2UU7A

Crystal structure of apo glutamine synthetase from dog (canis familiaris)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
370
structure length
370
Chain Sequence
TSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKGVEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Crystal Structures of Mammalian Glutamine Synthetases Illustrate Substrate-Induced Conformational Changes and Provide Opportunities for Drug and Herbicide Design.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Ligase
total genus 112
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2uu7A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2uu7A02
1F52A 2WGSA 2QC8A 2UU7A 2LGSA 1LGRA 4LNFA 3FKYA 2BVCA 4S0RA 1F1HA 4LNOA 4LNNA 1HTOA 4LNKA 4XYCA 4S17A 2D3BA 1HTQA 3ZXVA 2D3CA 3NG0A 1FPYA 2D3AA 2WHIA 4HPPA 2OJWA 2GLSA 4ACFA 4BAXA 4LNIA 3ZXRA
chains in the Genus database with same CATH superfamily
3GP7A 4PS3A 2M0AA 2G45B 2JXTA 1PGXA 4B6WA 3Q69A 4HDOA 2ZPYA 1FIQA 3H7PB 3P4QB 3U4EG 1UBIA 4ANXA 2Y5PA 4BZAA 1U4AA 4FJYA 4ZOHC 4K3CA 2ZJDA 3T3OA 2Q5WD 4LDTD 3IG8A 2LXCA 4PS8A 3LVVA 4ARIA 2CU3A 1KFYB 2N9XA 4GIVA 1V6EA 2N9KA 3O13A 2WDQB 3P4PB 1WXAA 5JHAA 1LM8B 1WGHA 2E6XA 1FCCC 1WE6A 5JZEB 5IOIA 5G5HA 2GLSA 3RNCC 3MHZA 3VHTC 4P7IA 1Y8RC 4ZRQA 3UQBA 2W82A 1F77A 3C19A 3NS8A 4IC7B 2J7QB 4F1SA 2QIEB 2M4NA 1TKEA 1EU4A 1OFFA 3MTNB 4J3OD 3QC8B 1L6VA 1ENFA 1WRIA 2C5LC 2R61A 1E6EB 2N9LA 2XBBC 3UINB 4GB9A 2O6VA 4BAXA 2N9EB 3R7RA 2L0FA 2KK8A 4JPSA 3VTUA 5AUKA 2J42A 4A55A 4GW0A 3GZNB 2H88B 3A9JA 2JVCA 3RPFC 5D6JB 2HE7A 3Q3FA 3IG5A 1F2RI 1WXSA 2FAZA 2PTLA 4CO7A 4C00A 3P63A 2KMMA 4ZRJA 4BOZB 4TSSA 1T6BX 5FK9C 2K25A 5IA7A 2QEJC 5L95C 3HM3A 1YNTE 1TIFA 2OHFA 1SF0A 3IAM1 4BFRA 4J6IA 3X23A 2L52A 2AL6A 3AE4B 5LXIB 1WF9A 1EM7A 1VRAB 2MBEA 2FIFA 2I1KA 3AU4A 4LJOB 2IY1B 3CSFA 3AEEB 1F0ZA 2V4IB 3MC9A 4DXFA 1C4CA 4FADA 3WCQA 3Q2AC 4RF8A 