1HTQA

Multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
477
structure length
477
Chain Sequence
b'TEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutamine synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
pubmed doi rcsb
total genus 140
structure length 477
sequence length 477
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 1htqA02
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 1htqA01
2D3AA 2OJWA 1HTOA 1CRKA 1P50A 4RF7A 2GLSA 3NG0A 3ZXRA 2D3BA 2LGSA 4LNIA 1LGRA 3ZXVA 2QC8A 2WHIA 3JU5A 2J1QA 4XYCA 1QK1A 4S17A 1P52A 4LNFA 1M15A 3DRBA 3JPZA 3M10A 4LNKA 4S0RA 1FPYA 1BG0A 4Z9MA 4GVYA 4GW0A 4BHLA 4BAXA 1HTQA 1F52A 5J99A 3L2EA 1G0WA 3L2EB 1QH4A 3FKYA 4LNNA 4AM1A 2CRKA 5J9AA 1F1HA 2D3CA 1U6RA 1SD0A 1VRPA 3JU6A 4GW2A 4RF6A 1RL9A 4HPPA 3DREA 4BG4B 4RF9A 2UU7A 4BG4A 4LNOA 2BVCA 4Q2RA 1I0EA 3JQ3A 4RF8A 4ACFA 3L2DA 4GVZA 3B6RA 2WGSA
chains in the Genus database with same CATH superfamily
3VHTC 1WJ4A 4WWPA 3HM3A 4K81A 1XLNA 4F7ZA 2ZEQA 3ZIMA 1C4PA 1LGRA 1XCQL 2M4NA 3GP7A 2NCNA 2RD0A 2SAKA 1UZXB 4GDLA 5FR6A 2IGDA 2K3UA 2K8BA 4X57B 3FC4A 3NRZA 3ABVB 2J0JA 3VXWA 2WNMA 5CHFA 4BKGA 4W9EA 3AE6B 2INDC 1WYWB 2KLCA 4ZHPA 1BT0A 2CHWA 1E6EB 1RLFA 3L54A 3L4PA 1E7UA 4JPSA 4LNIA 3I5JC 1PUTA 3MHZA 3O65B 3NOBA 4OZCA 4GW0A 5C1ZA 3L2EB 4MM3B 2CHZA 2KHWB 4FHKA 3OAWA 3V60A 2NTTA 3PZ8A 4US8A 2J52A 4K3CA 3RULA 2WXJA 1GB1A 1FFUA 2G4DB 3CWIA 2K9XA 2PE6B 2KDBA 3BYYB 1HE8A 3X0WA 1PGXA 3VRAB 2I1JA 4A9AA 2M56B 1VZ8A 1ZDXA 1R8GA 4IWPA 4P6VF 4WH4A 4WIPA 4Q2RA 4CHKA 1EWCA 1L4DB 2WDVB 3TEYA 2OHFA 2N1WA 3MC0B 1I4QA 1IGDA 1LQBA 2GBJA 1E7VA 4OZBA 4E74A 4DQOC 2AL3A 2Y3AA 2QJLA 2BWES 3DBLB 3RNGC 5I4DA 1G6JA 5H92C 2X38A 5KHQA 2O2VA 1E8WA 3RT3B 2D3BA 1C78A 1B1ZA 1ET9A 4HCNB 3AE4B 3WIMA 1QK1A 4PS7A 4HKQA 2KN4A 2JRIB 1JQ4A 2MJEA 3Q8CA 4MEMA 5AZFA 4LLGM 3IG5A 2MBEA 2KN5A 3Q69A 4WAFA 4HPPA 4GXBA 1NEKB 4AP4C 5JHBA 3A4SC 2HJ8A 3W1YA 4CQNA 3PRZA 4JWUC 1MFWA 2QC8A 4K7WA 3MC8A 4ZDVA 2WQYB 4LNKA 4EE2A 4IC7B 2IZVB 4BFRA 4ZRIA 4ZYNA 3V6EB 1U4AA 1VD2A 4O1NA 2WDTB 2HDEA 1ENFA 1ET6A 3VDZA 3N1XC 3H8HA 3LJ3A 4AQ7A 3QAQA 2WXPA 2PPHA 4GGQA 4P7IA 2IO0B 4FXCA 2L76A 1GPXA 3AEEB 1OTRB 2G4SA 4FJZA 4ANXA 3QX1A 1ZP0B 2G9HD 4WJQA 4AM1A 1U6RA 3AU5A 3MJ5A 5LNK1 3WALA 1D4BA 2W55A 2D2QA 3FILB 4RM8A 1EM7A 2V4IB 1JROA 4RGTA 4Q2JA 4HJGE 4PS8A 1P3QU 2CU1A 1R7SA 4NQLB 4GW2A 3T9LA 1WZ3A 3MFGA 3LB8C 1I42A 2V1YA 4M01A 2JYTA 1K8RB 2MLBA 3GOEA 5JH5C 1IGCA 2NBVB 1ZW7A 2KFKA 2CHXA 4AWJA 1E5WA 3FAHA 2M17A 4LNNA 1A5RA 2XBBC 2MWSB 3W5UB 1PGAA 1FXAA 1I0EA 2L0TA 2N9PC 1I35A 4XGAB 4IWQA 4XE0A 3U7ZA 3EHVA 3OJ3A 3UIPB 4IW0A 3VTUA 4XX5A 2NTSA 4RMAA 3AV8A 1F0ZA 4EZLA 2G1EA 5IKCM 2MP2A 2EMSA 4NPNA 5E6PA 2ZPNA 1SGHA 1NENB 2IO1B 4MGKE 3J9CA 2IY0B 4C7YA 3JU6A 2AQ2B 1ZKHA 1I4RA 3L2DA 2M0XA 3B6RA 2IBIB 2C9WB 3EECA 2L7RA 3RN9C 2MEKA 4XWTA 3PVLA 2GBRA 3PV1A 1TS5A 3NVYA 2EMTA 2M1MA 2WXHA 3HVZA 4AS1A 2PVGC 4KV2A 3GE3C 2GBMA 3H6NA 1QF6A 3R3MA 1UWXA 4RH6A 1WJ6A 3LVWA 3ZNZB 5HHDG 2V9HA 1YJ1A 1H8CA 2GOWA 1TT4A 1I4PA 3SR6A 4RM9A 5C23A 1L0YB 4HEA1 2N7EA 1WGGA 3R7RA 3RFZB 1JMLA 3I63C 4KZ0A 4I6NB 3VVWB 3MJWA 3IHPC 2QEJC 3NJTA 1GAQB 3ZNGC 5EDSA 4EOYA 1VRAB 1CK1A 1YD8U 2ONQA 3AE7B 4GIVA 2WU5B 4RF8A 4M02A 4RF0A 4Z9MA 1OQQA 2R61A 2VRRB 3NZUA 5BYQA 2JT4B 4XZ4A 3TL5A 3Q8AA 3SU8X 2LJIA 3AE9B 1TKYA 1L6UA 1OEYA 2RMMA 3UQAA 4MGZE 2J0MA 3JSVB 4C4VB 1MJDA 3ECIA 3R2IA 1S3SG 3AMZA 4GB9A 4GVZA 5AZGA 3AECB 2LGIA 4IM3A 5E6OA 1JW9D 3NZSA 4WQMA 4A3OA 3Q8FA 3O13A 4RF1A 4YT0B 4J6IA 1WGYA 2M8SA 4LNOA 4DHZB 3TIXA 4KKJA 1XLPA 1OQYA 3A9KA 3ZDTA 1FM0D 1E10A 4LK0M 3ZTCA 4YSYB 4JGHB 2IO3B 1V2YA 5BYSA 3WANA 4MGIE 3AB5A 5HG2A 1QOGA 1YN4A 1XT9B 2C60A 3Q3OC 4NJ6A 2N7JA 2LJ5A 4JE3B 2KJRA 1ZXIA 1P50A 1IP9A 3QARA 1HQRD 3DVGX 1L0XB 4DHZE 2AL6A 2QHOA 1IBXA 2KDFB 1WGRA 4A55A 4M0WA 3FKYA 4RFBA 2WDRB 5J18A 2RDBC 1K51A 2KD0A 2AYOB 4WURA 3VTVA 2JU6X 4DHJB 1ZGUB 4OVUA 3K9OB 3QJZA 4RGOS 4KDIC 3M63B 3AEFB 2LI5A 2MRPA 2GI9A 2BPSA 