2UU7A

Crystal structure of apo glutamine synthetase from dog (canis familiaris)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
370
structure length
370
Chain Sequence
TSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKGVEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mammalian Glutamine Synthetases Illustrate Substrate-Induced Conformational Changes and Provide Opportunities for Drug and Herbicide Design.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE
total genus 112
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2uu7A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2uu7A02
2D3BA 4LNFA 4LNKA 1HTOA 4S0RA 2WHIA 4LNNA 3ZXVA 2OJWA 4HPPA 2QC8A 2GLSA 2UU7A 2BVCA 1F1HA 4XYCA 4LNIA 2D3AA 2LGSA 1LGRA 2WGSA 3FKYA 2D3CA 4BAXA 3NG0A 3ZXRA 1HTQA 1FPYA 4LNOA 1F52A 4ACFA 4S17A
chains in the Genus database with same CATH superfamily
1ZP0B 2RDGA 2LVOA 2FUHB 3AMZA 4TQ0A 4HRSA 2KJ6A 2W55A 1VCBA 5FR6A 1WGRA 1KF6B 2L76A 3KH0A 4HJKA 3SR6A 3QC8B 3RMKC 2KNBA 1B9RA 3L2DA 1QF6A 2J0KA 3P4SB 2G4DB 2QEJC 3PZ7A 3DCGA 2WQYB 3A1QA 2K25A 3C19A 4LCDE 2WXGA 4FJYA 2QJLA 3AH7A 2KDMA 1GJZA 3DHHC 3QX1A 4OZAA 3NZUA 5DPWA 4WAFA 1P98A 1QOAA 1WGKA 1Q10A 4CYEA 3VAWA 4F1SA 1ZOYB 3P4RB 3EUB2 1HE8A 2KDEB 3EFUA 1WM3A 1YX5B 2UYZB 3EHVA 5DPRA 2JXXA 3ZRCA 3ZTCA 2MBBB 2JRIB 3PLUA 1SSNA 1DOIA 1YOVB 3PPAA 2AQ1B 2MW5A 4XC2A 4IOIE 2D07B 1EM7A 3NHEB 2KN4A 2V4IB 4N9F4 2EKIA 1QOGA 5DCNA 1X1MA 3H1UA 1FRRA 4JGHB 2LD9A 2D3CA 4KVGB 1M94A 4ZRPA 4EE2A 5AEKB 2WNMA 2DYOA 1JMLA 3NVVA 4REZA 1VLBA 1F52A 2AQ3B 2BB5A 1S1QB 1K53A 2HJ8A 2V3SA 3JYUA 2M56B 1I4RA 4DBGA 4GMVA 1T0YA 2BVCA 3LN7A 1TKEA 4BKGA 2MBOA 2I1JA 5HI1A 2K3UA 2CRKA 3AECB 5D3IB 2WXJA 3H6NA 2GBRA 1OFFA 3ML9A 1TIFA 3N32A 3DHGC 2Q5WD 2Y5CA 5EDSA 1P50A 4BFRA 2OJWA 2JZPA 3KYCD 4W9EA 2AX5A 3R2IA 3NS8A 2Z59B 5T8IA 4OHJA 3D32A 3TEWA 1AWDA 1H4RA 2GBKA 1E10A 1ENFA 3AEEB 2WP9B 1PDXA 2XEWA 4YTNB 4BBNF 1HTOA 4K3CA 3DVGX 5J18A 3ZGZA 5MPOA 1V8CA 1AARA 5D94A 3L10B 3KW5B 3RNCC 4WJQA 1WJNA 2UU7A 2V4LA 1EWCA 3VRBB 4WWNA 4JLCA 2JYEA 4EOYA 3ZJTA 3RNAC 4GSWA 2LHDA 4TMAB 4WJPA 1PGAA 1U4AA 5EE9A 3U2SC 1T0QC 1WR6E 1RFAA 4GN1A 2HTME 3KQ4A 3OJ3A 3NVWA 2HTHA 1FNVA 3Q8BA 1FMAD 4DXFA 4YSXB 1I42A 1E6EB 3HM6X 2DAFA 3VTVA 4MSQB 1E8WA 3ZDTA 1ZDVA 4XWWA 2DZMA 2Y5BB 5CHWA 2Y3AA 3URYA 4B95A 3PT2B 2D33A 2TSSA 2FCSA 1TYGB 4NJCA 4DHZE 1M4VA 2KTFA 4P1BC 3AEBB 2ZNVB 4HPLB 5DPSA 4B0EA 3GZNI 3OJ4B 3ZJVA 1T6BX 4NAMA 5JXVA 2J1QA 3AEFB 2KQ4X 3TUOA 3LJ3A 2CHXA 3UGBB 1RL9A 4CO7A 1KLGD 2IO0B 2KWDA 3A4RA 3VHTC 2KKCA 5C3JB 4FJZA 1VZ8A 2JQRB 4S0RA 4GDLB 3BY4B 3DBSA 4IKGA 3ML8A 4ZRQA 2JVCA 2E3TA 4JE3B 2IGGA 2WXIA 1R4MI 2QC8A 3DWMA 1XLPA 3B08A 4A9AA 1TS4A 3AXCA 3VUYA 4JPSA 3QCAA 2XBBC 4M8NA 2L83A 4DHJD 1Z5SB 2WXQA 2ZW0A 3Q3JA 4MDKE 3U8ZA 3Q8CA 3GP7A 1SE3A 2AL6A 3ZNID 4O1NA 1MHXA 2MEKA 2PVOD 2MX2A 1KLUD 4WJOA 4W9GA 1CJEA 5LXIB 4GU2A 3UIPB 3L2EB 1IGDA 1QOBA 1WX7A 2J4XA 3W1SC 1KOTA 1VRPA 4KZ0A 4I6NB 4US8A 2I1KA 1B1ZA 3AV8A 3I3TB 1I7HA 1AYFA 1TZOA 4BKSA 5IKCM 1SGHA 2KFKA 4IWOA 2QCZA 2W54A 3KWVA 3AU4A 1G6JA 2Y5PA 1ZGUB 3BIID 4WAAA 3MTNB 3QAQA 1NENB 1PQSA 2C5LC 1L6VA 2KJHB 1J19A 1R4NI 1KFYB 1V86A 2IJ0A 4WQOB 2BKRB 2I2YA 4FHJA 4M8MA 2VRRB 1DGJA 1V5OA 4AWJA 4OVVA 2K6DB 1FO4A 1P52A 2KT7A 1E8ZA 1Y8RC 2PIAA 3RZFA 4J3OD 3WAOA 5C1ZA 1UWXA 3N1XC 2AWTA 2ZVNA 2L00B 1VA6A 2NTSA 3MC9A 1I4PA 3VXWA 4BG4A 4FULA 4II2B 1LO5D 1UH6A 3M63B 4II3B 5IN7A 2WU5B 3I5JC 4KDLB 2NBVB 4B6WA 3OWEB 1GNUA 2LVPA 2NPTB 5AUIA 1C79A 5BYSA 3PRPB 4PYZA 4KKIA 4JX1C 2G1EA 4PS8A 4WWPA 2DWQA 3EC8A 2K6QA 2VZKB 3WAPA 2WXLA 2V0GA 3R7QA 3ZKJC 2J7QB 3LB8C 3U52E 1XO3A 3PHWB 2L0TA 2MWSB 1R4NB 2PE9A 2XK5B 1ZKHA 1I4HA 2FIFA 4E71A 4NQLB 1XQQA 1TS5A 3MC0B 2KO3A 5HKHA 5IA7A 3CF6E 1BXTA 1J8CA 1SXTA 2N9LA 4OZBA 5D2MB 2NMQA 4GGQA 1L5PA 2MBHA 3W2DA 4IG7B 3TEZA 5HFYA 3E9SA 3APDA 3AM9A 