I1KA 4G11A 3VXWA 2QHOA 4E74A 1WJ4A 4IM3A 3M10A 1FEHA 3LYYA 3VR8B 1I0EA 2LUEA 3QCAA 3L2DA 1MFWA 4A6QA 3CF6E 3PT2B 1V86A 1OEYA 3JSVB 2ZCBA 4ZYSA 2JRHA 1NVID 3DBSA 1WZ3A 1LO5D 3VDZA 1EWYC 5J2RA 1P0RA 2AWTA 1FXAA 5AUKA 3V05A 3LN7A 5DPWA 4HLEA 3RULA 4W9JA 3R2TA 2HJ1A 1NEKB 3RNAC 3BINA 1WH3A 3H7PB 3TL5A 2DZMA 2X8XX 4WJPA 1SB3C 3M95A 3MP9A 4ARCA 3BVGA 1ESFA 2J53A 3VFKA 3T3NA 1EM7A 2RDHA 1JROA 4JGHB 1ZE3D 4FJVB 4AJWA 1VRPA 2FUG1 2RDBC 4JWSC 1J19A 3RFZB 4G3XB 1YJIA 1XF5L 4Q2JA 1JCKB 3CSFA 4GLSC 2L52A 5AUIA 2NBUA 4GXBA 5G5GA 3V60A 1TTNA 1LGRA 2BBCA 5BYQA 1RL9A 1VD2A 2IDYA 4F1SA 5BYSA 5CHWA 1IUEA 1WXAA 2KN5A 3ZNHB 4I6PA 4DBGA 1P1AA 1MHHE 2LJ5A 1DOIA 2WDQB 2L05A 1FRRA 4GDKA 3RZWC 2RPQA 3BZDB 2UU7A 2KMAA 3TEYA 1VJKA 2GBRA 5G5HA 4CHKA 1TKGA 2AYOB 3IG3A 4TV3A 4NJ6A 3HHMA 3QK0A 3WA0A 1ENFA 2MBHA 2L00B 1PGAA 3CMMB 2RMMA 3NVWA 3H6NA 1MG8A 2B76B 2M56B 1WGHA 2GB1A 1UWXA 2IPKD 4LTUA 1XLQA 1C78A 3RNEC 3V62A 5FR6A 1SE4A 1X1MA 2K22A 3PV1A 3U4EG 3VVWB 2WXIA 2MX2A 1AW7A 1L0VB 3FAHA 1IBXB 1B1ZA 1OQYA 1BG0A 1OQRA 1J7CA 2NBWB 1SF0A 4CQNA 1WJUA 2KC1A 2UYZB 3OJ3A 3PRPB 1YX5B 4A90A 3EGRA 3DOWA 4NJCA 1YX6B 3P42A 4WWPA 3WANA 3NZUA 2WXKA 3SDLC 1QZEA 2GBJA 5BMHA 2IGGA 2C7NB 2VZKB 1WR6E 3P1MA 4YSZB 4IWOA 1P52A 2WXHA 3NOBA 3IXSA 4XDDA 4XYCA 4KDIC 3LB8C 1GC7A 2DYBA 4S17A 1R4MB 2KO3A 1K8RB 2XN9C 3AXCA 1UNSA 4IKGA 4KSLC 2CU1A 4FXCA 3Q3MC 1EWCA 1RYJA 2ASQA 4A20A 3GOEA 4ZRKA 2BS4B 2RDGA 2KDBA 3LJ3A 1C3TA 4IG7B 5D3DA 3KUDB 4LNFA 2G9HD 2K6QA 4JL9A 1FM0D 5FK9C 3MHZA 3QC8B 4K81A 4W9LA 1FFVA 1PQSA 2MRPA 4XWWA 4RCOA 2LGXA 3AE5B 1HA5A 1WM2A 1UBIA 3QAQA 3URYA 2K0PA 3NRZA 3C0RB 4G0NB 3VUWA 5JHAA 3AE6B 3VTWA 4QAYA 5HHDG 3GZNI 1ZDVA 2FUHB 2DHZA 3L17A 3W1SC 3KH0A 2N9PC 4LJPB 2YEPB 1WM3A 2CR5A 1FIQA 3R7QA 3I3TB 4OVUA 2JZ3B 3VH3B 1V1OA 3A1QA 1QOFA 1QILA 3E9SA 3I5JC 1ACCA 4PS7A 2V1YA 2JWUA 2GBNA 2KFKB 3DVNV 3ZTDA 1BXTA 3N1ZC 3KUCB 3M62B 5C2TB 5L95C 1C77A 2W82A 4MGKE 4BKTA 1G6JA 1CJEA 3A33B 3DBRI 4FHKA 3SD5A 3SU8X 3BWUD 3GE3C 3PZDA 1FXTB 2JF5A 1E10A 5FR3A 3OJ4B 4KVGB 4BZAA 2EELA 1NDDA 3Q8AA 4KIKA 1JWUD 4AQ7A 2DNFA 4GVZA 4GU2A 2K8HA 3ZXVA 1XT9B 2J0MA 3SFEB 2KTFA 2IGHA 1E9MA 2C9WB 2NCNA 3U7DA 5HFYA 5GMVA 2ZNVC 4DHZE 3AE2B 5JH5C 1OFFA 2PLPA 2E3TA 4DDID 2MA9B 3WALA 4AP4C 1FO4A 1XCTL 4MM3A 4AUQC 2V3PA 3VRBB 4C80A 1XQQA
chains in the Genus database with same CATH topology