3DPDA 2NVUI 1SF0A 1YOVB 3PRPB 3DBHB 2ACZB 1TT5B 3NZ3A 1VR9A 2GWDA 3VH4B 1R4MB 4URKA 2OJWA 3MTNB 3JYUA 3ZNID 1P7FA 2GWCA 4LTUA 3ENEA 4K7SA 1WSPA 2BKRB 3Q8EA 1YNTE 4ZOHC 1MHHE 3BINA 2I38A 1QQRA 3U2SC 1SE2A 3SFDB 3LYYA 1AYFA 1ESFA 3ML8A 5IO9A 1VZ7A 1HTOA 1E9MA 2LGXA 1SBBB 4OVZA 4BKTA 2LASA 2WHIA 3HVDA 2L83A 2DAFA 3BYTB 2IO2B 4MSQB 1JCKB 2D32A 4ARCA 2W3RA 3W2DA 4IUMB 3P4PB 1QOAA 5EE9A 1TYGB 4ITKA 2BW2A 3B2GA 1E0ZA 2K6QA 1RAXA 5MPOA 1NI2A 4ANUA 2KMCA 1GUAB 4L2YA 1TGZB 4WWMA 3VRBB 3VFKA 1J0GA 1J19A 3HK0A 5JZEB 3RNCC 2WU2B 2ON8A 3SEBA 3ONSA 2HTHA 1PDXA 4M8NA 1RM6C 2KWUB 1WMHB 2FIDA 2XNAC 4EUTA 1C3TA 2MW5A 3H9DA 3BY4B 3ZJUA 1YN3A 3N1ZC 2BGFA 3UQBA 2JQRB 1WR6E 3AU4A 3ZDMC 3GB1A 1D6EC 1V5OA 3OJ4B 3BVGA 1WM2A 1E8YA 5D94A 2DYBA 3Q3JA 1IYFA 3DHGC 4LJOB 4BG4A 1V1PB 4BKSD 4PYUA 3VR9B 2AX5A 2KLGA 1V1OA 1KH0A 1WXSA 4LCDE 1T0QC 4HLEA 4DWFA 1UUPA 2C7HA 1WGDA 3EFUA 3V61A 1TS2A 2KVRA 3E56A 2MHJA 1NYRA 4BHLA 2K25A 2H88B 3W9CB 2BYTA 5H8YE 3UF8A 4ZYSA 5CHVC 3L0WB 3NVZA 1SJED 1L2NA 5G55A 4B0EA 2VH1A 4GU2A 1WXVA 2QSDA 3ZNHB 4GDKB 3N20C 3RMKC 4S0RA 1FPYA 2EKIA 3NS8A 1BMLC 5LXIB 3CIRB 1WRIA 2KZRA 3PS6A 1UF0A 1WYGA 2PKOA 1DOXA 1T0RC 1MHXA 1VCBA 1F2RI 4BOZB 1RWSA 2CU3A 3A1QB 2KWCA 4W9FA 2YLMA 1QOBA 2JZZA 1VZ6A 1XO3A 4YL8A 2ZNVB 1XF5L 2BWFA 2LUMA 4D2KA 2DX5B 3RCZA 3P42A 3IBEA 1EF1A 4G3XB 2JVCA 3RZFA 2WXIA 1F2RC 3R8BA 3W1SA 2ASQA 3KW5B 1WWTA 4HCPB 4IDIA 1VLBA 3ETRA 4XDDA 1LM8B 2INCC 1EU3A 4WJNA 3RPFC 3VQIA 3ZVVA 4GN1A 1FFVA 1TY0A 2FCQA 4NZLB 4PK1A 1C77A 2MP2B 5E6JA 2LHEA 4N6EB 2D3CA 1TIFA 4XWWA 1C1YB 3ZRFA 1I4XA 2OEDA 2MCNB 1ZDVA 1UWMA 2PEAA 1QOFA 1Q5WB 1KFYB 2BS2B 3BK1A 1GOZA 2KMMA 4CO7A 3BIID 2KFKB 4MSMB 2DYOA 5D3DA 3DHIC 3NZTA 1L5PA 3P4RB 4LJPB 2KJ6A 2JY6A 3KVFB 5DCNA 1JRPA 1Y8RC 1SIFA 1V9JA 1P0RA 2RSUA 1Q0WB 3DQVA 1VDVA 3IT6B 2DZIA 1V8CA 2W9NA 4YXDB 1E8XA 3A9JB 3Q2AC 2FBWB 2CRKA 3AM9A 2N9LA 3JVZX 4WAAA 2DZKA 4JQWC 3VUXA 2CR5A 1VA6A 1WE6A 3ZRCA 2L1AA 2KYWA 1C4CA 4HPLB 4NAMA 5G5HA 4EKUA 1FEHA 2V3PA 2KC2A 3U7DA 2KKCA 1YQ4B 4NJ7A 3OLMD 3A4RA 3DREA 1C76A 3GS2A 1C9FA 3DBHI 3FILA 3L10B 2LHDA 2K6DB 4L23A 1I4HA 2LVQA 3RI7C 1QZEA 2MJ3A 4LNFA 1N63A 2DYMA 2DLBA 1FIQA 2K8HA 2L00B 1V80A 2JWUA 4RF6A 1V1PA 2XK5B 3VTWA 2ZCBA 4MH0E 2J0KA 3VAWA 1I7HA 2VZKB 1KLVA 1ACCA 2WWZA 5KHOA 5JHAA 4YTNB 3N3KB 4EZJA 4ICUA 4KX6B 3JU5A 1ZE3D 2QIEB 1V6EA 4KIKA 4RGMA 2W82A 4KVGB 3DVGY 1F9JA 5D3IB 3U30A 4BKSA 1KLUD 2Z8LA 3NS1A 4GOCA 4II2B 1PGBA 3IFWB 2C7NB 1DOYA 2X8XX 4ZRKA 5L83A 4FJVB 5AEKB 3QHTA 2KT7A 4RNAA 1BG0A 1V5TA 1WY8A 4C7ZA 3H7PA 2OOBB 1QILA 3SD5A 3DOWA 2JPHA 4C00A 1GG3A 2G45B 3RUIB 4XYCA 1I4GA 1UBQA 2KNBA 2KWVB 5BMGA 3AULA 4P1CC 4W9JA 5CHWA 2VH2A 4FN2A 3PREA 4OVVA 3RZWC 2NMQA 2NPTA 4W9HA 1H4RA 4W9IA 1TS4A 4BVUC 2DBYA 2WXQA 2XN9C 1SJHD 5J9AA 2WXFA 1TTNA 4L1BA 3BVZA 3AE2B 1CRKA 5DPWA 1E90A 3B1LX 5G5GA 2QMTA 2Z0DB 2WXLA 2ZW0A 1C4AA 4OW0A 1LFDA 3GZNB 3QCAA 2N1VA 3QA8A 1WXMA 5DPRA 2XEWA 3WAPA 3AEGB 2ZCCA 2JXTA 2JSVX 1WXAA 2MBBB 2KX0A 2KAJA 3PZ7A 1WRDB 2WP9B 2L3ZA 2ICIA 5AZHA 3E9SA 2WYQA 2I1KA 3W5VB 2WDQB 2JZPA 4FADA 4W9GA 4HROA 3TEZA 1XLQA 1QH4A 3NVWA 1T6BX 1WZ0A 2EKEC 1TS3A 2WXOA 4GDLB 1JWSD 4KGTA 4J3OD 4B0MA 2LVPA 2Z59B 2LVOA 2N9XA 3ZJTA 2LXCA 4WJPA 2O2VB 1T5XD 4EZKA 3ZUNA 3ZQ4A 4W9LA 2LGSA 4ZRPA 2JXXA 2FCSA 3R7QA 3JSVA 4C4VA 2GMIC 1R4NI 3PHXB 3AE5B 2O6VD 2BYVE 5AUKA 3IG8A 3TCAA 1OFFA 3HHMA 2UWQA 2C7MB 1P98A 1SIJA 2M19A 4QAYA 3V62A 1SE9A 3EGRA 1YJJA 2BKFA 3C19A 2L52A 1V97A 2R2OA 1FD6A 1HXYD 1J7BA 3CF6E 2KTRB 3Q14C 2KJHB 2KFJA 1TJEA 4K3BA 1QKZA 3VH3B 3GE8C 1LXDA 4HPMB 2YEPF 2DZJA 3R2TA 3DHHC 5DPSA 2PE9A 3LDZE 3OG5A 1CMXB 1N6ZA 1Z5SB 1WE7A 4AOFA 3DRBA 1P1AA 4DDID 3PSEB 1MVKA 2MBHA 3PHWB 4MM3A 2BB5A 3A9JA 1YJIA 3PTFC 2CJOA 1TBEA 1ZPSA 5IN7A 3Q3NC 2CKHB 1M4VA 4WQOB 2IGGA 1WF9A 1NYQA 4AUQC 2MBQA 2DZMA 1IBXB 4DHJD 2BTEA 2LEKA 2GRIA 2RR9A 3M95A 2WLBA 3NHEB 3DBRI 1E8ZA 4NAWB 5GXGB 1RL9A 2BYEA 3HM6X 4ZRQA 4ANWA 4DXAB 4M00A 1V81A 3ZTDA 1EWYC 2FE8A 4REZA 4TQ1A 