1I35A 3R2TA 2WXRA 2KLGA 1PYWD 5IO9A 4AOFA 4AM1A 1HQRD 2BTEA 3O65B 3BVGA 1WJ4A 2LJIA 4WH4A 2JF5A 4HXDA 2MP2A 3U7ZA 1I4QA 3N20C 4MGIE 1VR9A 4BBNC 2LFIA 2AL3A 1VDVA 3SHQA 2BF8B 2DENB 1TJEA 1SBBB 3NS1A 3L16A 1F77A 3ZYYX 3RFZB 1TY0A 5CHVC 4K7WA 2CJOA 1P3QU 2C7MB 1T0SC 1QLBB 3IAM1 4AS1A 2OJRA 3GE8C 4JWUC 2BGFA 5GXGB 5H92C 2K39A 1RAXA 2LRWA 2KD0A 4EEWA 3APFA 3DBLI 2FUG1 3APCA 2RR9A 3OAWA 4FN2A 4N58A 3NZTA 3LVVA 3MHSD 4GLSC 1FXTB 1L6UA 4RGOS 2HJ1A 3H7SA 3SD5A 2KAJA 3AE8B 1DOXA 4LNIA 3RNFC 2OHFA 1K51A 4USAA 2QIEB 1QK1A 3AB5A 3AE6B 4M0WA 2MBQA 3PGEA 1FXIA 3UIOB 2M19A 2GOWA 1Y56A 2EELA 1NEKB 2DX5B 1EF1A 2KVRA 3C0RB 4G3XB 4NAWA 4AJWA 3FC4A 1WGHA 4KSLC 1N63A 3HVDA 2NVUI 2Z8LA 4MH8A 1YJ1A 2KC1A 3VR8B 1SF0A 3DRBA 1NDDA 1AN8A 1TT5B 1D6EC 2WS3B 1N62A 1TKYA 3KLSX 1BG0A 3ZO5B 3JU5A 4L23A 4B0MA 2C60A 4MSMB 3L08A 4FLHA 3ZRFA 2D3GA 2O6VB 2MJEA 3PRZA 1GC6A 4EZKA 3DHIC 2FE8A 3M95A 1OEYA 2RMMA 4DWFA 1JROA 3NG0A 4IWPA 2EMSA 3ETRA 4HDQA 3Q2AC 2D3BA 1F2RC 3TMPB 3DWGC 1SJHD 1AW7A 2IZVB 1HA5A 3R3MA 2PEAA 4C4VB 4HPPA 3K9OB 1UBQA 1XCTL 4NPNA 2J0JA 3QHTA 1C76A 3V60A 3IVFA 2N1VA 5GMVA 1WMHA 4NJ7A 2M8SA 4FHKA 3UI3A 1VZ7A 4ASWC 3B1LX 1WX9A 3ZXVA 1J7BA 5AZHA 1GB4A 1WXVA 1ET6A 2ACZB 2L0FA 3VVWB 1SIFA 3DVGY 4XE0A 4ZYNA 3HM3A 3PLVA 3Q8AA 1FCCC 3PSEB 4ZDVA 1EF5A 2KDFB 2JSVX 3UF8A 1JWAD 3DBRI 3HRDD 1Z2MA 3P63A 2GWDA 2GBMA 2LXAA 4XDCA 5HHDG 3L0WB 1JALA 3P4PB 3W5VB 4P6VF 4LJPB 1CZPA 2PJHA 3S2AA 4BVUC 4RF6A 2B3AA 4KIKB 3NUHB 3MFGA 2RPQA 4RF1A 1I4XA 3VR9B 4TV3A 3KUZA 3DVNV 4W9LA 1LM8B 2LGXA 5IP4D 1SJED 1XLNA 2WDRB 4RGTA 3W5UB 3H9DA 3NZSA 4Z9MA 2XN9C 1SEBD 4XDDA 1YN4A 2MA9B 1WF9A 2IDYA 2NTTA 2QHOA 3FKYA 2ICIA 4W9JA 2KACA 4N6EB 2GBJA 1UNSA 2KMMA 2MLBA 4IC7B 3FAHA 1FNUA 4E3CA 3NVYA 4EUTA 3MP9A 1R8GA 1OQRA 4C4VA 4A8XC 2KWCA 4M02A 2MP2B 4HKQA 2CU3A 3JSVA 5IOIA 4WURA 1WR1A 2J42A 2IBIB 1LFDA 1RM6C 4I6LB 1F2RI 1F9JA 4FADA 1YIWA 1WGDA 1WMHB 2D11A 3IG5A 4WWOA 2FNJB 4EFOA 3AE1B 2N9KA 1V81A 3W1YA 5LXHA 4PS7A 3NJTA 2GB1A 1YD8U 4NY0A 2D10A 3J9CA 1TY2A 1ZPSA 4F7ZA 1HEZE 3E56A 2INDC 5C2TB 4WWMA 5BMGA 1WJ6A 1C78A 2DYBA 3FILB 3PRMB 1KJTA 3IT4B 1UGMA 2LRUA 2KX3A 4LK0M 3PVLA 5FK9C 3R8BA 1H8CA 4RMAA 5CHFA 4MELA 3VUXA 1LQBA 2V1YA 2RSUA 1ZUD2 2C9WB 2L3ZA 1XEEA 4ICVA 3W1SA 3H8HA 1E7VA 3A9KA 2ZEQA 2D3AA 4CHKA 3GS2A 5J17A 2CJNA 1RFKA 2Z0EB 3NY5A 1MI0A 4EZLA 2M1MA 1D4BA 4Q2RA 1E8YA 3Q8FA 2KJRA 3RI7C 2C7HA 2BKFA 2HDEA 2KZRA 2E6XA 1PUTA 2LI5A 2D32A 1N60A 2QILA 2V3NA 3JPZA 4IWQA 1L4ZB 2N9XA 1JW9D 1J7CA 1SB3C 1OGWA 1ZE3D 4IDIA 2KLCA 1FIQA 2RPVA 4RNAA 1SE2A 2N7EA 2RGFA 3FILA 2G45B 1QZEA 4MM3A 4EZJA 1Q0WB 4TQ1A 5EE0A 4NJ6A 3BVZA 4RGNA 4OZCA 2LXCA 1XXGA 4BOSC 2FIDA 4W9DA 3SEBA 2CU1A 2O6VD 1UD7A 4GXBA 2MRPA 4MACA 3A9KB 2JYTA 2BB6A 5H8YE 2D5GA 3O13A 3I9V1 2REXA 1IBXB 3N30A 2JY6A 3SFEB 3I57A 2M17A 2XNAC 4KGTA 5JHBA 1NVID 3ZTDA 1C9FA 2IO3B 2JX5A 2DBYA 3L17A 3B2GA 1F0ZA 3VTWA 2LASA 2KANA 4M00A 2WDQB 2IO2B 3VDZA 5D7GA 2LUEA 1FFVA 2KVZA 3AULA 3V61A 3HUIA 3MJWA 1T5XD 4XGAB 1WXMA 3UQBA 5C23A 3TBLD 3V3XA 1PGBA 2KFJA 2KN5A 4ARIA 2DAJA 2WDTB 4ICUA 2QDFA 5J9AA 4MT5A 4LTUA 3ZJUA 1MG8A 4N59A 2JZ3B 4FBJB 2ASQA 2ONQA 3RT3B 2CR5A 4C00A 5CTRC 4ITKA 2LGDA 2M0XA 3T8MA 3N1YC 2PMVA 2NBWB 4C56C 1FPYA 4RM9A 2ZPNA 5E6PA 2IPKD 2KTRB 4A20A 2FCNA 2LJ5A 5E6NA 2W9NA 2LGIA 4GW0A 1WYWB 1P0RA 1BUIC 1M15A 4ZRJA 1EU3A 1GOZA 4G11A 3IG3A 2N9PC 3DBRB 2JPHA 4IUMB 3T9LA 2DZKA 2A4ZA 2LMCA 1MFWA 2X8XX 5CX3A 4JWSC 1XLQA 1YN5A 1V4GA 2KWUB 2BW2A 2KDIA 2ZCCA 4HWIB 3N1ZC 2DZIA 2SEBD 5G5GA 1TTNA 2VZKD 1L0XB 5E6JA 1Q1OA 3KVFB 2UWQA 2G9HD 4LNOA 2BYEA 2R61A 3L13A 2XK5A 1I0EA 4PYUA 3Q69A 2N0SB 1C4CA 1YNTE 1FD6A 3IHPC 1E7UA 2B76B 3ALBA 2WWZA 1C1YB 1GG3A 1V80A 4US9A 3U30A 1NBFC 1EU4A 4IW0A 1WRDB 2KYWA 2PE6B 3ZIMA 2W3SA 2YEPB 4GW2A 1STEA 3AEAB 4A3OA 3RCZA 4RF8A 2J0MA 1BMLC 1V6EA 2WGSA 4PK1A 1WGGA 4A55A 3BVMA 3GZNB 1E0ZA 2YVCA 