4LNNA 1HTQA 5J9AA 4GW0A 1F52A 4S17A 2BVCA 1U6RA 3JU6A 1P50A 5J99A 3ZXRA 1F1HA 4LNIA 1QK1A 1FPYA 3B6RA 1QH4A 3L2EA 4RF9A 3JU5A 3FKYA 4LNOA 4BG4B 2OJWA 1BG0A 3JPZA 1HTOA 2J1QA 2WGSA 4LNKA 4Q2RA 3DRBA 4BHLA 2LGSA 3L2EB 3M10A 4GVYA 4BAXA 1LGRA 4GW2A 1I0EA 2D3CA 3L2DA 4Z9MA 1RL9A 1P52A 1VRPA 3DREA 1SD0A 4GVZA 1CRKA 4S0RA 2CRKA 4ACFA 4RF6A 4BG4A 1M15A 4RF8A 2D3BA 2QC8A 3ZXVA 2D3AA 4HPPA 4XYCA 2UU7A 4LNFA 1G0WA 4RF7A 4AM1A 3JQ3A 2WHIA 2GLSA 3NG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNN A;  1HTQ A;  5J9A A;  4GW0 A;  1F52 A;  4S17 A;  2BVC A;  1U6R A;  3JU6 A;  1P50 A;  5J99 A;  3ZXR A;  1F1H A;  4LNI A;  1QK1 A;  1FPY A;  3B6R A;  1QH4 A;  3L2E A;  4RF9 A;  3JU5 A;  3FKY A;  4LNO A;  4BG4 B;  2OJW A;  1BG0 A;  3JPZ A;  1HTO A;  2J1Q A;  2WGS A;  4LNK A;  4Q2R A;  3DRB A;  4BHL A;  2LGS A;  3L2E B;  3M10 A;  4GVY A;  4BAX A;  1LGR A;  4GW2 A;  1I0E A;  2D3C A;  3L2D A;  4Z9M A;  1RL9 A;  1P52 A;  1VRP A;  3DRE A;  1SD0 A;  4GVZ A;  1CRK A;  4S0R A;  2CRK A;  4ACF A;  4RF6 A;  4BG4 A;  1M15 A;  4RF8 A;  2D3B A;  2QC8 A;  3ZXV A;  2D3A A;  4HPP A;  4XYC A;  2UU7 A;  4LNF A;  1G0W A;  4RF7 A;  4AM1 A;  3JQ3 A;  2WHI A;  2GLS A;  3NG0 A; 
#chains in the Genus database with same CATH topology
 2L7R A;  1JW9 D;  1LFD A;  1E0Z A;  1YQB A;  1D3Z A;  1E7V A;  3H8H A;  4MSQ B;  2WS3 B;  4ZRP A;  1TS2 A;  1SEB D;  2KDM A;  3ZNG C;  1D5M C;  3Q14 C;  3X0W A;  3B2F A;  5BO4 B;  3VQI A;  2LEK A;  3QJZ A;  2KT7 A;  1FD6 A;  2BYF A;  1NBF C;  2G3Q B;  3O65 B;  4YTP B;  3RN9 C;  1E5W A;  5H92 C;  3Q8C A;  4GW2 A;  1VZ7 A;  2G4S A;  4RGM A;  3UI3 A;  2CS4 A;  2LVP A;  2VZK D;  2WX1 A;  3MHS D;  2KYW A;  4RF1 A;  3ZVV A;  2ZW0 A;  1HEZ E;  4L1B A;  2JUO A;  4HDQ A;  5HI1 A;  2G1E A;  3DWM A;  3BYT B;  3PVL A;  2CJO A;  4MGY E;  4YTM B;  1ZP0 B;  5D3I B;  3PHX B;  4B9K A;  5CHV C;  3QX1 A;  1UH6 A;  1KTK A;  1MG4 A;  5KHQ A;  3V3X A;  4NY0 A;  2LGY A;  2D3A A;  3A9J A;  4NNJ B;  3ML9 A;  4L2Y A;  3RNC C;  4MJS B;  4ANX A;  2K8C A;  4BOS C;  3Q8F A;  3IVF A;  3HRD D;  1FRD A;  2N0S B;  1NYR A;  1FPY A;  3VTV A;  3ZW3 A;  4RH6 A;  3QA8 A;  4P1C C;  3DRB A;  4MH8 A;  4JWU C;  4W9F A;  4YTN B;  3PO0 A;  1FNW A;  3KYD D;  3EEC A;  1MHX A;  2QEJ C;  1OQQ A;  3HVD A;  4GDK B;  1OGW A;  2ZVN A;  1KM7 A;  1XEE A;  3ZJU A;  2BF8 B;  3NY5 A;  2FID A;  5LNK 1;  2KWV B;  2D11 A;  1RWS A;  2NPT A;  4KKJ A;  4KX6 B;  2JZP A;  5DPT A;  2WLB A;  3MFG A;  1D4B A;  1UF0 A;  3KW5 B;  3DVG Y;  2O6V A;  3PPA A;  2KQ7 A;  3RZF A;  5G55 A;  1F0Z A;  2ZZP B;  1TZO A;  4KV2 A;  2WXL A;  2MBO A;  4YSX B;  2GOW A;  1JRP A;  3M63 B;  4M8N A;  1UZX B;  2BS3 B;  1TKY A;  1V1P B;  3L0W B;  1A5R A;  1JWM D;  4JLC A;  1B9R A;  2OJR A;  1L0X B;  4ZOH C;  2M1M A;  3PZ7 A;  1EU3 A;  3RNF C;  3TUO A;  2CHX A;  1TS4 A;  4GB9 A;  3J9C A;  4NPN A;  3KQ4 A;  3PRM B;  1C9F A;  3VUX A;  2ICI A;  4HRS A;  4J6I A;  4W9C A;  3X23 A;  4UDU C;  1CZP A;  1I4H A;  2JPH A;  3PTF C;  3U30 A;  4LLG