2K0PA 1P7EA 4US9A 2KOXA 3EC8A 5BYRA 5D6JB 1FMAD 3UGBB 2RDHA 3CSFA 1GJZA 1FNVA 4ICVA 5IP4D 2BYFA 2K22A 1C79A 1YQBA 1AW7A 3X23A 1JWBD 1WGHA 3QC8B 2KVZA 3IXSA 3AI5A 4MELA 3QIJA 4PS3A 5GMVA 2V3SA 2Y5BB 3TBLD 2AQ1B 1D5ZC 2RPVA 1RRBA 1KF6B 2YVCA 3APCA 1ZXHA 3I3TB 1WGKA 2QILA 1J7CA 1OQRA 2MQJA 3S2AA 2C5LC 1EO6A 1HZ6A 1WXQA 3WCQA 2A4ZA 4TSSA 4P1BC 3EUB2 2ZPYA 3DWMA 3APFA 2G3QB 3TMPB 4ZRJA 4DXFA 1WH3A 2V3NA 1KM7A 1KLGD 1K53A 2BS4B 4YWGG 4TQ0A 1NVID 2DNFA 4JL9A 4WWNA 1KRHA 1F77A 1MG8A 3U8ZA 3MP9A 4HWIB 4IOIE 3VUYA 1WJUA 1OEYJ 3EFCA 3IAS1 3B9JA 2BF8B 2N9KA 2M0AA 2JRHA 1KJTA 3IAM1 2KX3A 1YN5A 2NBUA 3LXFA 2KXJA 1MG4A 5BMHA 1CQVA 1V4GA 2BS3B 2DENB 3L17A 2HD5B 2DHZA 1IPGA 2L05A 2E3TA 1IUEA 5EE1A 1G0WA 1ROEA 2JUOA 5EE0A 2LFIA 5HI1A 4M8MA 2FNJB 1R4MI 1BXTA 2W3SA 2V0GA 3C0RB 1STEA 2GLSA 3ZXRA 3N32A 4DK5A 1NBFC 3V3XA 3P4QB 3M10A 3IG3A 1AARA 2RDGA 2B3AA 4YSXB 3PO0A 2NR2A 2JZ3B 1XEEA 3KYCD 2KTFA 1X1MA 1FXTB 5IA7A 3ZO5B 4N59A 1N5WA 2Q5WD 1JWMD 2HE7A 2BT6A 2CS4A 1FRRA 1TZOA 1L0VB 2V4LA 1MI0A 3DDCB 4N9F4 1S1QB 2KDMA 1M15A 1AN8A 2I2YA 2IYDB 4G11A 2GBKA 2PLPA 3QK0A 2J42A 3Q8BA 5J17A 4B9KA 2R2QA 4GSWA 4W9CA 1V49A 2INPE 4HXDA 3PT2B 2REXA 1N5XA 2K5PA 4RF7A 2NPTB 1YQ3B 5C2TB 4A6QA 5J2RA 3ZLZA 2J4XA 1DOIA 4H2AA 1F52A 4TMAB 3ZW3A 2FAZA 3A33B 1SE4A 4ZHOA 4R3DA 4JIOU 1Z2MA 4P16A 3DVNU 4HJKA 3U52E 2H89B 3L08A 3KLSX 1SE3A 2KTRA 3GZNI 4FBJB 2D07B 4IWOA 1FCCC 1GC6A 2PJHA 1RYJA 1P9DU 2L8JA 4F1SA 1Y56A 2E6XA 1QLBB 4KDLB 1F1HA 2WXRA 3TSSA 2L32A 3H7PB 4K1RB 4KSKC 4G50A 2IDYA 3N9YC 3P2BA 4OHJA 3LVVA 5HKHA 1WX9A 3NG0A 3LN7A 2PVOD 1JWAD 5CTRC 4A8XC 4M0WB 2LWPA 2FUG1 3U4EG 4JX1C 4YTPB 3A9KB 3UIOB 2BQQA 3HUIA 1L4ZB 3RNFC 3I57A 4TV3A 3PRMB 3PLUA 3N1YC 4UDUC 5AUIA 3R66C 4FLHA 3K9PB 3V6CB 4EFOA 3AXCA 4FHJA 3OWEB 2BBCA 4KSLC 4FULA 2MSED 1ZUD2 2DWQA 2WXNA 3I9V1 3RNBC 2XK5A 2AEHA 2WX1A 2JYEA 4NQKE 3DBSA 1CJEA 1CZPA 4NNJB 5FK9C 1WX7A 1YX6B 1XLOA 2WS3B 2Y5PA 5TR5A 3VR8B 2W54A 1HEZE 3JPZA 4S17A 1HA5A 2N9EB 1FNUA 2AQ3B 5LXHA 2ZVNA 5J99A 2MX2A 4K7UA 1V86A 2WX0A 1DGJA 1BUIC 3DWGC 2KDEB 3IT4B 5CX3A 2BVCA 2LRWA 4KKIA 5L95C 2FUHB 1FXIA 3RD2A 3RNEC 3ZYYX 2LMCA 3P1MA 4C56C 2A5UA 4DBGA 1M94A 4HRSA 3BK2A 5HFYA 4BAXA 1GB4A 1Q10A 2KC1A 3CSTA 4BBNC 3APDA 1N61A 2KO3A 3Q3MC 4I6PA 2CJNA 3JQ3A 1UBIA 1AWDA 2D3AA 3ALBA 3NVVA 2D3GA 4ARIA 2DAJA 4A20A 3ZGZA 2KACA 3URYA 1HZ5A 1PYWD 2D11A 1K52A 3N30A 3B0AA 1J8CA 1RFKA 3PPAA 1DYQA 1KTKA 2RGFA 1ZOYB 1WX8A 5E6NA 1K50A 3M62B 1TY2A 3T8MA 2KDIA 1SB3C 4PYZA 4KIKB 1JRUA 2O6VB 4NY0A 4TKNA 2KK8A 3H1UA 4FJYA 2KANA 1EUVB 2K1FA 3SFEB 3KYDD 3WAMA 2GB1A 1TKGA 1VRPA 1TZ1A 3M3JA 2WXKA 1T0SC 1D3ZA 2JF5A 2ZJDA 3EA6A 3ML9A 5D2MB 1N60A 1WR1A 4HKZE 1PFDA 3T3OA 3HIZA 4XDCA 2N4FA 1NDDA 2FCMA 3AH7A 3AE3B 2K39A 4USAA 3MC9A 2LGYA 4HVBA 2LRUA 3BZDB 3Q6BA 3B2FA 1QT9A 3TUOA 1UELA 3HRDD 5G2NA 2LXAA 4WWOA 3PZDA 2PTLA 3BVMA 4KGSA 3BWUD 3KWVA 4MT5A 2KMAA 3D32A 4PT5A 2MJDA 4BBNF 1GC7A 3AEBB 4OZAA 1L6VA 3P63A 4ANVA 3AE8B 3UI3A 2LD9A 1EF5A 4MJSA 3LN6A 2IJ0A 4MDKE 4ASWC 2RPQA 5DPTA 1KOTA 4RGNA 1R4NB 4LDTB 1YMHE 1GNUA 3KQ4A 4YTMB 1TKEA 1XQQA 1LO5D 2FIFA 3PLVA 1T3QA 3PGEA 3Q3FA 3AE1B 2EELA 1UNSA 3V05A 3AN1A 1XD3B 5D7GA 3WAOA 3IVFA 4II3B 2GBNA 2WXGA 3QWZB 2N0SB 1JWUD 2J1QA 3CMMB 1B9RA 4WJOA 4GVYA 1E7PB 1HTQA 5LLIA 1SXTA 2L0FA 1A70A 2N7DA 2NBWB 3RYTA 4IG7B 3KUZA 1OGWA 4RF9A 4MACA 2PIAA 3MHSD 4IKGA 2ZZPB 2WGSA 1T0YA 2MA9B 2WXMA 1XXGA 2J53A 2O6VA 2TSSA 2LGDA 3DBRB 3ZXVA 5C3JB 2ZNVC 2QCZA 5T8IA 3NY5A 4RCOA 2UYZB 1ISNA 4NAWA 5IOIA 4FA6A 1FNWA 2MBOA 3L16A 2PW9A 5TSSA 3NUHB 1SD0A 2VZKD 2KQSA 5FR3A 1SSNA 4AJWA 4A90A 3DVNV 2PMVA 2IY1B 2B76B 5EE3A 2IGHA 1YIWA 1P52A 4DXGA 2KQ4X 1L7YA 3SHQA 3QQ8B 1WIAA 3AEAB 2QDFA 1RFAA 1XCTL 3T3NA 2NS5A 4I6LB 4DDGD 4C80A 4E3CA 2INNE 2HTME 1WJNA 3RNAC 3KUCB 3WA0A 2HJ1A 4JWSC 1EU4A 4A3PA 3TEXA 2IPKD 1UH6A 2JWZA 3ZJVA 3JW0X 1YX5B 1PQSA 3A1QA 3KWLA 2FCNA 4W9KA 1Q1OA 4IM2A 4F8CB 3DCGA 4HK2A 4BZAA 1UGJA 3C8YA 4B95A 1VJKA 1N62A 4MJSB 3UINB 1UD7A 4IM0A 1SEBD 2LZ6A 2Z0EB 4XC2A 2YEPB 2Y5CA 2OJRA 5IAAC 4KZCA 2KWDA 3W1SC 1FCLA 1FO4A 4G0NB 1WFYA 3SDLC 3TJPA 4MGYE 5FKAC 3AEDB 3KUDB 2KQ7A 1D5MC 4N58A 5BMIA 2AWTA 4TUUA 2D5GA 4NJCA 2D10A 3B08A 1UGMA 4BG4B 3H7SA 2UU7A 3DBLI 2K8CA 4HDQA 4KGRA 5JXVA 3KH0A 5BO4B 1D5XC 2SEBD 4GLSC 4W9DA 4LDTD 1WI0A 2JX5A 1NI3A 1FRDA 1MPEA 1WM3A 2BB6A 4EEWA 1JALA 2ZVOA 4GMVA 3ZKJC 4GDKA 2ZW1A 4BOSC 3TEWA 3L2EA 4YSZB 4MH8A 2LUEA 3VUWA 3L13A 2MH7A 3P4SB 1WMHA 4B6WA 4AJYB 4JLCA 2D33A 1J7AA 4ACFA 4E71A 4CYEA 2J7QB 4HDOA