3TSSA 3JVZX 3L2EA 4FBJB 4HPMB 4RNAA 2Z0DB 2M8SA 5KHOA 3L2EB 2BB6A 2V3SA 2D2QA 2PEAA 2JSVX 1RM6C 1BMLC 5J17A 4TV3A 2ICIA 5MPOA 1AW7A 4K1RB 1UELA 2QCZA 1SE4A 3ZJUA 2MH7A 1UF0A 4RCOA 2V9HA 3RYTA 2AWTA 3MFGA 1JCKB 4GOCA 2WXPA 5L83A 3NZ3A 3N1ZC 3DQVA 1QT9A 4EE2A 4AJYB 4IKGA 1T0RC 1FRDA 2IO1B 2WWZA 1R4MB 2MX2A 1C79A 4E3CA 3QAQA 3QX1A 1WYWB 2JXXA 1Y56A 3APFA 4C56C 3W1SC 4WWOA 1YX5B 1MI0A 1SE2A 3L0WB 2KOXA 2KMAA 2N7JA 4UDUC 4BKGA 1VLBA 3VAWA 1HE8A 1WZ0A 3VDZA 1TYGB 3OJ3A 1KF6B 1ZP0B 2WYQA 1G6JA 4KDLB 4N9F4 4E71A 3QK0A 4BHLA 1JWBD 3ZXVA 2WX0A 2N7EA 1C9FA 4L2YA 2K0PA 3ZJTA 3L10B 2W3RA 2CHZA 3ZO5B 3B08A 3C8YA 2KDMA 2CHXA 1E90A 2KLGA 1E8XA 4FXCA 3B1LX 3MHSD 2ZCCA 2NBUA 1GC6A 2XEWA 3JPZA 4DHJD 2EELA 1EU3A 3QWZB 1OEYJ 2KO3A 3EECA 5GXGB 2V0GA 2BTEA 2BYVE 3URYA 3W5UB 1N5WA 2W55A 1V97A 2GOWA 3GZNI 4HXDA 2JX5A 2MJEA 3FILB 1TJEA 2JRHA 4XYCA 2ACZB 1EWCA 2LRWA 2I38A 2K6DB 2WQYB 4KGSA 2MSED 3A1QA 2RPQA 1TS5A 1XT9B 2PKOA 3H7SA 4KDIC 4O1NA 3N30A 3KW5B 3PHWB 1TTNA 4WJOA 2JWUA 2W9NA 1F1HA 3IAS1 3L17A 5DCNA 2J4XA 1KTKA 3ZDMC 2LEKA 2LFIA 2NMQA 3TIXA 2O2VA 4ICUA 2QSDA 1TZOA 2I1JA 2KXJA 2BWFA 2LUMA 3NG0A 2O2VB 4RM9A 2ZCBA 1UD7A 4IOIE 2IJ0A 4WH4A 4W9IA 1CRKA 1WJUA 2NBWB 2IGGA 4URKA 2LHDA 3Q3NC 3Q8CA 3RZFA 3LN6A 4DHZB 1F2RC 2IDYA 3NS1A 4BBNC 4WJQA 1TS4A 2KVZA 3NZUA 1K51A 4IWPA 2LXAA 1EF1A 2M56B 3EC8A 3QJZA 3SEBA 3J9CA 3Q6BA 1VZ6A 1TKGA 2G1EA 5FR6A 2RSUA 5AZGA 3AE3B 1MFWA 4QAYA 3APCA 4ACFA 2INCC 2WU5B 2Y5CA 2E3TA 4JQWC 1R7SA 2JF5A 3KYDD 2KD0A 2XN9C 2K39A 2CHWA 1MVKA 2GBKA 4FJVB 3C0RB 1VRPA 2BVCA 1DOYA 1WGGA 1BG0A 1R4MI 2IPKD 1SB3C 1WGKA 2KT7A 3ZRCA 1WX9A 4JWSC 3U2SC 1HQRD 2M0XA 4US9A 3PSEB 3B9JA 3SU8X 2L1AA 4XZ4A 4NJ6A 2LGYA 2LGDA 2AQ3B 3ZGZA 1OEYA 4HPPA 2VH2A 3N3KB 2ZZPB 1TS3A 2HJ1A 4M8NA 2ZNVC 1WMHB 1YOVB 3A33B 2JYEA 3WAPA 4B9KA 3ONSA 4M0WA 2DZMA 1LGRA 3WIMA 1FO4A 5LNK1 5BMGA 3NVWA 3VUYA 4M0WB 5G2NA 1QZEA 3UGBB 4S17A 