1EO6A 1A70A 2INPE 2FCMA 3PZDA 3DPDA 2BWFA 2JT4B 4DHZB 3HVZA 4J6IA 2PPHA 1C3TA 2GLSA 3KWLA 3NOBA 1J7AA 3ZUNA 4BAXA 4ZRIA 3AE4B 1YJIA 3KUCB 3RNEC 2WXNA 3RULA 2L7RA 3A9JA 3JQ3A 1YQ4B 3AE5B 1WX8A 3V05A 2MJDA 3VH4B 2NR2A 4KIKA 2OEDA 2WXHA 2JZZA 4KKJA 4IM2A 1HXYD 3ONSA 2ZNVC 3LXFA 4ANXA 5TR5A 4P1CC 5J2RA 3TJPA 4K7UA 4S17A 5D3DA 4BKTA 4BOZB 1G0WA 2AYOB 3R66C 2K0PA 4L2YA 3RNGC 2RD0A 1WH3A 1ISNA 3BK1A 1MVKA 1V9JA 2KFKB 1BT0A 5TSSA 3HIZA 2PLPA 1J0GA 5D6JB 2ZVOA 4BG4B 4RFBA 4NAWB 5JZEB 3MC8A 3CIRB 1L0YB 3WIMA 1R7SA 1YN3A 3K9PB 4ANWA 2CHWA 1JWBD 5BMIA 3PZ8A 3DBLB 2K1FA 3DBHB 1MHHE 2JUOA 3GB1A 3A9JB 3PS6A 3ECIA 4LLGM 1CK1A 1FFUA 3EGRA 4ACFA 2LVQA 3AE9B 4AQ7A 1DYQA 2PW9A 4BKSD 4KSKC 4MGZE 5L95C 3W9CB 1TZ1A 1C4PA 3Q3NC 3H7PA 4NZLB 3JU6A 4HLEA 2N1WA 1KH0A 4YL8A 2JWZA 2C7NB 4AP4C 1ACCA 2G4SA 3CSFA 4GDKA 4R3DA 2X38A 2WLBA 2PVGC 4MGYE 3V6CB 1C77A 2J53A 2BYVE 1P7FA 1YJJA 3SFDB 4ANUA 1FM0D 3EA6A 1F1HA 4DHJB 3JSVB 3DBHI 3V6EB 1OQYA 3P4QB 1V1PB 3IG8A 3TEXA 4FA6A 3DREA 3QA8A 1Q5WB 3DQVA 1SE4A 1ZXIA 5DPTA 2IYDB 3TL5A 4M0WB 1KM7A 3BYYB 4MJSA 4ZOHC 2MCNB 1WZ3A 2BWES 4A90A 2PKOA 4EKUA 1QKZA 1C4AA 4TSSA 1VD2A 1TT4A 1U6RA 1WZ0A 2EKEC 2ZPYA 1PGXA 4ARCA 4D2KA 1R4MB 1K50A 2BS3B 3CSTA 3HK0A 3ZVVA 3EECA 2IY1B 1V1OA 1D3ZA 4FXCA 3WCQA 1NYQA 2DHZA 2KOXA 3RNBC 3L4PA 2WXKA 2KWVB 1WGYA 3L54A 4XYCA 1P9DU 4W9IA 1N6ZA 4RH6A 3NRZA 3VTUA 1JQ4A 1RYJA 3MJ5A 2JRHA 2L05A 2FAZA 1GUAB 2KQSA 2HD5B 1WWTA 3C8YA 4W9FA 4DXAB 4RF0A 3R7RA 4WIPA 4H2AA 4DXGA 4QAYA 3NVZA 1T3QA 1TGZB 3U4EG 4C80A 2JU6X 2WHIA 2BPSA 3AN1A 4K7SA 4HK2A 3QIJA 1LXDA 4ANVA 2GRIA 3RPFC 3M3JA 1N5WA 2GI9A 3VH3B 4GDKB 5G5HA 3M62B 4UDUC 2D2QA 2H88B 3T3NA 3V62A 4AUQC 4YXDB 3QARA 3AI5A 2KC2A 2R2OA 3B9JA 4HKZE 1GPXA 2DYMA 1TS2A 1JCKB 2KMAA 3QQ8B 1V1PA 1GAQB 1WIAA 1UGJA 4KX6B 2BBCA 1ET9A 2YLMA 2LZ6A 1L4DB 2DZJA 5BYRA 3N3KB 4L1BA 4HCNB 3L2EA 2IGDA 4HPMB 4BZAA 3QWZB 2W3RA 1ESFA 5AUKA 4E74A 1S3SG 2V9HA 1RRBA 5KHQA 3TIXA 3HHMA 4YTMB 2WDVB 1XT9B 3UINB 2KQ7A 1PFDA 1WM2A 2LEKA 2IY0B 1VRAB 2MH7A 5LNK1 3B2FA 1QILA 1QOFA 5JHAA 3X0WA 3P42A 1RLFA 2NS5A 1OQQA 3X23A 2L1AA 2QSDA 5BYQA 4GVYA 2N9EB 2G3QB 1YQBA 3QK0A 1WFYA 1HZ6A 4PS3A 3LDZE 4ZHOA 2LGSA 3ZNHB 4TUUA 3T3OA 5G55A 2WYQA 4RGMA 4OW0A 2K8BA 3VQIA 2N7DA 1JWUD 2GMIC 2NBUA 4DK5A 1P7EA 4XWTA 1TBEA 2AQ2B 2OOBB 3IFWB 3AU5A 3PHXB 3AEGB 2ON8A 4YTPB 2O6VA 3M10A 1XF5L 1JRUA 4RCOA 1QT9A 1FRDA 1JWSD 1GC7A 3BINA 1MJDA 4K81A 3P1MA 2A5UA 3LYYA 5FKAC 2LHEA 2BS4B 3U7DA 2Z0DB 4WJNA 1TKGA 4G50A 2BS2B 5JH5C 3RUIB 3P2BA 2MBEA 1CMXB 4B9KA 5G2NA 4KGRA 2W82A 5EE3A 1WY8A 2BYTA 2V3PA 1T0RC 4XX5A 4LDTD 4AJYB 4GDLA 1JWMD 2DNFA 3VFKA 5AZGA 4HROA 4K1RB 2N4FA 1QQRA 2K8CA 2KHWB 4C7YA 1IBXA 2FCQA 4JQWC 4HDOA 2CHZA 4GIVA 4W9HA 4PT5A 2MHJA 1UWMA 1P1AA 3GOEA 5L83A 1KRHA 1OTRB 2CS4A 1A5RA 4YSZB 4RF7A 3Q14C 4HJGE 4HVBA 1WYGA 3WA0A 4P7IA 4DQOC 1FEHA 2VH2A 3BYTB 2L8JA 1DOYA 1WXAA 3I63C 1XLOA 1NI3A 1CQVA 2GWCA 3A33B 2IGHA 4M01A 1IGCA 3Q8EA 4RM8A 1V5TA 3B6RA 2LWPA 3UQAA 3TCAA 1IUEA 2IO1B 2RDHA 3OLMD 1N61A 4KV2A 4MJSB 1VJKA 4WQMA 1WE6A 4W9KA 1L0VB 1YX6B 1HTQA 4GVZA 5AZFA 2K9XA 3VRAB 4TKNA 1QH4A 2L32A 4P16A 1UUPA 4X57B 3WAMA 2BT6A 1D5ZC 4ZRKA 2KMCA 3GE3C 3ZDMC 2QMTA 5BO4B 1ZDXA 3WALA 2N7JA 2INCC 1KLVA 4KZCA 4OVZA 3ZLZA 2ZCBA 2WX1A 3DVNU 3Q3FA 1XD3B 2WXOA 3Q3MC 1E7PB 1ZW7A 3BZDB 2BYFA 2PTLA 3ZNGC 3BWUD 1UF0A 4G0NB 5J99A 1SE9A 4BHLA 4I6PA 3JVZX 1WI0A 5E6OA 3RD2A 5FR3A 2GBNA 1D5XC 1UELA 2WXFA 2RDBC 4FJVB 4W9CA 3DOWA 3A1QB 1V2YA 2R2QA 3CMMB 3DDCB 3MHZA 2NPTA 1SIJA 3AE2B 3KUDB 2LUMA 2INNE 1WSPA 1L7YA 2WU2B 3QJZA 4URKA 1MG4A 1K8RB 1GB1A 3PV1A 4YT0B 4C7ZA 2K22A 4GOCA 4K3BA 1YQ3B 2ZZPB 2FBWB 3IT6B 2NCNA 3CWIA 1NI2A 3ABVB 2CKHB 3PREA 1IYFA 3PTFC 1NYRA 3RYTA 5LLIA 3WANA 1HZ5A 1LGRA 2L52A 3ZXRA 3AEDB 4LJOB 4IM3A 3ZW3A 1MPEA 2KXJA 4LDTB 1E5WA 1XCQL 4HEA1 2KX0A 1CRKA 5I4DA 4LNNA 2MJ3A 4MM3B 3SDLC 2H89B 