chains in the Genus database with same CATH topology
2D3AA 2OJWA 1HTOA 1CRKA 1P50A 4RF7A 2GLSA 3NG0A 3ZXRA 2D3BA 2LGSA 4LNIA 1LGRA 3ZXVA 2QC8A 2WHIA 3JU5A 2J1QA 4XYCA 1QK1A 4S17A 1P52A 4LNFA 1M15A 3DRBA 3JPZA 3M10A 4LNKA 4S0RA 1FPYA 1BG0A 4Z9MA 4GVYA 4GW0A 4BHLA 4BAXA 1HTQA 1F52A 5J99A 3L2EA 1G0WA 3L2EB 1QH4A 3FKYA 4LNNA 4AM1A 2CRKA 5J9AA 1F1HA 2D3CA 1U6RA 1SD0A 1VRPA 3JU6A 4GW2A 4RF6A 1RL9A 4HPPA 3DREA 4BG4B 4RF9A 2UU7A 4BG4A 4LNOA 2BVCA 4Q2RA 1I0EA 3JQ3A 4RF8A 4ACFA 3L2DA 4GVZA 3B6RA 2WGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3A A;  2OJW A;  1HTO A;  1CRK A;  1P50 A;  4RF7 A;  2GLS A;  3NG0 A;  3ZXR A;  2D3B A;  2LGS A;  4LNI A;  1LGR A;  3ZXV A;  2QC8 A;  2WHI A;  3JU5 A;  2J1Q A;  4XYC A;  1QK1 A;  4S17 A;  1P52 A;  4LNF A;  1M15 A;  3DRB A;  3JPZ A;  3M10 A;  4LNK A;  4S0R A;  1FPY A;  1BG0 A;  4Z9M A;  4GVY A;  4GW0 A;  4BHL A;  4BAX A;  1HTQ A;  1F52 A;  5J99 A;  3L2E A;  1G0W A;  3L2E B;  1QH4 A;  3FKY A;  4LNN A;  4AM1 A;  2CRK A;  5J9A A;  1F1H A;  2D3C A;  1U6R A;  1SD0 A;  1VRP A;  3JU6 A;  4GW2 A;  4RF6 A;  1RL9 A;  4HPP A;  3DRE A;  4BG4 B;  4RF9 A;  2UU7 A;  4BG4 A;  4LNO A;  2BVC A;  4Q2R A;  1I0E A;  3JQ3 A;  4RF8 A;  4ACF A;  3L2D A;  4GVZ A;  3B6R A;  2WGS A; 
#chains in the Genus database with same CATH topology
 3VHT C;  1WJ4 A;  4WWP A;  3HM3 A;  4K81 A;  1XLN A;  4F7Z A;  2ZEQ A;  3ZIM A;  1C4P A;  1LGR A;  1XCQ L;  2M4N A;  3GP7 A;  2NCN A;  2RD0 A;  2SAK A;  1UZX B;  4GDL A;  5FR6 A;  2IGD A;  2K3U A;  2K8B A;  4X57 B;  3FC4 A;  3NRZ A;  3ABV B;  2J0J A;  3VXW A;  2WNM A;  5CHF A;  4BKG A;  4W9E A;  3AE6 B;  2IND C;  1WYW B;  2KLC A;  4ZHP A;  1BT0 A;  2CHW A;  1E6E B;  1RLF A;  3L54 A;  3L4P A;  1E7U A;  4JPS A;  4LNI A;  3I5J C;  1PUT A;  3MHZ A;  3O65 B;  3NOB A;  4OZC A;  4GW0 A;  5C1Z A;  3L2E B;  4MM3 B;  2CHZ A;  2KHW B;  4FHK A;  3OAW A;  3V60 A;  2NTT A;  3PZ8 A;  4US8 A;  2J52 A;  4K3C A;  3RUL A;  2WXJ A;  1GB1 A;  1FFU A;  2G4D B;  3CWI A;  2K9X A;  2PE6 B;  2KDB A;  3BYY B;  1HE8 A;  3X0W A;  1PGX A;  3VRA B;  2I1J A;  4A9A A;  2M56 B;  1VZ8 A;  1ZDX A;  1R8G A;  4IWP A;  4P6V F;  4WH4 A;  4WIP A;  4Q2R A;  4CHK A;  1EWC A;  1L4D B;  2WDV B;  3TEY A;  2OHF A;  2N1W A;  3MC0 B;  1I4Q A;  1IGD A;  1LQB A;  2GBJ A;  1E7V A;  4OZB A;  4E74 A;  4DQO C;  2AL3 A;  2Y3A A;  2QJL A;  2BWE S;  3DBL B;  3RNG C;  5I4D A;  1G6J A;  5H92 C;  2X38 A;  5KHQ A;  2O2V A;  1E8W A;  3RT3 B;  2D3B A;  1C78 A;  1B1Z A;  1ET9 A;  4HCN B;  3AE4 B;  3WIM A;  1QK1 A;  4PS7 A;  4HKQ A;  2KN4 A;  2JRI B;  1JQ4 A;  2MJE A;  3Q8C A;  4MEM A;  5AZF A;  4LLG M;  3IG5 A;  2MBE A;  2KN5 A;  3Q69 A;  4WAF A;  4HPP A;  4GXB A;  1NEK B;  4AP4 C;  5JHB A;  3A4S C;  2HJ8 A;  3W1Y A;  4CQN A;  3PRZ A;  4JWU C;  1MFW A;  2QC8 A;  4K7W A;  3MC8 A;  4ZDV A;  2WQY B;  4LNK A;  4EE2 A;  4IC7 B;  2IZV B;  4BFR A;  4ZRI A;  4ZYN A;  3V6E B;  1U4A A;  1VD2 A;  4O1N A;  2WDT B;  2HDE A;  1ENF A;  1ET6 A;  3VDZ A;  3N1X C;  3H8H A;  3LJ3 A;  4AQ7 A;  3QAQ A;  2WXP A;  2PPH A;  4GGQ A;  4P7I A;  2IO0 B;  4FXC A;  2L76 A;  1GPX A;  3AEE B;  1OTR B;  2G4S A;  4FJZ A;  4ANX A;  3QX1 A;  1ZP0 B;  2G9H D;  4WJQ A;  4AM1 A;  1U6R A;  3AU5 A;  3MJ5 A;  5LNK 1;  3WAL A;  1D4B A;  2W55 A;  2D2Q A;  3FIL B;  4RM8 A;  1EM7 A;  2V4I B;  1JRO A;  4RGT A;  4Q2J A;  4HJG E;  4PS8 A;  1P3Q U;  2CU1 A;  1R7S A;  4NQL B;  4GW2 A;  