3DDCB 3MP9A 1L0YB 2RDGA 4ZRIA 3GE8C 4MDKE 2N4FA 1TY0A 3JSVA 1L5PA 4HJGE 4JE3B 1JALA 2FIDA 1SIFA 3RD2A 3KUZA 1IGCA 1L7YA 2WHIA 2DHZA 1XCTL 3JSVB 1EO6A 5T8IA 4LLGM 2UU7A 1GPXA 1SE3A 2KN4A 1WR6E 1UGJA 2KX3A 2MP2A 1STEA 2XK5A 3V60A 2HJ8A 1FNUA 2D3GA 3TBLD 1VDVA 2WXJA 4CYEA 3SD5A 2ZVOA 4KVGB 3NUHB 4WWPA 2AYOB 1TT4A 1GB4A 1IPGA 3VTWA 1E8ZA 1TBEA 1QF6A 1Q0WB 4KIKA 1C3TA 1Z5SB 2QDFA 1MJDA 2DLBA 3MC0B 4KIKB 3TEYA 5C2TB 3IVFA 2PVOD 1FNWA 4KZ0A 4AJWA 2QILA 3TMPB 4MH8A 2L7RA 1UH6A 3EFCA 4MJSA 3W2DA 1J7CA 5H8YE 4WJPA 2K6QA 2NPTA 1I4PA 2AX5A 4MT5A 2INPE 4MJSB 1SEBD 1HZ6A 2OJRA 1QOGA 3R8BA 4ZYSA 4MACA 3X0WA 1SIJA 3VUWA 1YMHE 4DDGD 2FE8A 1VZ7A 3JU5A 4ZHOA 3H6NA 1RAXA 1RLFA 2D07B 1FNVA 4GW2A 1E8WA 2R2OA 3AH7A 1ROEA 4MGIE 3UQAA 1HZ5A 3U30A 3R66C 1NBFC 2MLBA 1P7FA 1JROA 1Q1OA 2D3BA 4YSXB 2BBCA 4N6EB 2KHWB 3VRAB 3AE6B 4ARCA 3NZSA 1TT5B 1YN4A 3PRZA 1I4QA 4NQKE 2K5PA 2ZPNA 2CR5A 2LZ6A 2Z8LA 3AB5A 1J7AA 2HTHA 3R2TA 1FFUA 1V5TA 2D33A 2VZKB 3I57A 4W9CA 3T8MA 3HM6X 2LVQA 2WX1A 3AECB 1KLGD 1KLUD 4A6QA 2LRUA 3PZDA 2LD9A 2N1VA 2AQ1B 2KJRA 3ZKJC 1WJNA 1M4VA 2I2YA 4XGAB 3CF6E 2JZZA 5DPWA 1HTQA 2J53A 3TUOA 3LYYA 2K9XA 3ECIA 2OJWA 3BVZA 4HCNB 3AULA 3AEAB 3KH0A 1L4ZB 3ZNGC 1BXTA 2GBJA 3NZTA 1E7PB 3RCZA 1DGJA 3BVMA 3TL5A 2A5UA 3KUDB 1E10A 3BYTB 1DOXA 2IGHA 4HJKA 4XWTA 1K8RB 3L54A 5TSSA 2DYBA 1FXTB 5CHWA 4HRSA 4LNIA 3DREA 1XF5L 4LK0M 3BINA 4DBGA 2KWDA 2LWPA 4PYUA 4BKSA 2BKRB 4AQ7A 1WI0A 1UZXB 3M62B 3TEXA 4FA6A 2LVPA 2FCMA 3ENEA 4OZCA 2RGFA 2UYZB 1V80A 5BYRA 3ZUNA 2O6VB 4WIPA 3RT3B 4AOFA 5E6JA 1G0WA 3NY5A 2BF8B 3A9JB 5G5GA 2N1WA 2D5GA 2GMIC 3VXWA 1HXYD 4DQOC 1P0RA 2JY6A 2BS3B 2FUHB 3DOWA 4Q2JA 4R3DA 4CHKA 1XCQL 4AUQC 1P52A 2KQ7A 3WAOA 1Q10A 5G55A 1RFKA 4WAAA 2WDRB 4WURA 1QQRA 4P1CC 2KDEB 2EMSA 2D32A 3DVNV 3W9CB 4EUTA 1QOFA 3ABVB 4B0EA 2N9PC 2IGDA 2D11A 3BK1A 2W3SA 4KX6B 3M63B 1WRDB 3EUB2 2W54A 4NY0A 4K3BA 4II3B 4BG4A 1TY2A 