M;  2WXF A;  4HKQ A;  5EE3 A;  4NAW A;  1A70 A;  4GGQ A;  2KJH B;  2MLB A;  4D2K A;  3L16 A;  3VAW A;  3EHV A;  4MH0 E;  1WMH B;  1WWT A;  1Q1O A;  2TSS A;  3AEB B;  2L3Z A;  2L83 A;  1C1Y B;  4DQO C;  2M17 A;  2V4L A;  3Q3J A;  3B9J A;  3B6R A;  1L6V A;  2Y5P A;  1IGC A;  2PIA A;  1WJN A;  2W9N A;  1XD3 B;  1ZDX A;  2M19 A;  2PEA A;  3LVW A;  4HKZ E;  4TSS A;  4ZDV A;  2WXG A;  1G0W A;  3C19 A;  1E8W A;  2WDR B;  1HE8 A;  2CJN A;  4NZL B;  1ZKH A;  2INN E;  2LWP A;  2INP E;  3BY4 B;  4W9K A;  4EEW A;  3U7Z A;  3A9K B;  1V4G A;  2GMI C;  2D07 B;  3B08 A;  3ABV B;  1TZ1 A;  4FA6 A;  1KLG D;  1BT0 A;  2WU5 B;  4EFO A;  3IAM 1;  1TJE A;  1VZ8 A;  2JSV X;  1IYF A;  2D3B A;  1N63 A;  2PMV A;  1PYW D;  1V97 A;  2KMM A;  4E3C A;  1UBQ A;  1C76 A;  2KFJ A;  2V3N A;  3NZT A;  3AU5 A;  1C4C A;  4IOI E;  4US9 A;  2LFI A;  4LNK A;  2BYE A;  4DHJ D;  3QAR A;  3W1Y A;  3N1Y C;  3KUZ A;  2BTE A;  1D5Z C;  3GB1 A;  1WXV A;  3DCG A;  2HE7 A;  4BKG A;  5JZE B;  1N61 A;  3NS8 A;  2GLS A;  3L2E A;  3ZGZ A;  3ECI A;  4FHJ A;  1F52 A;  1WRI A;  1GPX A;  4ICV A;  3RI7 C;  3L10 B;  3AEE B;  2DZK A;  4IM0 A;  2JXX A;  3T8M A;  2WGS A;  3JYU A;  3DPD A;  4JIO U;  1GAQ B;  2DYM A;  2Y5C A;  1U4A A;  3OAW A;  3LN6 A;  3N20 C;  4XX5 A;  1Z2M A;  2JVC A;  2WXN A;  4M8M A;  2O2V B;  2BT6 A;  1SIJ A;  2ONQ A;  3DWG C;  2MJE A;  2MP2 A;  2L76 A;  1SE2 A;  1WR1 A;  4PT5 A;  1GNU A;  1K53 A;  4X57 B;  2KJ6 A;  1SBB B;  2KAN A;  4BG4 A;  4E71 A;  3T3O A;  3P4S B;  1ZGU B;  5D2M B;  2OED A;  2C7M B;  1GC6 A;  1ZXI A;  4MT5 A;  4RF9 A;  3PLU A;  2SAK A;  1L4D B;  3TMP B;  2IO1 B;  3W2D A;  3BK1 A;  2GWC A;  3RT3 B;  1HQR D;  4IWP A;  2WDT B;  3Q8E A;  5AZF A;  3A4S C;  2IO2 B;  3M3J A;  3ZO5 B;  2JYE A;  4DXA B;  4GMV A;  3MC0 B;  3JU6 A;  1PGX A;  2XK5 A;  2KAJ A;  4HXD A;  4N58 A;  4RGN A;  2MBE A;  2N7D A;  5FKA C;  3EA6 A;  2AQ3 B;  1PFD A;  4ZHO A;  1N5W A;  2ZJD A;  1J7B A;  1WYW B;  2JRI B;  2GWD A;  4IDI A;  4K1R B;  4W9D A;  1UEL A;  2FIF A;  2MJ3 A;  5HKH A;  4F8C B;  4BBN C;  1TY0 A;  3AE8 B;  4WWN A;  2KX3 A;  1VA6 A;  1TKE A;  2D2Q A;  2N7J A;  4GDL B;  1EO6 A;  1UD7 A;  1TT4 A;  1WGG A;  3L54 A;  2CHZ A;  4XE0 A;  4GOC A;  4M0W A;  5CHF A;  1I7H A;  4ZYN A;  4WJO A;  2DZI A;  1T3Q A;  5AZH A;  1QOA A;  2DEN B;  2KHW B;  4A3O A;  2L1A A;  2AQ2 B;  5EE1 A;  1J7A A;  1P7F A;  1YQ4 B;  3DQV A;  3C8Y A;  3JSV A;  3R2I A;  1SGH A;  1WX7 A;  1T0R C;  2VRR B;  1L2N A;  2KWU B;  2D33 A;  3PHW B;  3N3K B;  1N5X A;  3NHE B;  4OZB A;  3B1L X;  1Q10 A;  3Q8B A;  3HM6 X;  4YT0 B;  2HD5 B;  1WRD B;  2FAZ A;  3RD2 A;  4L23 A;  2LXA A;  2DAF A;  3AUL A;  3AU4 A;  