3N9YC 3ENEA 5BMHA 4A6QA 3H7PB 1K52A 4ZYSA 3AE7B 4JIOU 1SD0A 1WXQA 1EWYC 2ZW1A 1OEYJ 2BQQA 4JL9A 2EMTA 2WXPA 2JXTA 1WE7A 4OVUA 2DLBA 3KYDD 1V97A 4CQNA 2M0AA 3IBEA 2VH1A 3Q6BA 1KTKA 3Q3OC 1JRPA 2ZJDA 1FCLA 4MH0E 2JWUA 3OG5A 2I38A 1E90A 3BK2A 1E8XA 4Q2JA 2WX0A 2KK8A 4HCPB 3ZNZB 1UZXB 2K5PA 2MSED 3NZ3A 1YMHE 4KDIC 1IPGA 4KGSA 3IXSA 1WXSA 5HG2A 1FXAA 5IAAC 4LNKA 4NQKE 1WRIA 1E9MA 2O2VA 4XZ4A 4MGKE 1ROEA 2K8HA 3PO0A 3RN9C 2O2VB 4IM0A 2HE7A 4YWGG 1V49A 5KHOA 4GB9A 2SAKA 3LVWA 1IP9A 4YSYB 4ZHPA 5EE1A 1ZXHA 3RZWC 1UBIA 3ZQ4A 4DDGD 2WXMA 3SU8X 1I4GA 2KDBA 3B0AA 4MEMA 1L2NA 3IAS1 3TSSA 2YEPF 3LN6A 1TS3A 3TEYA 1D5MC 4NNJB 3VUWA 1WJUA 1VZ6A 4LNFA 3A4SC 3JW0X 4DDID 2MQJA 1FNWA 3AE3B 4RF9A 1RWSA 2J52A 1EUVB 2LGYA 2AEHA 3EFCA 2M4NA 1N5XA 2KTRA 4A3PA 4F8CB
chains in the Genus database with same CATH topology
2D3BA 4LNFA 4LNKA 1R8GA 1HTOA 3LVVA 2D33A 4S0RA 2WHIA 4LNNA 1V4GA 3ZXVA 2GWDA 3NZTA 2OJWA 4HPPA 2QC8A 2D32A 2GLSA 2UU7A 2BVCA 1F1HA 4XYCA 3LN7A 4LNIA 2D3AA 2LGSA 1LGRA 2WGSA 3FKYA 3LVWA 3IG8A 2D3CA 3IG5A 1VA6A 4BAXA 3NG0A 2GWCA 3ZXRA 1HTQA 3LN6A 1TT4A 1FPYA 4LNOA 1F52A 4ACFA 4S17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3B A;  4LNF A;  4LNK A;  1HTO A;  4S0R A;  2WHI A;  4LNN A;  3ZXV A;  2OJW A;  4HPP A;  2QC8 A;  2GLS A;  2UU7 A;  2BVC A;  1F1H A;  4XYC A;  4LNI A;  2D3A A;  2LGS A;  1LGR A;  2WGS A;  3FKY A;  2D3C A;  4BAX A;  3NG0 A;  3ZXR A;  1HTQ A;  1FPY A;  4LNO A;  1F52 A;  4ACF A;  4S17 A; 
#chains in the Genus database with same CATH topology
 1ZP0 B;  2RDG A;  2LVO A;  2FUH B;  3AMZ A;  4TQ0 A;  4HRS A;  2KJ6 A;  2W55 A;  1VCB A;  5FR6 A;  1WGR A;  1KF6 B;  2L76 A;  3KH0 A;  4HJK A;  3SR6 A;  3QC8 B;  3RMK C;  2KNB A;  1B9R A;  3L2D A;  1QF6 A;  2J0K A;  3P4S B;  2G4D B;  2QEJ C;  3PZ7 A;  3DCG A;  2WQY B;  3A1Q A;  2K25 A;  3C19 A;  4LCD E;  2WXG A;  4FJY A;  2QJL A;  3AH7 A;  2KDM A;  1GJZ A;  3DHH C;  3QX1 A;  4OZA A;  3NZU A;  5DPW A;  4WAF A;  1P98 A;  1QOA A;  1WGK A;  1Q10 A;  4CYE A;  3VAW A;  4F1S A;  1ZOY B;  3P4R B;  3EUB 2;  1HE8 A;  2KDE B;  3EFU A;  1WM3 A;  1YX5 B;  2UYZ B;  3EHV A;  5DPR A;  2JXX A;  3ZRC A;  3ZTC A;  2MBB B;  2JRI B;  3PLU A;  1SSN A;  1DOI A;  1YOV B;  3PPA A;  2AQ1 B;  2MW5 A;  4XC2 A;  4IOI E;  2D07 B;  1EM7 A;  3NHE B;  2KN4 A;  2V4I B;  4N9F 4;  2EKI A;  1QOG A;  5DCN A;  1X1M A;  3H1U A;  1FRR A;  4JGH B;  2LD9 A;  2D3C A;  4KVG B;  1M94 A;  4ZRP A;  4EE2 A;  5AEK B;  2WNM A;  2DYO A;  1JML A;  3NVV A;  4REZ A;  1VLB A;  1F52 A;  2AQ3 B;  2BB5 A;  1S1Q B;  1K53 A;  2HJ8 A;  2V3S A;  3JYU A;  2M56 B;  1I4R A;  4DBG A;  4GMV A;  1T0Y A;  2BVC A;  3LN7 A;  1TKE A;  4BKG A;  2MBO A;  2I1J A;  5HI1 A;  2K3U A;  2CRK A;  3AEC B;  5D3I B;  2WXJ A;  3H6N A;  2GBR A;  1OFF A;  3ML9 A;  1TIF A;  3N32 A;  3DHG C;  2Q5W D;  2Y5C A;  5EDS A;  1P50 A;  4BFR A;  2OJW A;  2JZP A;  3KYC D;  4W9E A;  2AX5 A;  3R2I A;  3NS8 A;  2Z59 B;  5T8I A;  4OHJ A;  3D32 A;  3TEW A;  1AWD A;  1H4R A;  2GBK A;  1E10 A;  1ENF A;  3AEE B;  2WP9 B;  1PDX A;  2XEW A;  4YTN B;  4BBN F;  1HTO A;  4K3C A;  3DVG X;  5J18 A;  3ZGZ A;  5MPO A;  1V8C A;  1AAR A;  5D94 A;  3L10 B;  3KW5 B;  3RNC C;  4WJQ A;  1WJN A;  2UU7 A;  2V4L A;  1EWC A;  3VRB B;  4WWN A;  4JLC A;  2JYE A;  4EOY A;  3ZJT A;  3RNA C;  4GSW A;  2LHD A;  4TMA B;  4WJP A;  1PGA A;  1U4A A;  5EE9 A;  3U2S C;  1T0Q C;  1WR6 E;  1RFA A;  4GN1 A;  2HTM E;  3KQ4 A;  3OJ3 A;  3NVW A;  2HTH A;  1FNV A;  3Q8B A;  1FMA D;  4DXF A;  4YSX B;  1I42 A;  1E6E B;  3HM6 X;  2DAF A;  3VTV A;  4MSQ B;  1E8W A;  3ZDT A;  1ZDV A;  4XWW A;  2DZM A;  2Y5B B;  5CHW A;  2Y3A A;  3URY A;  4B95 A;  3PT2 B;  2D33 A;  2TSS A;  2FCS A;  1TYG B;  4NJC A;  4DHZ E;  1M4V A;  2KTF A;  4P1B C;  3AEB B;  2ZNV B;  4HPL B;  5DPS A;  4B0E A;  3GZN I;  3OJ4 B;  