4DHZE 2C60A 3ZXRA 4ZRPA 3VFKA 3PHXB 1V81A 1L4DB 1AN8A 3DBSA 4IWOA 1CQVA 1PYWD 2LGSA 1WJ4A 1RL9A 2RR9A 3PVLA 1XLOA 4FHJA 2KX0A 5EE3A 3PV1A 3HIZA 1CK1A 2V3PA 5C1ZA 1P9DU 1KM7A 2R2QA 3V3XA 1VA6A 2BYFA 4FHKA 2IO2B 5DPSA 4D2KA 3EGRA 3V61A 1WXVA 1OQRA 3W1YA 4A3OA 2M19A 3DCGA 1E7UA 2EKIA 1ZPSA 2LJIA 3Q8BA 3RNFC 4DXGA 4AM1A 4OVZA 2IO0B 2J1QA 3GB1A 4I6NB 4MGZE 4NQLB 4HPLB 3PS6A 1K50A 4L1BA 2OEDA 3ZNID 1V9JA 2JYTA 4RGMA 2CKHB 1E0ZA 1B1ZA 3LXFA 1YN5A 1KJTA 2BS4B 4W9LA 1TS2A 4AWJA 1A5RA 1XXGA 2KMCA 1E8YA 5AUIA 1YQ3B 4K7UA 3RN9C 2C9WB 2NR2A 1J19A 2REXA 1NEKB 1P98A 1YJ1A 2RPVA 2DYMA 4GN1A 4ITKA 3AE9B 3M95A 4C7ZA 2KTFA 1IP9A 3NJTA 4HEA1 4GLSC 4ZYNA 3P2BA 5IKCM 1OGWA 2FNJB 4YSYB 3I63C 4BBNF 2KACA 4ICVA 2LMCA 1GOZA 1EWYC 4PT5A 3VRBB 1MG4A 2KANA 4FLHA 4FULA 4JGHB 4GGQA 3N1XC 4LNFA 1V4GA 3JYUA 3MJ5A 4HK2A 4A90A 4NZLB 1V86A 4NJCA 2GI9A 4JX1C 1TZ1A 4MEMA 1K53A 3ZW3A 2LUEA 1DYQA 2L76A 1QOAA 4JL9A 4RMAA 4HKZE 1WY8A 1XLPA 3L08A 3CWIA 4W9FA 4W9HA 1AYFA 3BWUD 1L0VB 2JWZA 3A4SC 3TCAA 4ZRKA 3RNGC 2WXRA 1KH0A 3IXSA 3HUIA 1C4PA 2JT4B 4HVBA 1FPYA 1LFDA 3AE2B 3HHMA 1UBQA 3AEDB 1WH3A 3DRBA 3SFDB 3QA8A 3A1QB 4IUMB 1IGDA 3FKYA 1D6EC 3ZYYX 2IBIB 3WAMA 1QK1A 1YX6B 3AE7B 4TKNA 4G11A 1T0YA 1K52A 3BZDB 3K9OB 3KWLA 1GG3A 3OJ4B 2ZW1A 1GB1A 3P4RB 3ZLZA 2BYTA 3Q3MC 1SSNA 1FMAD 1JRUA 1AARA 2LJ5A 2YEPF 2K8BA 1JW9D 1SE9A 4GVZA 1UNSA 1ESFA 2D10A 3ALBA 3VQIA 1L6UA 1C77A 2BS2B 4A3PA 1ZOYB 1JWSD 1YJJA 3IHPC 4GVYA 2ZW0A 4ZDVA 1IBXA 2N0SB 3W1SA 5BO4B 4N58A 4US8A 2FCSA 2KWCA 3AI5A 3BY4B 4RGOS 1IBXB 1LQBA 1T3QA 2EKEC 5E6OA 2C7MB 2KJ6A 4S0RA 4RF9A 3P1MA 1GJZA 1JQ4A 3JW0X 4P6VF 4C4VA 4XDDA 2DZIA 5C23A 2KTRA 5J2RA 1S1QB 5D3IB 4C4VB 4A8XC 2KFKA 3NHEB 3Q3OC 2KTRB 1L2NA 4A20A 1I35A 3ZIMA 2UWQA 5E6PA 3SR6A 4OZAA 3AM9A 4K81A 1YIWA 1I4GA 4KGTA 1YD8U 3CMMB 2FCNA 1NENB 4MSQB 2RDBC 3ETRA 4HKQA 3AMZA 3Q8FA 3PZ7A 2J0MA 2GBNA 1E5WA 1R8GA 4LNKA 2ASQA 1XEEA 