3H7P A;  4BOZ B;  4OHJ A;  2W3S A;  2WXO A;  2KWD A;  2NMQ A;  1DGJ A;  1WE6 A;  3KVF B;  2KX0 A;  2MEK A;  2KOX A;  1JRU A;  2N9K A;  3ZQ4 A;  2JU6 X;  1NYQ A;  3P4Q B;  4USA A;  3U52 E;  4XZ4 A;  4II3 B;  2IY0 B;  1WYG A;  2V9H A;  5TR5 A;  3P4P B;  1GUA B;  2AEH A;  2O6V B;  5E6J A;  3HK0 A;  4JX1 C;  2M4N A;  2MCN B;  2CHW A;  1WJ6 A;  1ZPS A;  3NZ3 A;  4EZL A;  3AEA B;  2NVU I;  1LM8 B;  1QT9 A;  4P6V F;  4ICU A;  4GN1 A;  3TJP A;  2MBQ A;  3VRA B;  1KLU D;  2PVO D;  4OVZ A;  3GP7 A;  2MJD A;  2MSE D;  1HTO A;  1ET6 A;  1RLF A;  2J42 A;  2FCQ A;  1PGB A;  3BVZ A;  1AYF A;  3HIZ A;  4AOF A;  5D94 A;  1K52 A;  1L7Y A;  4KGR A;  3NS1 A;  1TY2 A;  1V9J A;  4YWG G;  3NZS A;  3V6E B;  2QDF A;  2VH1 A;  3NJT A;  1QH4 A;  1M94 A;  1P98 A;  1QOB A;  1LQB A;  2K1F A;  2X38 A;  3L4P A;  1WXS A;  5IO9 A;  4HDO A;  4RF6 A;  4ANU A;  4HPM B;  3R8B A;  1D6E C;  1SE3 A;  1KJT A;  3I57 A;  1E7P B;  4ANW A;  1SSN A;  3NG0 A;  4GW0 A;  1HXY D;  2OOB B;  3DHG C;  4YL8 A;  2GI9 A;  1VRA B;  2BYV E;  4WH4 A;  1F77 A;  4IUM B;  2KK8 A;  2N1W A;  4BKS A;  4BKS D;  3ZDT A;  2CKH B;  1CMX B;  1IBX A;  4GIV A;  2JXT A;  3OG5 A;  1YD8 U;  1YN5 A;  3T9L A;  2M0X A;  5D7G A;  1F1H A;  3ML8 A;  3GZN B;  2BYT A;  1TS3 A;  4IC7 B;  2ZPN A;  3P2B A;  4OW0 A;  3SFD B;  1R4N I;  4KGS A;  4RNA A;  5C1Z A;  5EE9 A;  3O13 A;  2KTR A;  1SJE D;  2ZNV B;  2QC8 A;  4HPP A;  2RD0 A;  4ASW C;  4MEM A;  2J4X A;  1WXM A;  1P3Q U;  3Q3F A;  4WAF A;  3U2S C;  3DDC B;  3DBH I;  2G4D B;  5E6O A;  2INC C;  2N7E A;  2GBK A;  1KRH A;  2UWQ A;  3I9V 1;  4FJZ A;  4LCD E;  4BAX A;  4CO7 A;  2IND C;  4GSW A;  4TQ0 A;  3UQA A;  3V61 A;  4M00 A;  1NEN B;  5L83 A;  5KHO A;  4EKU A;  4WQO B;  4B0E A;  4MGI E;  1UGJ A;  1QQR A;  2L8J A;  4BBN F;  3DBR B;  2N9E B;  3ZLZ A;  2C60 A;  1JML A;  4ZRJ A;  3V6C B;  2R2Q A;  2NS5 A;  3L2E B;  3UGB B;  4KKI A;  3W5U B;  3Q69 A;  3VUY A;  4HVB A;  1QOG A;  2HDE A;  3NVV A;  2N9L A;  2EKE C;  3ENE A;  1ISN A;  1S3S G;  4H2A A;  4NAM A;  4W9E A;  1PUT A;  4XDC A;  5DCN A;  3UIN B;  3PRZ A;  1IP9 A;  1QLB B;  1C4P A;  3WAP A;  1AWD A;  3UIO B;  4ITK A;  3IFW B;  1JQ4 A;  5BMI A;  3H9D A;  2WXJ A;  1I35 A;  4RF8 A;  2FNJ B;  4HK2 A;  2WHI A;  2HTH A;  2KDE B;  4LDT B;  3KWV A;  1L4Z B;  1E8Z A;  3NVZ A;  1WGY A;  1LXD A;  2BB5 A;  1OTR B;  3LXF A;  2CU3 A;  3VR9 B;  2LGS A;  3ZIM A;  2I1J A;  1F2R C;  2K9X A;  3IT4 B;  5LXH A;  4K7U A;  4ACF A;  3Q2A C;  1L5P A;  5IP4 D;  1TIF A;  2G45 B;  4LNN A;  1SIF A;  1P9D U;  3IBE A;  1ROE A;  5IA7 A;  1SE9 A;  5J99 A;  4MGZ E;  2V4I B;  2WXP A;  4EE2 A;  1YN4 A;  3RMK C;  1YOV B;  3OLM D;  3BK2 A;  