3ZJV A;  1T6B X;  4NAM A;  5JXV A;  2J1Q A;  3AEF B;  2KQ4 X;  3TUO A;  3LJ3 A;  2CHX A;  3UGB B;  1RL9 A;  4CO7 A;  1KLG D;  2IO0 B;  2KWD A;  3A4R A;  3VHT C;  2KKC A;  5C3J B;  4FJZ A;  1VZ8 A;  2JQR B;  4S0R A;  4GDL B;  3BY4 B;  3DBS A;  4IKG A;  3ML8 A;  4ZRQ A;  2JVC A;  2E3T A;  4JE3 B;  2IGG A;  2WXI A;  1R4M I;  2QC8 A;  3DWM A;  1XLP A;  3B08 A;  4A9A A;  1TS4 A;  3AXC A;  3VUY A;  4JPS A;  3QCA A;  2XBB C;  4M8N A;  2L83 A;  4DHJ D;  1Z5S B;  2WXQ A;  2ZW0 A;  3Q3J A;  4MDK E;  3U8Z A;  3Q8C A;  3GP7 A;  1SE3 A;  2AL6 A;  3ZNI D;  4O1N A;  1MHX A;  2MEK A;  2PVO D;  2MX2 A;  1KLU D;  4WJO A;  4W9G A;  1CJE A;  5LXI B;  4GU2 A;  3UIP B;  3L2E B;  1IGD A;  1QOB A;  1WX7 A;  2J4X A;  3W1S C;  1KOT A;  1VRP A;  4KZ0 A;  4I6N B;  4US8 A;  2I1K A;  1B1Z A;  3AV8 A;  3I3T B;  1I7H A;  1AYF A;  1TZO A;  4BKS A;  5IKC M;  1SGH A;  2KFK A;  4IWO A;  2QCZ A;  2W54 A;  3KWV A;  3AU4 A;  1G6J A;  2Y5P A;  1ZGU B;  3BII D;  4WAA A;  3MTN B;  3QAQ A;  1NEN B;  1PQS A;  2C5L C;  1L6V A;  2KJH B;  1J19 A;  1R4N I;  1KFY B;  1V86 A;  2IJ0 A;  4WQO B;  2BKR B;  2I2Y A;  4FHJ A;  4M8M A;  2VRR B;  1DGJ A;  1V5O A;  4AWJ A;  4OVV A;  2K6D B;  1FO4 A;  1P52 A;  2KT7 A;  1E8Z A;  1Y8R C;  2PIA A;  3RZF A;  4J3O D;  3WAO A;  5C1Z A;  1UWX A;  3N1X C;  2AWT A;  2ZVN A;  2L00 B;  1VA6 A;  2NTS A;  3MC9 A;  1I4P A;  3VXW A;  4BG4 A;  4FUL A;  4II2 B;  1LO5 D;  1UH6 A;  3M63 B;  4II3 B;  5IN7 A;  2WU5 B;  3I5J C;  4KDL B;  2NBV B;  4B6W A;  3OWE B;  1GNU A;  2LVP A;  2NPT B;  5AUI A;  1C79 A;  5BYS A;  3PRP B;  4PYZ A;  4KKI A;  4JX1 C;  2G1E A;  4PS8 A;  4WWP A;  2DWQ A;  3EC8 A;  2K6Q A;  2VZK B;  3WAP A;  2WXL A;  2V0G A;  3R7Q A;  3ZKJ C;  2J7Q B;  3LB8 C;  3U52 E;  1XO3 A;  3PHW B;  2L0T A;  2MWS B;  1R4N B;  2PE9 A;  2XK5 B;  1ZKH A;  1I4H A;  2FIF A;  4E71 A;  4NQL B;  1XQQ A;  1TS5 A;  3MC0 B;  2KO3 A;  5HKH A;  5IA7 A;  3CF6 E;  1BXT A;  1J8C A;  1SXT A;  2N9L A;  4OZB A;  5D2M B;  2NMQ A;  4GGQ A;  1L5P A;  2MBH A;  3W2D A;  4IG7 B;  3TEZ A;  5HFY A;  3E9S A;  3APD A;  3AM9 A;  1I35 A;  3R2T A;  2WXR A;  2KLG A;  1PYW D;  5IO9 A;  4AOF A;  4AM1 A;  1HQR D;  2BTE A;  3O65 B;  3BVG A;  1WJ4 A;  2LJI A;  4WH4 A;  2JF5 A;  4HXD A;  2MP2 A;  3U7Z A;  1I4Q A;  3N20 C;  4MGI E;  1VR9 A;  4BBN C;  2LFI A;  2AL3 A;  1VDV A;  3SHQ A;  2BF8 B;  2DEN B;  1TJE A;  1SBB B;  3NS1 A;  3L16 A;  1F77 A;  3ZYY X;  3RFZ B;  1TY0 A;  5CHV C;  4K7W A;  2CJO A;  1P3Q U;  2C7M B;  1T0S C;  1QLB B;  3IAM 1;  4AS1 A;  2OJR A;  3GE8 C;  4JWU C;  2BGF A;  5GXG B;  5H92 C;  2K39 A;  1RAX A;  2LRW A;  2KD0 A;  4EEW A;  3APF A;  3DBL I;  2FUG 1;  3APC A;  2RR9 A;  3OAW A;  4FN2 A;  4N58 A;  3NZT A;  3LVV A;  3MHS D;  4GLS C;  1FXT B;  1L6U A;  4RGO S;  2HJ1 A;  3H7S A;  3SD5 A;  2KAJ A;  3AE8 B;  1DOX A;  4LNI A;  3RNF C;  2OHF A;  1K51 A;  4USA A;  2QIE B;  1QK1 A;  3AB5 A;  3AE6 B;  4M0W A;  2MBQ A;  3PGE A;  1FXI A;  3UIO B;  2M19 A;  2GOW A;  1Y56 A;  2EEL A;  1NEK B;  2DX5 B;  1EF1 A;  2KVR A;  3C0R B;  4G3X B;  4NAW A;  4AJW A;  3FC4 A;  1WGH A;  4KSL C;  1N63 A;  3HVD A;  2NVU I;  2Z8L A;  4MH8 A;  1YJ1 A;  2KC1 A;  3VR8 B;  1SF0 A;  3DRB A;  1NDD A;  1AN8 A;  1TT5 B;  1D6E C;  2WS3 B;  1N62 A;  1TKY A;  3KLS X;  1BG0 A;  3ZO5 B;  3JU5 A;  4L23 A;  4B0M A;  2C60 A;  4MSM B;  3L08 A;  4FLH A;  3ZRF A;  2D3G A;  2O6V B;  2MJE A;  3PRZ A;  1GC6 A;  4EZK A;  3DHI C;  2FE8 A;  3M95 A;  1OEY A;  2RMM A;  4DWF A;  1JRO A;  3NG0 A;  4IWP A;  2EMS A;  3ETR A;  4HDQ A;  3Q2A C;  2D3B A;  1F2R C;  3TMP B;  3DWG C;  1SJH D;  1AW7 A;  2IZV B;  1HA5 A;  3R3M A;  2PEA A;  4C4V B;  4HPP A;  3K9O B;  1UBQ A;  1XCT L;  4NPN A;  2J0J A;  3QHT A;  1C76 A;  3V60 A;  3IVF A;  2N1V A;  5GMV A;  1WMH A;  4NJ7 A;  2M8S A;  4FHK A;  3UI3 A;  1VZ7 