3T9L A;  1WZ3 A;  3MFG A;  3LB8 C;  1I42 A;  2V1Y A;  4M01 A;  2JYT A;  1K8R B;  2MLB A;  3GOE A;  5JH5 C;  1IGC A;  2NBV B;  1ZW7 A;  2KFK A;  2CHX A;  4AWJ A;  1E5W A;  3FAH A;  2M17 A;  4LNN A;  1A5R A;  2XBB C;  2MWS B;  3W5U B;  1PGA A;  1FXA A;  1I0E A;  2L0T A;  2N9P C;  1I35 A;  4XGA B;  4IWQ A;  4XE0 A;  3U7Z A;  3EHV A;  3OJ3 A;  3UIP B;  4IW0 A;  3VTU A;  4XX5 A;  2NTS A;  4RMA A;  3AV8 A;  1F0Z A;  4EZL A;  2G1E A;  5IKC M;  2MP2 A;  2EMS A;  4NPN A;  5E6P A;  2ZPN A;  1SGH A;  1NEN B;  2IO1 B;  4MGK E;  3J9C A;  2IY0 B;  4C7Y A;  3JU6 A;  2AQ2 B;  1ZKH A;  1I4R A;  3L2D A;  2M0X A;  3B6R A;  2IBI B;  2C9W B;  3EEC A;  2L7R A;  3RN9 C;  2MEK A;  4XWT A;  3PVL A;  2GBR A;  3PV1 A;  1TS5 A;  3NVY A;  2EMT A;  2M1M A;  2WXH A;  3HVZ A;  4AS1 A;  2PVG C;  4KV2 A;  3GE3 C;  2GBM A;  3H6N A;  1QF6 A;  3R3M A;  1UWX A;  4RH6 A;  1WJ6 A;  3LVW A;  3ZNZ B;  5HHD G;  2V9H A;  1YJ1 A;  1H8C A;  2GOW A;  1TT4 A;  1I4P A;  3SR6 A;  4RM9 A;  5C23 A;  1L0Y B;  4HEA 1;  2N7E A;  1WGG A;  3R7R A;  3RFZ B;  1JML A;  3I63 C;  4KZ0 A;  4I6N B;  3VVW B;  3MJW A;  3IHP C;  2QEJ C;  3NJT A;  1GAQ B;  3ZNG C;  5EDS A;  4EOY A;  1VRA B;  1CK1 A;  1YD8 U;  2ONQ A;  3AE7 B;  4GIV A;  2WU5 B;  4RF8 A;  4M02 A;  4RF0 A;  4Z9M A;  1OQQ A;  2R61 A;  2VRR B;  3NZU A;  5BYQ A;  2JT4 B;  4XZ4 A;  3TL5 A;  3Q8A A;  3SU8 X;  2LJI A;  3AE9 B;  1TKY A;  1L6U A;  1OEY A;  2RMM A;  3UQA A;  4MGZ E;  2J0M A;  3JSV B;  4C4V B;  1MJD A;  3ECI A;  3R2I A;  1S3S G;  3AMZ A;  4GB9 A;  4GVZ A;  5AZG A;  3AEC B;  2LGI A;  4IM3 A;  5E6O A;  1JW9 D;  3NZS A;  4WQM A;  4A3O A;  3Q8F A;  3O13 A;  4RF1 A;  4YT0 B;  4J6I A;  1WGY A;  2M8S A;  4LNO A;  4DHZ B;  3TIX A;  4KKJ A;  1XLP A;  1OQY A;  3A9K A;  3ZDT A;  1FM0 D;  1E10 A;  4LK0 M;  3ZTC A;  4YSY B;  4JGH B;  2IO3 B;  1V2Y A;  5BYS A;  3WAN A;  4MGI E;  3AB5 A;  5HG2 A;  1QOG A;  1YN4 A;  1XT9 B;  2C60 A;  3Q3O C;  4NJ6 A;  2N7J A;  2LJ5 A;  4JE3 B;  2KJR A;  1ZXI A;  1P50 A;  1IP9 A;  3QAR A;  1HQR D;  3DVG X;  1L0X B;  4DHZ E;  2AL6 A;  2QHO A;  1IBX A;  2KDF B;  1WGR A;  4A55 A;  4M0W A;  3FKY A;  4RFB A;  2WDR B;  5J18 A;  2RDB C;  1K51 A;  2KD0 A;  2AYO B;  4WUR A;  3VTV A;  2JU6 X;  4DHJ B;  1ZGU B;  4OVU A;  3K9O B;  3QJZ A;  4RGO S;  4KDI C;  3M63 B;  3AEF B;  2LI5 A;  2MRP A;  2GI9 A;  2BPS A;  3DPD A;  2NVU I;  1SF0 A;  1YOV B;  3PRP B;  3DBH B;  2ACZ B;  1TT5 B;  3NZ3 A;  1VR9 A;  2GWD A;  3VH4 B;  1R4M B;  4URK A;  2OJW A;  3MTN B;  3JYU A;  3ZNI D;  1P7F A;  2GWC A;  4LTU A;  3ENE A;  4K7S A;  1WSP A;  2BKR B;  3Q8E A;  1YNT E;  4ZOH C;  1MHH E;  3BIN A;  2I38 A;  1QQR A;  3U2S C;  1SE2 A;  3SFD B;  3LYY A;  1AYF A;  1ESF A;  3ML8 A;  5IO9 A;  1VZ7 A;  1HTO A;  1E9M A;  2LGX A;  1SBB B;  4OVZ A;  4BKT A;  2LAS A;  2WHI A;  3HVD A;  2L83 A;  2DAF A;  3BYT B;  2IO2 B;  4MSQ B;  1JCK B;  2D32 A;  4ARC A;  2W3R A;  3W2D A;  4IUM B;  3P4P B;  1QOA A;  5EE9 A;  1TYG B;  4ITK A;  2BW2 A;  3B2G A;  1E0Z A;  2K6Q A;  1RAX A;  5MPO A;  1NI2 A;  4ANU A;  2KMC A;  1GUA B;  4L2Y A;  1TGZ B;  4WWM A;  3VRB B;  3VFK A;  1J0G A;  1J19 A;  3HK0 A;  5JZE B;  3RNC C;  2WU2 B;  2ON8 A;  3SEB A;  3ONS A;  2HTH A;  1PDX A;  4M8N A;  1RM6 C;  2KWU B;  1WMH B;  2FID A;  2XNA C;  4EUT A;  1C3T A;  2MW5 A;  3H9D A;  3BY4 B;  3ZJU A;  1YN3 A;  3N1Z C;  2BGF A;  3UQB A;  2JQR B;  1WR6 E;  3AU4 A;  3ZDM C;  3GB1 A;  1D6E C;  1V5O A;  3OJ4 B;  3BVG A;  1WM2 A;  1E8Y A;  5D94 A;  2DYB A;  3Q3J A;  1IYF A;  3DHG C;  4LJO B;  4BG4 A;  1V1P B;  4BKS D;  4PYU A;  3VR9 B;  2AX5 A;  2KLG A;  1V1O A;  1KH0 A;  1WXS A;  4LCD E;  1T0Q C;  4HLE A;  4DWF A;  1UUP A;  2C7H A;  1WGD A;  3EFU A;  3V61 A;  1TS2 A;  2KVR A;  3E56 A;  2MHJ A;  1NYR A;  4BHL A;  2K25 A;  2H88 B;  3W9C B;  2BYT A;  5H8Y E;  3UF8 A;  4ZYS A;  5CHV C;  3L0W B;  3NVZ A;  1SJE D;  1L2N A;  5G55 A;  4B0E A;  2VH1 A;  4GU2 A;  1WXV A;  2QSD