2C7NB 2CS4A 2PMVA 2D3CA 5D3DA 1QKZA 2RDHA 2WDVB 3OAWA 3Q14C 1SJHD 1TKYA 3RZWC 4YWGG 5EE9A 2MJ3A 2INDC 4ASWC 1P7EA 2MCNB 3P4SB 1V2YA 4MGKE 4IWQA 4LJPB 2G9HD 3UF8A 1D5XC 4KSKC 2LASA 2WLBA 4USAA 2MP2B 1C1YB 1MPEA 2VZKD 2CJOA 2K8CA 2JU6X 2XK5B 4NNJB 1ZXHA 2MA9B 4B95A 3RI7C 2L8JA 1FFVA 1RFAA 4NAWA 3UI3A 3BK2A 2BB5A 3DVNU 4EZKA 1M94A 3IT4B 4NAWB 4WWMA 5DPRA 4YL8A 2J0JA 4L23A 1QLBB 3KVFB 2FBWB 2DBYA 1ZXIA 2WDTB 3E9SA 3PT2B 3EHVA 2WXGA 5KHQA 3N32A 1HTOA 4JIOU 2M1MA 1T0SC 1V5OA 3DWGC 1PFDA 2NPTB 2XNAC 2GRIA 2KKCA 2MQJA 4AP4C 3I3TB 5JHBA 2L00B 1I4XA 3PTFC 2MBBB 3PREA 1MG8A 1I4HA 3AEBB 3OLMD 1S3SG 5D2MB 2LVOA 1NI3A 1C78A 4WJNA 4TUUA 4BKSD 2L83A 4DXAB 1A70A 4JLCA 1JRPA 1XLNA 1JMLA 4BKTA 1T5XD 4RGNA 2O6VD 4ANUA 4KKJA 5LLIA 2RMMA 3LB8C 5DPTA 1U6RA 4NPNA 3ZDTA 3TEWA 2WP9B 1I0EA 1P50A 4RF6A 3DVGY 3Q8EA 1OQQA 3RNEC 3A9KA 4LTUA 3AXCA 2K8HA 2GBRA 3VR8B 3AE1B 4LNNA 4PK1A 2FUG1 3A9KB 2PJHA 4MELA 4RF1A 1J7BA 3DPDA 2GWCA 2NS5A 3NVZA 3DWMA 1N60A 3UIOB 3R7QA 3H7PA 2IZVB 2CU1A 2KQ4X 3M10A 3KUCB 4IDIA 4IG7B 1WWTA 3QIJA 3QHTA 4KV2A 3DBRB 2FCQA 1FXAA 4YTPB 2DWQA 2JZPA 1FM0D 4MM3A 1WGDA 4KGRA 1E7VA 2D3AA 1VR9A 2C7HA 1MHXA 2DZKA 2WGSA 4MM3B 2QHOA 1JWMD 3GS2A 4Q2RA 5BMIA 1FCLA 3Q8AA 3Q3JA 3N9YC 4YTNB 4F7ZA 2SEBD 1WE7A 3PRPB 1ZE3D 1V1OA 4OW0A 3V05A 2KYWA 1NYQA 1J0GA 4I6LB 4OHJA 2MJDA 2AEHA 4W9EA 2LGIA 1MHHE 3VUXA 4MH0E 4W9JA 4DK5A 2IYDB 2CRKA 4HROA 2QMTA 2K1FA 3CSTA 2L32A 2MWSB 4Z9MA 2KDFB 1E9MA 1VCBA 1KOTA 1FXIA 1P3QU 5HG2A 4RFBA 2ZEQA 1V1PA 1R4NB 4YXDB 1V1PB 3KYCD 3L13A 1TGZB 1QILA 2IO3B 3DBHB 3QARA 1BUIC 4W9GA 2V3NA 2MBHA 1ACCA 1ISNA 4YT0B 3JQ3A 1WFYA 2KFJA 3W5VB 4ANVA 3PLUA 1Z2MA 1H8CA 2PW9A 4GDKA 2V4LA 1HEZE 2PE9A 2LHEA 3U7ZA 1XLQA 4IW0A 4GDKB 1VZ8A 2NTTA 3V6EB 1ET9A 2HTME 4W9DA 4BG4B 4GXBA 1B9RA 2BQQA 1I7HA 3T3NA 1N62A 1D5ZC 4EZLA 2CJNA 2Y3AA 2WXLA 4LDTB 1CMXB 4FN2A 1ZKHA 1XO3A 4BOSC 5EE0A 5IP4D 2NBVB 3SFEB 4X57B 