A;  4ASW C;  3B1L X;  1WX9 A;  3ZXV A;  1J7B A;  5AZH A;  1GB4 A;  1WXV A;  1ET6 A;  2ACZ B;  2L0F A;  3VVW B;  1SIF A;  3DVG Y;  4XE0 A;  4ZYN A;  3HM3 A;  3PLV A;  3Q8A A;  1FCC C;  3PSE B;  4ZDV A;  1EF5 A;  2KDF B;  2JSV X;  3UF8 A;  1JWA D;  3DBR I;  3HRD D;  1Z2M A;  3P63 A;  2GWD A;  2GBM A;  2LXA A;  4XDC A;  5HHD G;  3L0W B;  1JAL A;  3P4P B;  3W5V B;  4P6V F;  4LJP B;  1CZP A;  2PJH A;  3S2A A;  4BVU C;  4RF6 A;  2B3A A;  4KIK B;  3NUH B;  3MFG A;  2RPQ A;  4RF1 A;  1I4X A;  3VR9 B;  4TV3 A;  3KUZ A;  3DVN V;  4W9L A;  1LM8 B;  2LGX A;  5IP4 D;  1SJE D;  1XLN A;  2WDR B;  4RGT A;  3W5U B;  3H9D A;  3NZS A;  4Z9M A;  2XN9 C;  1SEB D;  4XDD A;  1YN4 A;  2MA9 B;  1WF9 A;  2IDY A;  2NTT A;  2QHO A;  3FKY A;  2ICI A;  4W9J A;  2KAC A;  4N6E B;  2GBJ A;  1UNS A;  2KMM A;  2MLB A;  4IC7 B;  3FAH A;  1FNU A;  4E3C A;  3NVY A;  4EUT A;  3MP9 A;  1R8G A;  1OQR A;  4C4V A;  4A8X C;  2KWC A;  4M02 A;  2MP2 B;  4HKQ A;  2CU3 A;  3JSV A;  5IOI A;  4WUR A;  1WR1 A;  2J42 A;  2IBI B;  1LFD A;  1RM6 C;  4I6L B;  1F2R I;  1F9J A;  4FAD A;  1YIW A;  1WGD A;  1WMH B;  2D11 A;  3IG5 A;  4WWO A;  2FNJ B;  4EFO A;  3AE1 B;  2N9K A;  1V81 A;  3W1Y A;  5LXH A;  4PS7 A;  3NJT A;  2GB1 A;  1YD8 U;  4NY0 A;  2D10 A;  3J9C A;  1TY2 A;  1ZPS A;  4F7Z A;  1HEZ E;  3E56 A;  2IND C;  5C2T B;  4WWM A;  5BMG A;  1WJ6 A;  1C78 A;  2DYB A;  3FIL B;  3PRM B;  1KJT A;  3IT4 B;  1UGM A;  2LRU A;  2KX3 A;  4LK0 M;  3PVL A;  5FK9 C;  3R8B A;  1H8C A;  4RMA A;  5CHF A;  4MEL A;  3VUX A;  1LQB A;  2V1Y A;  2RSU A;  1ZUD 2;  2C9W B;  2L3Z A;  1XEE A;  4ICV A;  3W1S A;  3H8H A;  1E7V A;  3A9K A;  2ZEQ A;  2D3A A;  4CHK A;  3GS2 A;  5J17 A;  2CJN A;  1RFK A;  2Z0E B;  3NY5 A;  1MI0 A;  4EZL A;  2M1M A;  1D4B A;  4Q2R A;  1E8Y A;  3Q8F A;  2KJR A;  3RI7 C;  2C7H A;  2BKF A;  2HDE A;  2KZR A;  2E6X A;  1PUT A;  2LI5 A;  2D32 A;  1N60 A;  2QIL A;  2V3N A;  3JPZ A;  4IWQ A;  1L4Z B;  2N9X A;  1JW9 D;  1J7C A;  1SB3 C;  1OGW A;  1ZE3 D;  4IDI A;  2KLC A;  1FIQ A;  2RPV A;  4RNA A;  1SE2 A;  2N7E A;  2RGF A;  3FIL A;  2G45 B;  1QZE A;  4MM3 A;  4EZJ A;  1Q0W B;  4TQ1 A;  5EE0 A;  4NJ6 A;  3BVZ A;  4RGN A;  4OZC A;  2LXC A;  1XXG A;  4BOS C;  2FID A;  4W9D A;  3SEB A;  2CU1 A;  2O6V D;  1UD7 A;  4GXB A;  2MRP A;  4MAC A;  3A9K B;  2JYT A;  2BB6 A;  5H8Y E;  2D5G A;  3O13 A;  3I9V 1;  2REX A;  1IBX B;  3N30 A;  2JY6 A;  3SFE B;  3I57 A;  2M17 A;  2XNA C;  4KGT A;  5JHB A;  1NVI D;  3ZTD A;  1C9F A;  2IO3 B;  2JX5 A;  2DBY A;  3L17 A;  3B2G A;  1F0Z A;  3VTW A;  2LAS A;  2KAN A;  4M00 A;  2WDQ B;  2IO2 B;  3VDZ A;  5D7G A;  2LUE A;  1FFV A;  2KVZ A;  3AUL A;  3V61 A;  3HUI A;  3MJW A;  1T5X D;  4XGA B;  1WXM A;  3UQB A;  5C23 A;  3TBL D;  3V3X A;  1PGB A;  2KFJ A;  2KN5 A;  4ARI A;  2DAJ A;  2WDT B;  4ICU A;  2QDF A;  5J9A A;  4MT5 A;  4LTU A;  3ZJU A;  1MG8 A;  4N59 A;  2JZ3 B;  4FBJ B;  2ASQ A;  2ONQ A;  3RT3 B;  2CR5 A;  4C00 A;  5CTR C;  4ITK A;  2LGD A;  2M0X A;  3T8M A;  3N1Y C;  2PMV A;  2NBW B;  4C56 C;  1FPY A;  4RM9 A;  2ZPN A;  5E6P A;  2IPK D;  2KTR B;  4A20 A;  2FCN A;  2LJ5 A;  5E6N A;  2W9N A;  2LGI A;  4GW0 A;  1WYW B;  1P0R A;  1BUI C;  1M15 A;  4ZRJ A;  1EU3 A;  1GOZ A;  4G11 A;  3IG3 A;  2N9P C;  3DBR B;  2JPH A;  4IUM B;  3T9L A;  2DZK A;  2A4Z A;  2LMC A;  1MFW A;  2X8X X;  5CX3 A;  4JWS C;  1XLQ A;  1YN5 A;  1V4G A;  2KWU B;  2BW2 A;  2KDI A;  2ZCC A;  4HWI B;  3N1Z C;  2DZI A;  2SEB D;  5G5G A;  1TTN A;  2VZK D;  1L0X B;  5E6J A;  1Q1O A;  3KVF B;  2UWQ A;  2G9H D;  4LNO A;  2BYE A;  2R61 A;  3L13 A;  2XK5 A;  1I0E A;  4PYU A;  3Q69 A;  2N0S B;  1C4C A;  1YNT E;  1FD6 A;  3IHP C;  1E7U A;  2B76 B;  3ALB A;  2WWZ A;  1C1Y B;  1GG3 A;  1V80 A;  4US9 A;  3U30 A;  1NBF C;  1EU4 A;  4IW0 A;  1WRD B;  2KYW A;  2PE6 B;  3ZIM