A;  3ZNH B;  4GDK B;  3N20 C;  3RMK C;  4S0R A;  1FPY A;  2EKI A;  3NS8 A;  1BML C;  5LXI B;  3CIR B;  1WRI A;  2KZR A;  3PS6 A;  1UF0 A;  1WYG A;  2PKO A;  1DOX A;  1T0R C;  1MHX A;  1VCB A;  1F2R I;  4BOZ B;  1RWS A;  2CU3 A;  3A1Q B;  2KWC A;  4W9F A;  2YLM A;  1QOB A;  2JZZ A;  1VZ6 A;  1XO3 A;  4YL8 A;  2ZNV B;  1XF5 L;  2BWF A;  2LUM A;  4D2K A;  2DX5 B;  3RCZ A;  3P42 A;  3IBE A;  1EF1 A;  4G3X B;  2JVC A;  3RZF A;  2WXI A;  1F2R C;  3R8B A;  3W1S A;  2ASQ A;  3KW5 B;  1WWT A;  4HCP B;  4IDI A;  1VLB A;  3ETR A;  4XDD A;  1LM8 B;  2INC C;  1EU3 A;  4WJN A;  3RPF C;  3VQI A;  3ZVV A;  4GN1 A;  1FFV A;  1TY0 A;  2FCQ A;  4NZL B;  4PK1 A;  1C77 A;  2MP2 B;  5E6J A;  2LHE A;  4N6E B;  2D3C A;  1TIF A;  4XWW A;  1C1Y B;  3ZRF A;  1I4X A;  2OED A;  2MCN B;  1ZDV A;  1UWM A;  2PEA A;  1QOF A;  1Q5W B;  1KFY B;  2BS2 B;  3BK1 A;  1GOZ A;  2KMM A;  4CO7 A;  3BII D;  2KFK B;  4MSM B;  2DYO A;  5D3D A;  3DHI C;  3NZT A;  1L5P A;  3P4R B;  4LJP B;  2KJ6 A;  2JY6 A;  3KVF B;  5DCN A;  1JRP A;  1Y8R C;  1SIF A;  1V9J A;  1P0R A;  2RSU A;  1Q0W B;  3DQV A;  1VDV A;  3IT6 B;  2DZI A;  1V8C A;  2W9N A;  4YXD B;  1E8X A;  3A9J B;  3Q2A C;  2FBW B;  2CRK A;  3AM9 A;  2N9L A;  3JVZ X;  4WAA A;  2DZK A;  4JQW C;  3VUX A;  2CR5 A;  1VA6 A;  1WE6 A;  3ZRC A;  2L1A A;  2KYW A;  1C4C A;  4HPL B;  4NAM A;  5G5H A;  4EKU A;  1FEH A;  2V3P A;  2KC2 A;  3U7D A;  2KKC A;  1YQ4 B;  4NJ7 A;  3OLM D;  3A4R A;  3DRE A;  1C76 A;  3GS2 A;  1C9F A;  3DBH I;  3FIL A;  3L10 B;  2LHD A;  2K6D B;  4L23 A;  1I4H A;  2LVQ A;  3RI7 C;  1QZE A;  2MJ3 A;  4LNF A;  1N63 A;  2DYM A;  2DLB A;  1FIQ A;  2K8H A;  2L00 B;  1V80 A;  2JWU A;  4RF6 A;  1V1P A;  2XK5 B;  3VTW A;  2ZCB A;  4MH0 E;  2J0K A;  3VAW A;  1I7H A;  2VZK B;  1KLV A;  1ACC A;  2WWZ A;  5KHO A;  5JHA A;  4YTN B;  3N3K B;  4EZJ A;  4ICU A;  4KX6 B;  3JU5 A;  1ZE3 D;  2QIE B;  1V6E A;  4KIK A;  4RGM A;  2W82 A;  4KVG B;  3DVG Y;  1F9J A;  5D3I B;  3U30 A;  4BKS A;  1KLU D;  2Z8L A;  3NS1 A;  4GOC A;  4II2 B;  1PGB A;  3IFW B;  2C7N B;  1DOY A;  2X8X X;  4ZRK A;  5L83 A;  4FJV B;  5AEK B;  3QHT A;  2KT7 A;  4RNA A;  1BG0 A;  1V5T A;  1WY8 A;  4C7Z A;  3H7P A;  2OOB B;  1QIL A;  3SD5 A;  3DOW A;  2JPH A;  4C00 A;  1GG3 A;  2G45 B;  3RUI B;  4XYC A;  1I4G A;  1UBQ A;  2KNB A;  2KWV B;  5BMG A;  3AUL A;  4P1C C;  4W9J A;  5CHW A;  2VH2 A;  4FN2 A;  3PRE A;  4OVV A;  3RZW C;  2NMQ A;  2NPT A;  4W9H A;  1H4R A;  4W9I A;  1TS4 A;  4BVU C;  2DBY A;  2WXQ A;  2XN9 C;  1SJH D;  5J9A A;  2WXF A;  1TTN A;  4L1B A;  3BVZ A;  3AE2 B;  1CRK A;  5DPW A;  1E90 A;  3B1L X;  5G5G A;  2QMT A;  2Z0D B;  2WXL A;  2ZW0 A;  1C4A A;  4OW0 A;  1LFD A;  3GZN B;  3QCA A;  2N1V A;  3QA8 A;  1WXM A;  5DPR A;  2XEW A;  3WAP A;  3AEG B;  2ZCC A;  2JXT A;  2JSV X;  1WXA A;  2MBB B;  2KX0 A;  2KAJ A;  3PZ7 A;  1WRD B;  2WP9 B;  2L3Z A;  2ICI A;  5AZH A;  3E9S A;  2WYQ A;  2I1K A;  3W5V B;  2WDQ B;  2JZP A;  4FAD A;  4W9G A;  4HRO A;  3TEZ A;  1XLQ A;  1QH4 A;  3NVW A;  1T6B X;  1WZ0 A;  2EKE C;  1TS3 A;  2WXO A;  4GDL B;  1JWS D;  4KGT A;  4J3O D;  4B0M A;  2LVP A;  2Z59 B;  2LVO A;  2N9X A;  3ZJT A;  2LXC A;  4WJP A;  2O2V B;  1T5X D;  4EZK A;  3ZUN A;  3ZQ4 A;  4W9L A;  2LGS A;  4ZRP A;  2JXX A;  2FCS A;  3R7Q A;  3JSV A;  4C4V A;  2GMI C;  1R4N I;  3PHX B;  3AE5 B;  2O6V D;  2BYV E;  5AUK A;  3IG8 A;  3TCA A;  1OFF A;  3HHM A;  2UWQ A;  2C7M B;  1P98 A;  1SIJ A;  2M19 A;  4QAY A;  3V62 A;  1SE9 A;  3EGR A;  1YJJ A;  2BKF A;  3C19 A;  2L52 A;  1V97 A;  2R2O A;  1FD6 A;  1HXY D;  1J7B A;  3CF6 E;  2KTR B;  3Q14 C;  2KJH B;  2KFJ A;  1TJE A;  4K3B A;  1QKZ A;  3VH3 B;  3GE8 C;  1LXD A;  4HPM B;  2YEP F;  2DZJ A;  3R2T A;  3DHH C;  5DPS A;  2PE9 A;  3LDZ E;  3OG5 A;  1CMX B;  1N6Z A;  1Z5S B;  1WE7 A;  4AOF A;  3DRB A;  1P1A A;  4DDI D;  3PSE B;  1MVK A;  2MBH A;  3PHW B;  4MM3 A;  2BB5 A;  3A9J A;  1YJI A;  