4DWF A;  2KLG A;  2R2O A;  3WAM A;  1KLV A;  3BYY B;  2LI5 A;  2KQ4 X;  2W3R A;  3ZUN A;  2NTS A;  2BWF A;  2J7Q B;  2RGF A;  2C5L C;  4URK A;  5IN7 A;  2KWC A;  3TEZ A;  4R3D A;  4US8 A;  2NR2 A;  2Z59 B;  3ZNZ B;  2WDV B;  1V8C A;  3DBH B;  4DXG A;  2VH2 A;  5G2N A;  2K39 A;  4AWJ A;  2Z0E B;  4FLH A;  1EU4 A;  1CK1 A;  4OZC A;  2LAS A;  1I42 A;  1V5T A;  4LJO B;  3W9C B;  3P4R B;  3N30 A;  4XGA B;  1HTQ A;  4PS8 A;  2KMC A;  1L6U A;  4F7Z A;  1CQV A;  3PZ8 A;  3VTU A;  1BUI C;  4LNO A;  1ZW7 A;  2ZCC A;  5J17 A;  2MQJ A;  3B2G A;  1T6B X;  2JZZ A;  4REZ A;  1Q5W B;  3A4R A;  5BMG A;  2EKI A;  3ONS A;  1I4R A;  4YSY B;  1I4X A;  4JQW C;  3HVZ A;  3AM9 A;  1YQ3 B;  3N1X C;  4W9I A;  1T5X D;  2KLC A;  4M02 A;  1QKZ A;  5CX3 A;  3WAO A;  1R8G A;  2B3A A;  1K51 A;  4OZA A;  3PGE A;  2IY1 B;  1JAL A;  2A5U A;  3AE1 B;  2M0A A;  4AM1 A;  4HCP B;  1WX8 A;  5HG2 A;  2L32 A;  3ZRF A;  2LZ6 A;  2KQS A;  1V6E A;  2PE9 A;  3MTN B;  3PLV A;  1FCL A;  2KJR A;  3ETR A;  5EE0 A;  2JQR B;  3PRE A;  4MDK E;  4TKN A;  1FMA D;  2KKC A;  3A1Q B;  3EFU A;  3DBL I;  1R7S A;  4C4V A;  1MI0 A;  3R3M A;  3TEW A;  4TQ1 A;  2LD9 A;  1R4M I;  1Y8R C;  5LLI A;  5IKC M;  3RNB C;  1YNT E;  1UGM A;  4MSM B;  3JU5 A;  3APC A;  3L08 A;  1GOZ A;  3Q3N C;  1TS5 A;  4MJS A;  4GVY A;  1RM6 C;  4RFB A;  1TBE A;  1M4V A;  4RMA A;  1AAR A;  3IG8 A;  4FAD A;  4MEL A;  2RPV A;  1H4R A;  2C7H A;  4PYU A;  4KIK B;  3AN1 A;  4LNI A;  1PDX A;  1GB1 A;  2Z0D B;  2QJL A;  5MPO A;  4DK5 A;  1XCQ L;  3ZYY X;  2KXJ A;  1SXT A;  2QSD A;  2R61 A;  2KD0 A;  3DVN U;  3FIL A;  2PE6 B;  2JT4 B;  1M15 A;  3H1U A;  1WGK A;  4ZRI A;  4KDL B;  3WIM A;  5C3J B;  2LVQ A;  2N4F A;  2JX5 A;  3EC8 A;  2K25 A;  3AE9 B;  2QMT A;  4I6L B;  3TBL D;  3DHH C;  2BS2 B;  3K9P B;  2AQ1 B;  3RNG C;  3R7R A;  2M8S A;  2PKO A;  2ACZ B;  4MM3 B;  4EZK A;  1V49 A;  5JXV A;  2J1Q A;  2RR9 A;  2H89 B;  3IT6 B;  4LDT D;  1HZ5 A;  4K3B A;  2AL6 A;  5GXG B;  4A55 A;  1H8C A;  1GG3 A;  3JW0 X;  3TIX A;  2PW9 A;  3BVM A;  4IM2 A;  2Z8L A;  4II2 B;  1WF9 A;  2WQY B;  5EDS A;  2WWZ A;  4KGT A;  4TMA B;  3DVG X;  2MBB B;  4ARI A;  1MPE A;  1WY8 A;  4G50 A;  1V1P A;  1P7E A;  3APD A;  2D5G A;  4FN2 A;  4N59 A;  3P63 A;  2FCS A;  1C4A A;  1BML C;  4RGT A;  2BW2 A;  2WXR A;  2V0G A;  1YN3 A;  1L0Y B;  1N62 A;  2NBV B;  2KTR B;  3ZJT A;  1V5O A;  3AEC B;  4BHL A;  2BKR B;  2MH7 A;  3IAS 1;  3NVY A;  3U8Z A;  3ZKJ C;  2LRW A;  5E6P A;  3N32 A;  2D3C A;  1RFK A;  4KZ0 A;  1RFA A;  3DBL B;  1IGD A;  3GE8 C;  4PS3 A;  3KYC D;  2GRI A;  4WAA A;  2L0T A;  4ZHP A;  4EZJ A;  1WMH A;  1KOT A;  3EFC A;  4ANV A;  1RAX A;  