A;  2W3S A;  2YEP B;  4GW2 A;  1STE A;  3AEA B;  4A3O A;  3RCZ A;  4RF8 A;  2J0M A;  1BML C;  1V6E A;  2WGS A;  4PK1 A;  1WGG A;  4A55 A;  3BVM A;  3GZN B;  1E0Z A;  2YVC A;  1EO6 A;  1A70 A;  2INP E;  2FCM A;  3PZD A;  3DPD A;  2BWF A;  2JT4 B;  4DHZ B;  3HVZ A;  4J6I A;  2PPH A;  1C3T A;  2GLS A;  3KWL A;  3NOB A;  1J7A A;  3ZUN A;  4BAX A;  4ZRI A;  3AE4 B;  1YJI A;  3KUC B;  3RNE C;  2WXN A;  3RUL A;  2L7R A;  3A9J A;  3JQ3 A;  1YQ4 B;  3AE5 B;  1WX8 A;  3V05 A;  2MJD A;  3VH4 B;  2NR2 A;  4KIK A;  2OED A;  2WXH A;  2JZZ A;  4KKJ A;  4IM2 A;  1HXY D;  3ONS A;  2ZNV C;  3LXF A;  4ANX A;  5TR5 A;  4P1C C;  5J2R A;  3TJP A;  4K7U A;  4S17 A;  5D3D A;  4BKT A;  4BOZ B;  1G0W A;  2AYO B;  3R66 C;  2K0P A;  4L2Y A;  3RNG C;  2RD0 A;  1WH3 A;  1ISN A;  3BK1 A;  1MVK A;  1V9J A;  2KFK B;  1BT0 A;  5TSS A;  3HIZ A;  2PLP A;  1J0G A;  5D6J B;  2ZVO A;  4BG4 B;  4RFB A;  4NAW B;  5JZE B;  3MC8 A;  3CIR B;  1L0Y B;  3WIM A;  1R7S A;  1YN3 A;  3K9P B;  4ANW A;  2CHW A;  1JWB D;  5BMI A;  3PZ8 A;  3DBL B;  2K1F A;  3DBH B;  1MHH E;  2JUO A;  3GB1 A;  3A9J B;  3PS6 A;  3ECI A;  4LLG M;  1CK1 A;  1FFU A;  3EGR A;  4ACF A;  2LVQ A;  3AE9 B;  4AQ7 A;  1DYQ A;  2PW9 A;  4BKS D;  4KSK C;  4MGZ E;  5L95 C;  3W9C B;  1TZ1 A;  1C4P A;  3Q3N C;  3H7P A;  4NZL B;  3JU6 A;  4HLE A;  2N1W A;  1KH0 A;  4YL8 A;  2JWZ A;  2C7N B;  4AP4 C;  1ACC A;  2G4S A;  3CSF A;  4GDK A;  4R3D A;  2X38 A;  2WLB A;  2PVG C;  4MGY E;  3V6C B;  1C77 A;  2J53 A;  2BYV E;  1P7F A;  1YJJ A;  3SFD B;  4ANU A;  1FM0 D;  3EA6 A;  1F1H A;  4DHJ B;  3JSV B;  3DBH I;  3V6E B;  1OQY A;  3P4Q B;  1V1P B;  3IG8 A;  3TEX A;  4FA6 A;  3DRE A;  3QA8 A;  1Q5W B;  3DQV A;  1SE4 A;  1ZXI A;  5DPT A;  2IYD B;  3TL5 A;  4M0W B;  1KM7 A;  3BYY B;  4MJS A;  4ZOH C;  2MCN B;  1WZ3 A;  2BWE S;  4A90 A;  2PKO A;  4EKU A;  1QKZ A;  1C4A A;  4TSS A;  1VD2 A;  1TT4 A;  1U6R A;  1WZ0 A;  2EKE C;  2ZPY A;  1PGX A;  4ARC A;  4D2K A;  1R4M B;  1K50 A;  2BS3 B;  3CST A;  3HK0 A;  3ZVV A;  3EEC A;  2IY1 B;  1V1O A;  1D3Z A;  4FXC A;  3WCQ A;  1NYQ A;  2DHZ A;  2KOX A;  3RNB C;  3L4P A;  2WXK A;  2KWV B;  1WGY A;  3L54 A;  4XYC A;  1P9D U;  4W9I A;  1N6Z A;  4RH6 A;  3NRZ A;  3VTU A;  1JQ4 A;  1RYJ A;  3MJ5 A;  2JRH A;  2L05 A;  2FAZ A;  1GUA B;  2KQS A;  2HD5 B;  1WWT A;  3C8Y A;  4W9F A;  4DXA B;  4RF0 A;  3R7R A;  4WIP A;  4H2A A;  4DXG A;  4QAY A;  3NVZ A;  1T3Q A;  1TGZ B;  3U4E G;  4C80 A;  2JU6 X;  2WHI A;  2BPS A;  3AN1 A;  4K7S A;  4HK2 A;  3QIJ A;  1LXD A;  4ANV A;  2GRI A;  3RPF C;  3M3J A;  1N5W A;  2GI9 A;  3VH3 B;  4GDK B;  5G5H A;  3M62 B;  4UDU C;  2D2Q A;  2H88 B;  3T3N A;  3V62 A;  4AUQ C;  4YXD B;  3QAR A;  3AI5 A;  2KC2 A;  2R2O A;  3B9J A;  4HKZ E;  1GPX A;  2DYM A;  1TS2 A;  1JCK B;  2KMA A;  3QQ8 B;  1V1P A;  1GAQ B;  1WIA A;  1UGJ A;  4KX6 B;  2BBC A;  1ET9 A;  2YLM A;  2LZ6 A;  1L4D B;  2DZJ A;  5BYR A;  3N3K B;  4L1B A;  4HCN B;  3L2E A;  2IGD A;  4HPM B;  4BZA A;  3QWZ B;  2W3R A;  1ESF A;  5AUK A;  4E74 A;  1S3S G;  2V9H A;  1RRB A;  5KHQ A;  3TIX A;  3HHM A;  4YTM B;  2WDV B;  1XT9 B;  3UIN B;  2KQ7 A;  1PFD A;  1WM2 A;  2LEK A;  2IY0 B;  1VRA B;  2MH7 A;  5LNK 1;  3B2F A;  1QIL A;  1QOF A;  5JHA A;  3X0W A;  3P42 A;  1RLF A;  2NS5 A;  1OQQ A;  3X23 A;  2L1A A;  2QSD A;  5BYQ A;  4GVY A;  2N9E B;  2G3Q B;  1YQB A;  3QK0 A;  1WFY A;  1HZ6 A;  4PS3 A;  3LDZ E;  4ZHO A;  2LGS A;  3ZNH B;  4TUU A;  3T3O A;  5G55 A;  2WYQ A;  4RGM A;  4OW0 A;  2K8B A;  3VQI A;  2N7D A;  1JWU D;  2GMI C;  2NBU A;  4DK5 A;  1P7E A;  4XWT A;  1TBE A;  2AQ2 B;  2OOB B;  3IFW B;  3AU5 A;  3PHX B;  3AEG B;  2ON8 A;  4YTP B;  2O6V A;  3M10 A;  1XF5 L;  1JRU A;  4RCO A;  1QT9 A;  1FRD A;  1JWS D;  1GC7 A;  3BIN A;  1MJD A;  4K81 A;  3P1M A;  2A5U A;  3LYY A;  5FKA C;  