3PTF C;  2CJO A;  1TBE A;  1ZPS A;  5IN7 A;  3Q3N C;  2CKH B;  1M4V A;  4WQO B;  2IGG A;  1WF9 A;  1NYQ A;  4AUQ C;  2MBQ A;  2DZM A;  1IBX B;  4DHJ D;  2BTE A;  2LEK A;  2GRI A;  2RR9 A;  3M95 A;  2WLB A;  3NHE B;  3DBR I;  1E8Z A;  4NAW B;  5GXG B;  1RL9 A;  2BYE A;  3HM6 X;  4ZRQ A;  4ANW A;  4DXA B;  4M00 A;  1V81 A;  3ZTD A;  1EWY C;  2FE8 A;  4REZ A;  4TQ1 A;  2K0P A;  1P7E A;  4US9 A;  2KOX A;  3EC8 A;  5BYR A;  5D6J B;  1FMA D;  3UGB B;  2RDH A;  3CSF A;  1GJZ A;  1FNV A;  4ICV A;  5IP4 D;  2BYF A;  2K22 A;  1C79 A;  1YQB A;  1AW7 A;  3X23 A;  1JWB D;  1WGH A;  3QC8 B;  2KVZ A;  3IXS A;  3AI5 A;  4MEL A;  3QIJ A;  4PS3 A;  5GMV A;  2V3S A;  2Y5B B;  3TBL D;  2AQ1 B;  1D5Z C;  2RPV A;  1RRB A;  1KF6 B;  2YVC A;  3APC A;  1ZXH A;  3I3T B;  1WGK A;  2QIL A;  1J7C A;  1OQR A;  2MQJ A;  3S2A A;  2C5L C;  1EO6 A;  1HZ6 A;  1WXQ A;  3WCQ A;  2A4Z A;  4TSS A;  4P1B C;  3EUB 2;  2ZPY A;  3DWM A;  3APF A;  2G3Q B;  3TMP B;  4ZRJ A;  4DXF A;  1WH3 A;  2V3N A;  1KM7 A;  1KLG D;  1K53 A;  2BS4 B;  4YWG G;  4TQ0 A;  1NVI D;  2DNF A;  4JL9 A;  4WWN A;  1KRH A;  1F77 A;  1MG8 A;  3U8Z A;  3MP9 A;  4HWI B;  4IOI E;  3VUY A;  1WJU A;  1OEY J;  3EFC A;  3IAS 1;  3B9J A;  2BF8 B;  2N9K A;  2M0A A;  2JRH A;  1KJT A;  3IAM 1;  2KX3 A;  1YN5 A;  2NBU A;  3LXF A;  2KXJ A;  1MG4 A;  5BMH A;  1CQV A;  1V4G A;  2BS3 B;  2DEN B;  3L17 A;  2HD5 B;  2DHZ A;  1IPG A;  2L05 A;  2E3T A;  1IUE A;  5EE1 A;  1G0W A;  1ROE A;  2JUO A;  5EE0 A;  2LFI A;  5HI1 A;  4M8M A;  2FNJ B;  1R4M I;  1BXT A;  2W3S A;  2V0G A;  3C0R B;  1STE A;  2GLS A;  3ZXR A;  3N32 A;  4DK5 A;  1NBF C;  3V3X A;  3P4Q B;  3M10 A;  3IG3 A;  1AAR A;  2RDG A;  2B3A A;  4YSX B;  3PO0 A;  2NR2 A;  2JZ3 B;  1XEE A;  3KYC D;  2KTF A;  1X1M A;  1FXT B;  5IA7 A;  3ZO5 B;  4N59 A;  1N5W A;  2Q5W D;  1JWM D;  2HE7 A;  2BT6 A;  2CS4 A;  1FRR A;  1TZO A;  1L0V B;  2V4L A;  1MI0 A;  3DDC B;  4N9F 4;  1S1Q B;  2KDM A;  1M15 A;  1AN8 A;  2I2Y A;  2IYD B;  4G11 A;  2GBK A;  2PLP A;  3QK0 A;  2J42 A;  3Q8B A;  5J17 A;  4B9K A;  2R2Q A;  4GSW A;  4W9C A;  1V49 A;  2INP E;  4HXD A;  3PT2 B;  2REX A;  1N5X A;  2K5P A;  4RF7 A;  2NPT B;  1YQ3 B;  5C2T B;  4A6Q A;  5J2R A;  3ZLZ A;  2J4X A;  1DOI A;  4H2A A;  1F52 A;  4TMA B;  3ZW3 A;  2FAZ A;  3A33 B;  1SE4 A;  4ZHO A;  4R3D A;  4JIO U;  1Z2M A;  4P16 A;  3DVN U;  4HJK A;  3U52 E;  2H89 B;  3L08 A;  3KLS X;  1SE3 A;  2KTR A;  3GZN I;  4FBJ B;  2D07 B;  4IWO A;  1FCC C;  1GC6 A;  2PJH A;  1RYJ A;  1P9D U;  2L8J A;  4F1S A;  1Y56 A;  2E6X A;  1QLB B;  4KDL B;  1F1H A;  2WXR A;  3TSS A;  2L32 A;  3H7P B;  4K1R B;  4KSK C;  4G50 A;  2IDY A;  3N9Y C;  3P2B A;  4OHJ A;  3LVV A;  5HKH A;  1WX9 A;  3NG0 A;  3LN7 A;  2PVO D;  1JWA D;  5CTR C;  4A8X C;  4M0W B;  2LWP A;  2FUG 1;  3U4E G;  4JX1 C;  4YTP B;  3A9K B;  3UIO B;  2BQQ A;  3HUI A;  1L4Z B;  3RNF C;  3I57 A;  4TV3 A;  3PRM B;  3PLU A;  3N1Y C;  4UDU C;  5AUI A;  3R66 C;  4FLH A;  3K9P B;  3V6C B;  4EFO A;  3AXC A;  4FHJ A;  3OWE B;  2BBC A;  4KSL C;  4FUL A;  2MSE D;  1ZUD 2;  2DWQ A;  2WXN A;  3I9V 1;  3RNB C;  2XK5 A;  2AEH A;  2WX1 A;  2JYE A;  4NQK E;  3DBS A;  1CJE A;  1CZP A;  4NNJ B;  5FK9 C;  1WX7 A;  1YX6 B;  1XLO A;  2WS3 B;  2Y5P A;  5TR5 A;  3VR8 B;  2W54 A;  1HEZ E;  3JPZ A;  4S17 A;  1HA5 A;  2N9E B;  1FNU A;  2AQ3 B;  5LXH A;  2ZVN A;  5J99 A;  2MX2 A;  4K7U A;  1V86 A;  2WX0 A;  1DGJ A;  1BUI C;  3DWG C;  2KDE B;  3IT4 B;  5CX3 A;  2BVC A;  2LRW A;  4KKI A;  5L95 C;  2FUH B;  1FXI A;  3RD2 A;  3RNE C;  3ZYY X;  2LMC A;  3P1M A;  4C56 C;  2A5U A;  4DBG A;  1M94 A;  4HRS A;  3BK2 A;  5HFY A;  4BAX A;  1GB4 A;  1Q10 A;  2KC1 A;  3CST A;  4BBN C;  3APD A;  1N61 A;  2KO3 A;  3Q3M C;  4I6P A;  2CJN A;  3JQ3 A;  1UBI A;  1AWD A;  2D3A A;  3ALB A;  3NVV A;  2D3G A;  4ARI A;  2DAJ A;  4A20 A;  3ZGZ A;  2KAC A;  3URY A;  1HZ5 A;  1PYW D;  2D11 A;  1K52 A;  3N30 A;  