3JPZ A;  3A9J B;  2WXQ A;  1DYQ A;  5IAA C;  1EF5 A;  3PSE B;  3VHT C;  1T0S C;  3MC9 A;  3W5V B;  1STE A;  2D10 A;  3HM3 A;  3DHI C;  4JPS A;  2KNB A;  3AH7 A;  2DLB A;  1AN8 A;  2KAC A;  4NQL B;  3AV8 A;  2WX0 A;  2Y5B B;  5JHB A;  4K7W A;  2WU2 B;  1E7U A;  2KDI A;  2BB6 A;  3APF A;  4K3C A;  5DPR A;  1KFY B;  4B95 A;  3KLS X;  1VZ6 A;  5BYR A;  1XLP A;  4FBJ B;  4HJG E;  3A9K A;  3LDZ E;  2I38 A;  4W9G A;  1NI2 A;  4DHZ B;  3BII D;  3AI5 A;  2NTT A;  5AZG A;  1WSP A;  4RM8 A;  2QCZ A;  4RM9 A;  2ZVO A;  3L13 A;  2NPT B;  2IO3 B;  2K3U A;  2DAJ A;  1Z5S B;  4OVV A;  3ZDM C;  4A3P A;  5E6N A;  3K9O B;  2GBM A;  4A8X C;  2LGD A;  1OEY J;  2DZJ A;  1CRK A;  3ZRC A;  1WIA A;  4HRO A;  3JQ3 A;  3B0A A;  2ZPY A;  1EF1 A;  3RYT A;  4B6W A;  4J3O D;  1HZ6 A;  2JYT A;  2LHD A;  4HJK A;  1ZXH A;  3D32 A;  2JWZ A;  5J18 A;  5CTR C;  2V3S A;  1RRB A;  4Q2R A;  1T0Y A;  3EUB 2;  1T0Q C;  2YLM A;  1TT5 B;  4RF7 A;  3UIP B;  4C7Z A;  3CWI A;  3AE7 B;  1FNU A;  1S1Q B;  1ET9 A;  1WXQ A;  2JY6 A;  3CST A;  5D6J B;  2K8B A;  3CIR B;  2O2V A;  4JE3 B;  4FUL A;  2WXM A;  3H7S A;  3QIJ A;  4IWQ A;  5DPS A;  4AJY B;  4DDG D;  4KSK C;  5I4D A;  3DRE A;  2J0J A;  3TEX A;  1WFY A;  2QIL A;  3AED B;  1C79 A;  1MJD A;  2IGD A;  1JWS D;  1J8C A;  2ZEQ A;  2E6X A;  3E56 A;  1QK1 A;  4NAW B;  2KZR A;  2OHF A;  2LRU A;  2Y3A A;  3S2A A;  2OJW A;  5H8Y E;  1E8Y A;  1IPG A;  2K6D B;  2IO0 B;  4W9H A;  3Q6B A;  3LVV A;  3PS6 A;  3VH4 B;  3AB5 A;  4B0M A;  3NUH B;  2MHJ A;  4NJ7 A;  3QHT A;  4RF0 A;  4ZRQ A;  4M01 A;  2EMT A;  3TSS A;  3AEG B;  3HUI A;  3WCQ A;  4WJQ A;  2FCN A;  2BGF A;  3RCZ A;  3IHP C;  1NI3 A;  2WP9 B;  4WWM A;  3KWL A;  3ZTC A;  1XLO A;  1I4P A;  3AE3 B;  5TSS A;  2ZW1 A;  4N9F 4;  1JWA D;  2N9X A;  1TYG B;  1JWB D;  4HCN B;  1VCB A;  1VR9 A;  4C7Y A;  5J9A A;  2DYO A;  1P50 A;  4EOY A;  3ZJV A;  1TGZ B;  4HPL B;  4BVU C;  4HWI B;  3FKY A;  1J0G A;  2PVG C;  1QF6 A;  4N6E B;  3ALB A;  1ZOY B;  1FCC C;  1YJ1 A;  4WUR A;  2J52 A;  2KC2 A;  1F2R I;  4GDL A;  2A4Z A;  4LK0 M;  4S0R A;  4P16 A;  1WI0 A;  4WIP A;  2LJI A;  4P7I A;  1Y56 A;  3UF8 A;  4DHJ B;  1GB4 A;  4KZC A;  2DX5 B;  1U6R A;  2IJ0 A;  2BKF A;  4C4V B;  1YJJ A;  2W54 A;  2H88 B;  3SR6 A;  3MC8 A;  2YVC A;  4WWO A;  2LUM A;  5C23 A;  2WYQ A;  1SD0 A;  2XBB C;  2PTL A;  2KN4 A;  5AEK B;  2LVO A;  4YXD B;  5LXI B;  2LHE A;  2WNM A;  2RSU A;  4BFR A;  4TUU A;  2LXC A;  2DWQ A;  3ZXR A;  3TCA A;  2D3G A;  2N1V A;  5IOI A;  1WE7 A;  2YEP F;  3RUI B;  1E8X A;  4MAC A;  1FNV A;  4HEA 1;  1EUV B;  2XEW A;  1XO3 A;  1DOY A;  1D5X C;  1I4Q A;  2FCM A;  4A9A A;  2XNA C;  1WGD A;  1WZ0 