3IFWB 1WSPA 3M3JA 1Q5WB 3OWEB 3ZTDA 1NVID 2BPSA 3WA0A 5CHFA 3RULA 3ML8A 4M8MA 2YVCA 1T0QC 1OTRB 1WIAA 2GBMA 5D94A 2Z0EB 3H1UA 2VRRB 4MSMB 1FD6A 2IY0B 2KNBA 3HRDD 4KZCA 5AEKB 3PPAA 4XX5A 4RM8A 4XWWA 5IAAC 4HCPB 3BVGA 1LXDA 2MW5A 1M15A 3B6RA 3RNBC 3H8HA 1VD2A 4E74A 3E56A 5E6NA 1ZDVA 1IYFA 2AQ2B 1KRHA 3PO0A 2V1YA 3APDA 1QH4A 2KLCA 3P42A 4MGYE 2KC1A 3SDLC 2OOBB 3B2GA 2DYOA 3L2DA 3EFUA 2ZVNA 4G3XB 3AEFB 2G4DB 1ZDXA 4GMVA 2Y5BB 4M02A 2BYEA 1RWSA 2WXHA 3DBRI 3IT6B 5TR5A 3A4RA 4G50A 4DDID 4EKUA 2BGFA 1LO5D 4AS1A 2AL3A 5HI1A 3R2IA 3PRMB 4WQOB 3S2AA 1RRBA 2YLMA 1HA5A 1WXMA 2DAJA 4BVUC 2K22A 4LCDE 1WXQA 1BT0A 2WXKA 2X8XX 3AN1A 5AZHA 4IM2A 3GOEA 2NCNA 2KJHB 2KAJA 3ZTCA 2JRIB 4YTMB 2M17A 5EE1A 1VJKA 2PVGC 1C4AA 2ON8A 3U8ZA 3PLVA 1PUTA 5CX3A 2LI5A 3DHHC 2WXQA 3VTVA 3BYYB 3U52E 3QQ8B 4EOYA 2MEKA 2KDIA 2WXNA 1R4NI 3L16A 2G3QB 3FILA 5BYQA 1QOBA 2DX5B 3KWVA 2WXIA 5CHVC 3VR9B 4F8CB 3DBHI 5HHDG 4LNOA 1YN3A 5HKHA 1RYJA 2PPHA 1V8CA 2WU2B 4C7YA 4YSZB 3DBLB 3V62A 3IBEA 3R3MA 1JWUD 1H4RA 2KC2A 1NDDA 2A4ZA 3O65B 4P1BC 1FRRA 1EUVB 2K3UA 4CQNA 3HVDA 4IM3A 1EF5A 1CJEA 4II2B 3I9V1 5JH5C 3DHIC 3L4PA 3SHQA 5IO9A 1UUPA 2MBOA 3AE8B 5IN7A 3RNAC 2BWES 4N59A 1GNUA 5CTRC 3NVYA 2TSSA 3ZRFA 1N5XA 3ZJVA 4EEWA 2PE6B 1J8CA 2B76B 1ET6A 1L0XB 1WGRA 3U7DA 1ZW7A 2MBQA 3B2FA 2HDEA 5I4DA 4GSWA 2L0TA 3HVZA 4HDQA 3WALA 3AU5A 3PGEA 4FJZA 3B0AA 1SJED 5H92C 1WR1A 4DHJB 2KFKB 2WNMA 1GC7A 1WM2A 4TQ0A 4RGTA 3TEZA 1SD0A 1XD3B 2NVUI 4I6PA 4XC2A 1UGMA 3OG5A 2KWVB 2X38A 3ZNZB 1WGYA 2DZJA 1WJ6A 4GU2A 3LDZE 1GUAB 1WZ3A 1F52A 1N61A 3LVWA 3EA6A 3FC4A 5LXHA 1V49A 4PS7A 4WWNA 3ZNHB 3LJ3A 1KLVA 2Z59B 2KZRA 3AE5B 2DAFA 4K7WA 2DNFA 1WMHA 1X1MA 1AWDA 1SBBB 4M01A 4KSLC 2JPHA 3NVVA 3PZ8A 1I42A 1XQQA 2KQSA 1ZGUB 2HD5B 1WM3A 4RF0A 1IUEA 3TJPA 5BYSA 3D32A 2EMTA 3VVWB 1YJIA 4NJ7A 1D5MC 5D7GA 4JWUC 4B0MA 2DENB 3MC8A 3GE3C 4K7SA 2L3ZA 1ZUD2 4G0NB 1WX7A 2SAKA 1D4BA 