3B0A A;  1J8C A;  1RFK A;  3PPA A;  1DYQ A;  1KTK A;  2RGF A;  1ZOY B;  1WX8 A;  5E6N A;  1K50 A;  3M62 B;  1TY2 A;  3T8M A;  2KDI A;  1SB3 C;  4PYZ A;  4KIK B;  1JRU A;  2O6V B;  4NY0 A;  4TKN A;  2KK8 A;  3H1U A;  4FJY A;  2KAN A;  1EUV B;  2K1F A;  3SFE B;  3KYD D;  3WAM A;  2GB1 A;  1TKG A;  1VRP A;  1TZ1 A;  3M3J A;  2WXK A;  1T0S C;  1D3Z A;  2JF5 A;  2ZJD A;  3EA6 A;  3ML9 A;  5D2M B;  1N60 A;  1WR1 A;  4HKZ E;  1PFD A;  3T3O A;  3HIZ A;  4XDC A;  2N4F A;  1NDD A;  2FCM A;  3AH7 A;  3AE3 B;  2K39 A;  4USA A;  3MC9 A;  2LGY A;  4HVB A;  2LRU A;  3BZD B;  3Q6B A;  3B2F A;  1QT9 A;  3TUO A;  1UEL A;  3HRD D;  5G2N A;  2LXA A;  4WWO A;  3PZD A;  2PTL A;  3BVM A;  4KGS A;  3BWU D;  3KWV A;  4MT5 A;  2KMA A;  3D32 A;  4PT5 A;  2MJD A;  4BBN F;  1GC7 A;  3AEB B;  4OZA A;  1L6V A;  3P63 A;  4ANV A;  3AE8 B;  3UI3 A;  2LD9 A;  1EF5 A;  4MJS A;  3LN6 A;  2IJ0 A;  4MDK E;  4ASW C;  2RPQ A;  5DPT A;  1KOT A;  4RGN A;  1R4N B;  4LDT B;  1YMH E;  1GNU A;  3KQ4 A;  4YTM B;  1TKE A;  1XQQ A;  1LO5 D;  2FIF A;  3PLV A;  1T3Q A;  3PGE A;  3Q3F A;  3AE1 B;  2EEL A;  1UNS A;  3V05 A;  3AN1 A;  1XD3 B;  5D7G A;  3WAO A;  3IVF A;  4II3 B;  2GBN A;  2WXG A;  3QWZ B;  2N0S B;  1JWU D;  2J1Q A;  3CMM B;  1B9R A;  4WJO A;  4GVY A;  1E7P B;  1HTQ A;  5LLI A;  1SXT A;  2L0F A;  1A70 A;  2N7D A;  2NBW B;  3RYT A;  4IG7 B;  3KUZ A;  1OGW A;  4RF9 A;  4MAC A;  2PIA A;  3MHS D;  4IKG A;  2ZZP B;  2WGS A;  1T0Y A;  2MA9 B;  2WXM A;  1XXG A;  2J53 A;  2O6V A;  2TSS A;  2LGD A;  3DBR B;  3ZXV A;  5C3J B;  2ZNV C;  2QCZ A;  5T8I A;  3NY5 A;  4RCO A;  2UYZ B;  1ISN A;  4NAW A;  5IOI A;  4FA6 A;  1FNW A;  2MBO A;  3L16 A;  2PW9 A;  5TSS A;  3NUH B;  1SD0 A;  2VZK D;  2KQS A;  5FR3 A;  1SSN A;  4AJW A;  4A90 A;  3DVN V;  2PMV A;  2IY1 B;  2B76 B;  5EE3 A;  2IGH A;  1YIW A;  1P52 A;  4DXG A;  2KQ4 X;  1L7Y A;  3SHQ A;  3QQ8 B;  1WIA A;  3AEA B;  2QDF A;  1RFA A;  1XCT L;  3T3N A;  2NS5 A;  4I6L B;  4DDG D;  4C80 A;  4E3C A;  2INN E;  2HTM E;  1WJN A;  3RNA C;  3KUC B;  3WA0 A;  2HJ1 A;  4JWS C;  1EU4 A;  4A3P A;  3TEX A;  2IPK D;  1UH6 A;  2JWZ A;  3ZJV A;  3JW0 X;  1YX5 B;  1PQS A;  3A1Q A;  3KWL A;  2FCN A;  4W9K A;  1Q1O A;  4IM2 A;  4F8C B;  3DCG A;  4HK2 A;  4BZA A;  1UGJ A;  3C8Y A;  4B95 A;  1VJK A;  1N62 A;  4MJS B;  3UIN B;  1UD7 A;  4IM0 A;  1SEB D;  2LZ6 A;  2Z0E B;  4XC2 A;  2YEP B;  2Y5C A;  2OJR A;  5IAA C;  4KZC A;  2KWD A;  3W1S C;  1FCL A;  1FO4 A;  4G0N B;  1WFY A;  3SDL C;  3TJP A;  4MGY E;  5FKA C;  3AED B;  3KUD B;  2KQ7 A;  1D5M C;  4N58 A;  5BMI A;  2AWT A;  4TUU A;  2D5G A;  4NJC A;  2D10 A;  3B08 A;  1UGM A;  4BG4 B;  3H7S A;  2UU7 A;  3DBL I;  2K8C A;  4HDQ A;  4KGR A;  5JXV A;  3KH0 A;  5BO4 B;  1D5X C;  2SEB D;  4GLS C;  4W9D A;  4LDT D;  1WI0 A;  2JX5 A;  1NI3 A;  1FRD A;  1MPE A;  1WM3 A;  2BB6 A;  4EEW A;  1JAL A;  2ZVO A;  4GMV A;  3ZKJ C;  4GDK A;  2ZW1 A;  4BOS C;  3TEW A;  3L2E A;  4YSZ B;  4MH8 A;  2LUE A;  3VUW A;  3L13 A;  2MH7 A;  3P4S B;  1WMH A;  4B6W A;  4AJY B;  4JLC A;  2D33 A;  1J7A A;  4ACF A;  4E71 A;  4CYE A;  2J7Q B;  4HDO A; 
#chains in the Genus database with same CATH homology
 2D3A A;  2OJW A;  1HTO A;  1CRK A;  1P50 A;  4RF7 A;  2GLS A;  3NG0 A;  3ZXR A;  2D3B A;  2LGS A;  4LNI A;  1LGR A;  3ZXV A;  2QC8 A;  2WHI A;  3JU5 A;  2J1Q A;  4XYC A;  1QK1 A;  4S17 A;  1P52 A;  4LNF A;  1M15 A;  3DRB A;  3JPZ A;  3M10 A;  4LNK A;  4S0R A;  1FPY A;  1BG0 A;  4Z9M A;  4GVY A;  4GW0 A;  4BHL A;  4BAX A;  1HTQ A;  1F52 A;  5J99 A;  3L2E A;  1G0W A;  3L2E B;  1QH4 A;  3FKY A;  4LNN A;  4AM1 A;  2CRK A;  5J9A A;  1F1H A;  2D3C A;  1U6R A;  1SD0 A;  1VRP A;  3JU6 A;  4GW2 A;  4RF6 A;  1RL9 A;  4HPP A;  3DRE A;  4BG4 B;  4RF9 A;  2UU7 A;  4BG4 A;  4LNO A;  2BVC A;  4Q2R A;  1I0E A;  3JQ3 A;  4RF8 A;  4ACF A;  3L2D A;  4GVZ A;  3B6R A;  2WGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...