A;  1VDV A;  2MP2 B;  4AS1 A;  4RGO S;  2IBI B;  1F9J A;  3AMZ A;  2D32 A;  4NQK E;  2FE8 A;  2K5P A;  3FIL B;  2W55 A;  1E90 A;  2HJ8 A;  1KH0 A;  3N9Y C;  4WJN A;  2KDF B;  4BG4 B;  2BQQ A;  1V80 A;  1ZUD 2;  2SEB D;  4XC2 A;  2LGI A;  2LMC A;  1K50 A;  1YIW A;  3GS2 A;  3SHQ A;  4I6N B;  2CRK A;  3FC4 A;  2EMS A;  1DOX A;  1E6E B;  2KFK A;  1SJH D;  2AL3 A;  1FXI A;  1XXG A;  1XLN A;  2Q5W D;  1WGR A;  2MW5 A;  2O6V D;  2QIE B;  3Q3O C;  1VLB A;  3QQ8 B;  2FBW B;  3I63 C;  3JVZ X;  2DBY A;  1I4G A;  4C00 A;  3R66 C;  1UWM A;  4WQM A;  4Z9M A;  2ON8 A;  2XK5 B;  3SEB A;  4XWT A;  2IZV B;  3QWZ B;  4CYE A;  2L0F A;  1N6Z A;  3AEF B;  2J0K A;  2KVR A;  3W1S A;  5T8I A;  1R4N B;  3ZNI D;  1MVK A;  4O1N A;  2AX5 A;  2BPS A;  4K7S A;  2BVC A;  2I2Y A;  3MJW A;  2PJH A;  3OWE B;  1UUP A;  1KF6 B;  1Q0W B;  4FJY A;  3UQB A;  1V81 A;  2KVZ A;  4P1B C;  1FFU A;  2MWS B;  4PYZ A;  2HTM E;  2REX A;  1YMH E;  4C56 C;  1WX9 A;  1V2Y A;  3IG5 A;  2PPH A;  3MJ5 A;  4DXF A;  4EUT A;  2IYD B;  4M0W B;  3RPF C;  1N60 A;  4PK1 A;  3AE4 B;  4IW0 A;  2BWE S;  1GJZ A;  2I1K A;  4G11 A;  3VXW A;  2QHO A;  4E74 A;  1WJ4 A;  4IM3 A;  3M10 A;  1FEH A;  3LYY A;  3VR8 B;  1I0E A;  2LUE A;  3QCA A;  3L2D A;  1MFW A;  4A6Q A;  3CF6 E;  3PT2 B;  1V86 A;  1OEY A;  3JSV B;  2ZCB A;  4ZYS A;  2JRH A;  1NVI D;  3DBS A;  1WZ3 A;  1LO5 D;  3VDZ A;  1EWY C;  5J2R A;  1P0R A;  2AWT A;  1FXA A;  5AUK A;  3V05 A;  3LN7 A;  5DPW A;  4HLE A;  3RUL A;  4W9J A;  3R2T A;  2HJ1 A;  1NEK B;  3RNA C;  3BIN A;  1WH3 A;  3H7P B;  3TL5 A;  2DZM A;  2X8X X;  4WJP A;  1SB3 C;  3M95 A;  3MP9 A;  4ARC A;  3BVG A;  1ESF A;  2J53 A;  3VFK A;  3T3N A;  1EM7 A;  2RDH A;  1JRO A;  4JGH B;  1ZE3 D;  4FJV B;  4AJW A;  1VRP A;  2FUG 1;  2RDB C;  4JWS C;  1J19 A;  3RFZ B;  4G3X B;  1YJI A;  1XF5 L;  4Q2J A;  1JCK B;  3CSF A;  4GLS C;  2L52 A;  5AUI A;  2NBU A;  4GXB A;  5G5G A;  3V60 A;  1TTN A;  1LGR A;  2BBC A;  5BYQ A;  1RL9 A;  1VD2 A;  2IDY A;  4F1S A;  5BYS A;  5CHW A;  1IUE A;  1WXA A;  2KN5 A;  3ZNH B;  4I6P A;  4DBG A;  1P1A A;  1MHH E;  2LJ5 A;  1DOI A;  2WDQ B;  2L05 A;  1FRR A;  4GDK A;  3RZW C;  2RPQ A;  3BZD B;  2UU7 A;  2KMA A;  3TEY A;  1VJK A;  2GBR A;  5G5H A;  4CHK A;  1TKG A;  2AYO B;  3IG3 A;  4TV3 A;  4NJ6 A;  3HHM A;  3QK0 A;  3WA0 A;  1ENF A;  2MBH A;  2L00 B;  1PGA A;  3CMM B;  2RMM A;  3NVW A;  3H6N A;  1MG8 A;  2B76 B;  2M56 B;  1WGH A;  2GB1 A;  1UWX A;  2IPK D;  4LTU A;  1XLQ A;  1C78 A;  3RNE C;  3V62 A;  5FR6 A;  1SE4 A;  1X1M A;  2K22 A;  3PV1 A;  3U4E G;  3VVW B;  2WXI A;  2MX2 A;  1AW7 A;  1L0V B;  3FAH A;  1IBX B;  1B1Z A;  1OQY A;  1BG0 A;  1OQR