3NRZA 2MRPA 3H9DA 3UIPB 5J9AA 4TMAB 3NOBA 5J18A 5BMHA 3ML9A 2WS3B 2RD0A 1C76A 4HLEA 4PYZA 4ZHPA 1UWXA 2JZ3B 3N20C 4NAMA 2WXOA 5HFYA 2KDBA 2QC8A 3V6CB 4TQ1A 3VH4B 3LN7A 2J52A 4OVVA 4HWIB 4W9KA 1I4RA 5GMVA 1CZPA 4P16A 2MHJA 3N1YC 3T9LA 2G4SA 3BIID 4ANWA 1PGAA 3KQ4A 4XE0A 4WQMA 4DWFA 2ONQA 1GAQB 4IM0A 4A9AA 3DBLI 1P1AA 2GB1A 1PDXA 1SGHA 4M00A 5AZFA 2WXFA 2JQRB 1YQBA 3CIRB 2QJLA 3ZVVA 1PGBA 2B3AA 2L05A 3RMKC 1DOIA 1D3ZA 1SXTA 2INNE 3JU6A 1JWAD 3AV8A 3KLSX 4REZA 3RFZB 1OQYA 3RUIB 3AEGB 2KN5A 3ZQ4A 5C3JB 2GWDA 2KVRA 2NTSA 4RH6A 4EZJA 2N7DA 2WXMA 4RF7A 2KWUB 4OZBA 2LGXA 5FKAC 4GDLA 2BKFA 4XDCA 1F9JA 2ZNVB 2H89B 1NYRA 3MJWA 4GDLB 2BW2A 4OVUA 3WANA 1PQSA 3QCAA 4H2AA 4WAFA 2VH1A 3VH3B 2JUOA 3IG3A 3DHGC 1WX8A 3FAHA 1N63A 1YQ4B 3K9PB 4EFOA 4C80A 2J0KA 4KKIA 1UWMA 3HK0A 5EDSA 5FR3A 2PIAA 1N6ZA 2BT6A 1FEHA 2YEPB 1WYGA 3I5JC 1NI2A 2PLPA 5J99A 3DVGX 5JXVA
chains in the Genus database with same CATH topology
1F52A 1TT4A 2WGSA 3LVWA 2QC8A 2UU7A 2LGSA 3LN7A 2GWDA 3NZTA 1LGRA 4LNFA 3FKYA 2BVCA 1V4GA 4S0RA 2D32A 3IG5A 1F1HA 4LNOA 4LNNA 1HTOA 4LNKA 4XYCA 1R8GA 4S17A 2D33A 2D3BA 3LN6A 1HTQA 3ZXVA 2D3CA 3NG0A 2GWCA 1FPYA 3IG8A 2D3AA 2WHIA 4HPPA 2OJWA 1VA6A 2GLSA 3LVVA 4ACFA 4BAXA 4LNIA 3ZXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F52 A;  2WGS A;  2QC8 A;  2UU7 A;  2LGS A;  1LGR A;  4LNF A;  3FKY A;  2BVC A;  4S0R A;  1F1H A;  4LNO A;  4LNN A;  1HTO A;  4LNK A;  4XYC A;  4S17 A;  2D3B A;  1HTQ A;  3ZXV A;  2D3C A;  3NG0 A;  1FPY A;  2D3A A;  2WHI A;  4HPP A;  2OJW A;  2GLS A;  4ACF A;  4BAX A;  4LNI A;  3ZXR A; 
#chains in the Genus database with same CATH topology