2LHE A;  2BS4 B;  3U7D A;  2Z0D B;  4WJN A;  1TKG A;  4G50 A;  2BS2 B;  5JH5 C;  3RUI B;  3P2B A;  2MBE A;  1CMX B;  4B9K A;  5G2N A;  4KGR A;  2W82 A;  5EE3 A;  1WY8 A;  2BYT A;  2V3P A;  1T0R C;  4XX5 A;  4LDT D;  4AJY B;  4GDL A;  1JWM D;  2DNF A;  3VFK A;  5AZG A;  4HRO A;  4K1R B;  2N4F A;  1QQR A;  2K8C A;  2KHW B;  4C7Y A;  1IBX A;  2FCQ A;  4JQW C;  4HDO A;  2CHZ A;  4GIV A;  4W9H A;  4PT5 A;  2MHJ A;  1UWM A;  1P1A A;  3GOE A;  5L83 A;  1KRH A;  1OTR B;  2CS4 A;  1A5R A;  4YSZ B;  4RF7 A;  3Q14 C;  4HJG E;  4HVB A;  1WYG A;  3WA0 A;  4P7I A;  4DQO C;  1FEH A;  2VH2 A;  3BYT B;  2L8J A;  1DOY A;  1WXA A;  3I63 C;  1XLO A;  1NI3 A;  1CQV A;  2GWC A;  3A33 B;  2IGH A;  4M01 A;  1IGC A;  3Q8E A;  4RM8 A;  1V5T A;  3B6R A;  2LWP A;  3UQA A;  3TCA A;  1IUE A;  2IO1 B;  2RDH A;  3OLM D;  1N61 A;  4KV2 A;  4MJS B;  1VJK A;  4WQM A;  1WE6 A;  4W9K A;  1L0V B;  1YX6 B;  1HTQ A;  4GVZ A;  5AZF A;  2K9X A;  3VRA B;  4TKN A;  1QH4 A;  2L32 A;  4P16 A;  1UUP A;  4X57 B;  3WAM A;  2BT6 A;  1D5Z C;  4ZRK A;  2KMC A;  3GE3 C;  3ZDM C;  2QMT A;  5BO4 B;  1ZDX A;  3WAL A;  2N7J A;  2INC C;  1KLV A;  4KZC A;  4OVZ A;  3ZLZ A;  2ZCB A;  2WX1 A;  3DVN U;  3Q3F A;  1XD3 B;  2WXO A;  3Q3M C;  1E7P B;  1ZW7 A;  3BZD B;  2BYF A;  2PTL A;  3ZNG C;  3BWU D;  1UF0 A;  4G0N B;  5J99 A;  1SE9 A;  4BHL A;  4I6P A;  3JVZ X;  1WI0 A;  5E6O A;  3RD2 A;  5FR3 A;  2GBN A;  1D5X C;  1UEL A;  2WXF A;  2RDB C;  4FJV B;  4W9C A;  3DOW A;  3A1Q B;  1V2Y A;  2R2Q A;  3CMM B;  3DDC B;  3MHZ A;  2NPT A;  1SIJ A;  3AE2 B;  3KUD B;  2LUM A;  2INN E;  1WSP A;  1L7Y A;  2WU2 B;  3QJZ A;  4URK A;  1MG4 A;  1K8R B;  1GB1 A;  3PV1 A;  4YT0 B;  4C7Z A;  2K22 A;  4GOC A;  4K3B A;  1YQ3 B;  2ZZP B;  2FBW B;  3IT6 B;  2NCN A;  3CWI A;  1NI2 A;  3ABV B;  2CKH B;  3PRE A;  1IYF A;  3PTF C;  1NYR A;  3RYT A;  5LLI A;  3WAN A;  1HZ5 A;  1LGR A;  2L52 A;  3ZXR A;  3AED B;  4LJO B;  4IM3 A;  3ZW3 A;  1MPE A;  2KXJ A;  4LDT B;  1E5W A;  1XCQ L;  4HEA 1;  2KX0 A;  1CRK A;  5I4D A;  4LNN A;  2MJ3 A;  4MM3 B;  3SDL C;  2H89 B;  3N9Y C;  3ENE A;  5BMH A;  4A6Q A;  3H7P B;  1K52 A;  4ZYS A;  3AE7 B;  4JIO U;  1SD0 A;  1WXQ A;  1EWY C;  2ZW1 A;  1OEY J;  2BQQ A;  4JL9 A;  2EMT A;  2WXP A;  2JXT A;  1WE7 A;  4OVU A;  2DLB A;  3KYD D;  1V97 A;  4CQN A;  2M0A A;  3IBE A;  2VH1 A;  3Q6B A;  1KTK A;  3Q3O C;  1JRP A;  2ZJD A;  1FCL A;  4MH0 E;  2JWU A;  3OG5 A;  2I38 A;  1E90 A;  3BK2 A;  1E8X A;  4Q2J A;  2WX0 A;  2KK8 A;  4HCP B;  3ZNZ B;  1UZX B;  2K5P A;  2MSE D;  3NZ3 A;  1YMH E;  4KDI C;  1IPG A;  4KGS A;  3IXS A;  1WXS A;  5HG2 A;  1FXA A;  5IAA C;  4LNK A;  4NQK E;  1WRI A;  1E9M A;  2O2V A;  4XZ4 A;  4MGK E;  1ROE A;  2K8H A;  3PO0 A;  3RN9 C;  2O2V B;  4IM0 A;  2HE7 A;  4YWG G;  1V49 A;  5KHO A;  4GB9 A;  2SAK A;  3LVW A;  1IP9 A;  4YSY B;  4ZHP A;  5EE1 A;  1ZXH A;  3RZW C;  1UBI A;  3ZQ4 A;  4DDG D;  2WXM A;  3SU8 X;  1I4G A;  2KDB A;  3B0A A;  4MEM A;  1L2N A;  3IAS 1;  3TSS A;  2YEP F;  3LN6 A;  1TS3 A;  3TEY A;  1D5M C;  4NNJ B;  3VUW A;  1WJU A;  1VZ6 A;  4LNF A;  3A4S C;  3JW0 X;  4DDI D;  2MQJ A;  1FNW A;  3AE3 B;  4RF9 A;  1RWS A;  2J52 A;  1EUV B;  2LGY A;  2AEH A;  3EFC A;  2M4N A;  1N5X A;  2KTR A;  4A3P A;  4F8C B; 
#chains in the Genus database with same CATH homology
 2D3B A;  4LNF A;  4LNK A;  1R8G A;  1HTO A;  3LVV A;  2D33 A;  4S0R A;  2WHI A;  4LNN A;  1V4G A;  3ZXV A;  2GWD A;  3NZT A;  2OJW A;  4HPP A;  2QC8 A;  2D32 A;  2GLS A;  2UU7 A;  2BVC A;  1F1H A;  4XYC A;  3LN7 A;  4LNI A;  2D3A A;  2LGS A;  1LGR A;  2WGS A;  3FKY A;  3LVW A;  3IG8 A;  2D3C A;  3IG5 A;  1VA6 A;  4BAX A;  3NG0 A;  2GWC A;  3ZXR A;  1HTQ A;  3LN6 A;  1TT4 A;  1FPY A;  4LNO A;  1F52 A;  4ACF A;  4S17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...