A;  1J7C A;  2NBW B;  1SF0 A;  4CQN A;  1WJU A;  2KC1 A;  2UYZ B;  3OJ3 A;  3PRP B;  1YX5 B;  4A90 A;  3EGR A;  3DOW A;  4NJC A;  1YX6 B;  3P42 A;  4WWP A;  3WAN A;  3NZU A;  2WXK A;  3SDL C;  1QZE A;  2GBJ A;  5BMH A;  2IGG A;  2C7N B;  2VZK B;  1WR6 E;  3P1M A;  4YSZ B;  4IWO A;  1P52 A;  2WXH A;  3NOB A;  3IXS A;  4XDD A;  4XYC A;  4KDI C;  3LB8 C;  1GC7 A;  2DYB A;  4S17 A;  1R4M B;  2KO3 A;  1K8R B;  2XN9 C;  3AXC A;  1UNS A;  4IKG A;  4KSL C;  2CU1 A;  4FXC A;  3Q3M C;  1EWC A;  1RYJ A;  2ASQ A;  4A20 A;  3GOE A;  4ZRK A;  2BS4 B;  2RDG A;  2KDB A;  3LJ3 A;  1C3T A;  4IG7 B;  5D3D A;  3KUD B;  4LNF A;  2G9H D;  2K6Q A;  4JL9 A;  1FM0 D;  5FK9 C;  3MHZ A;  3QC8 B;  4K81 A;  4W9L A;  1FFV A;  1PQS A;  2MRP A;  4XWW A;  4RCO A;  2LGX A;  3AE5 B;  1HA5 A;  1WM2 A;  1UBI A;  3QAQ A;  3URY A;  2K0P A;  3NRZ A;  3C0R B;  4G0N B;  3VUW A;  5JHA A;  3AE6 B;  3VTW A;  4QAY A;  5HHD G;  3GZN I;  1ZDV A;  2FUH B;  2DHZ A;  3L17 A;  3W1S C;  3KH0 A;  2N9P C;  4LJP B;  2YEP B;  1WM3 A;  2CR5 A;  1FIQ A;  3R7Q A;  3I3T B;  4OVU A;  2JZ3 B;  3VH3 B;  1V1O A;  3A1Q A;  1QOF A;  1QIL A;  3E9S A;  3I5J C;  1ACC A;  4PS7 A;  2V1Y A;  2JWU A;  2GBN A;  2KFK B;  3DVN V;  3ZTD A;  1BXT A;  3N1Z C;  3KUC B;  3M62 B;  5C2T B;  5L95 C;  1C77 A;  2W82 A;  4MGK E;  4BKT A;  1G6J A;  1CJE A;  3A33 B;  3DBR I;  4FHK A;  3SD5 A;  3SU8 X;  3BWU D;  3GE3 C;  3PZD A;  1FXT B;  2JF5 A;  1E10 A;  5FR3 A;  3OJ4 B;  4KVG B;  4BZA A;  2EEL A;  1NDD A;  3Q8A A;  4KIK A;  1JWU D;  4AQ7 A;  2DNF A;  4GVZ A;  4GU2 A;  2K8H A;  3ZXV A;  1XT9 B;  2J0M A;  3SFE B;  2KTF A;  2IGH A;  1E9M A;  2C9W B;  2NCN A;  3U7D A;  5HFY A;  5GMV A;  2ZNV C;  4DHZ E;  3AE2 B;  5JH5 C;  1OFF A;  2PLP A;  2E3T A;  4DDI D;  2MA9 B;  3WAL A;  4AP4 C;  1FO4 A;  1XCT L;  4MM3 A;  4AUQ C;  2V3P A;  3VRB B;  4C80 A;  1XQQ A; 
#chains in the Genus database with same CATH homology
 4LNN A;  1HTQ A;  5J9A A;  4GW0 A;  1F52 A;  4S17 A;  2BVC A;  1U6R A;  3JU6 A;  1P50 A;  5J99 A;  3ZXR A;  1F1H A;  4LNI A;  1QK1 A;  1FPY A;  3B6R A;  1QH4 A;  3L2E A;  4RF9 A;  3JU5 A;  3FKY A;  4LNO A;  4BG4 B;  2OJW A;  1BG0 A;  3JPZ A;  1HTO A;  2J1Q A;  2WGS A;  4LNK A;  4Q2R A;  3DRB A;  4BHL A;  2LGS A;  3L2E B;  3M10 A;  4GVY A;  4BAX A;  1LGR A;  4GW2 A;  1I0E A;  2D3C A;  3L2D A;  4Z9M A;  1RL9 A;  1P52 A;  1VRP A;  3DRE A;  1SD0 A;  4GVZ A;  1CRK A;  4S0R A;  2CRK A;  4ACF A;  4RF6 A;  4BG4 A;  1M15 A;  4RF8 A;  2D3B A;  2QC8 A;  3ZXV A;  2D3A A;  4HPP A;  4XYC A;  2UU7 A;  4LNF A;  1G0W A;  4RF7 A;  4AM1 A;  3JQ3 A;  2WHI A;  2GLS A;  3NG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...