 3GP7 A;  4PS3 A;  2M0A A;  2G45 B;  2JXT A;  1PGX A;  4B6W A;  3Q69 A;  4HDO A;  2ZPY A;  1FIQ A;  3H7P B;  3P4Q B;  3U4E G;  1UBI A;  4ANX A;  2Y5P A;  4BZA A;  1U4A A;  4FJY A;  4ZOH C;  4K3C A;  2ZJD A;  3T3O A;  2Q5W D;  4LDT D;  3IG8 A;  2LXC A;  4PS8 A;  3LVV A;  4ARI A;  2CU3 A;  1KFY B;  2N9X A;  4GIV A;  1V6E A;  2N9K A;  3O13 A;  2WDQ B;  3P4P B;  1WXA A;  5JHA A;  1LM8 B;  1WGH A;  2E6X A;  1FCC C;  1WE6 A;  5JZE B;  5IOI A;  5G5H A;  2GLS A;  3RNC C;  3MHZ A;  3VHT C;  4P7I A;  1Y8R C;  4ZRQ A;  3UQB A;  2W82 A;  1F77 A;  3C19 A;  3NS8 A;  4IC7 B;  2J7Q B;  4F1S A;  2QIE B;  2M4N A;  1TKE A;  1EU4 A;  1OFF A;  3MTN B;  4J3O D;  3QC8 B;  1L6V A;  1ENF A;  1WRI A;  2C5L C;  2R61 A;  1E6E B;  2N9L A;  2XBB C;  3UIN B;  4GB9 A;  2O6V A;  4BAX A;  2N9E B;  3R7R A;  2L0F A;  2KK8 A;  4JPS A;  3VTU A;  5AUK A;  2J42 A;  4A55 A;  4GW0 A;  3GZN B;  2H88 B;  3A9J A;  2JVC A;  3RPF C;  5D6J B;  2HE7 A;  3Q3F A;  3IG5 A;  1F2R I;  1WXS A;  2FAZ A;  2PTL A;  4CO7 A;  4C00 A;  3P63 A;  2KMM A;  4ZRJ A;  4BOZ B;  4TSS A;  1T6B X;  5FK9 C;  2K25 A;  5IA7 A;  2QEJ C;  5L95 C;  3HM3 A;  1YNT E;  1TIF A;  2OHF A;  1SF0 A;  3IAM 1;  4BFR A;  4J6I A;  3X23 A;  2L52 A;  2AL6 A;  3AE4 B;  5LXI B;  1WF9 A;  1EM7 A;  1VRA B;  2MBE A;  2FIF A;  2I1K A;  3AU4 A;  4LJO B;  2IY1 B;  3CSF A;  3AEE B;  1F0Z A;  2V4I B;  3MC9 A;  4DXF A;  1C4C A;  4FAD A;  3WCQ A;  3Q2A C;  4RF8 A;  3TSS A;  3JVZ X;  3L2E A;  4FBJ B;  4HPM B;  4RNA A;  2Z0D B;  2M8S A;  5KHO A;  3L2E B;  2BB6 A;  2V3S A;  2D2Q A;  2PEA A;  2JSV X;  1RM6 C;  1BML C;  5J17 A;  4TV3 A;  2ICI A;  5MPO A;  1AW7 A;  4K1R B;  1UEL A;  2QCZ A;  1SE4 A;  3ZJU A;  2MH7 A;  1UF0 A;  4RCO A;  2V9H A;  3RYT A;  2AWT A;  3MFG A;  1JCK B;  4GOC A;  2WXP A;  5L83 A;  3NZ3 A;  3N1Z C;  3DQV A;  1QT9 A;  4EE2 A;  4AJY B;  4IKG A;  1T0R C;  1FRD A;  2IO1 B;  2WWZ A;  1R4M B;  2MX2 A;  1C79 A;  4E3C A;  3QAQ A;  3QX1 A;  1WYW B;  2JXX A;  1Y56 A;  3APF A;  4C56 C;  3W1S C;  4WWO A;  1YX5 B;  1MI0 A;  1SE2 A;  3L0W B;  2KOX A;  2KMA A;  2N7J A;  4UDU C;  4BKG A;  1VLB A;  3VAW A;  1HE8 A;  1WZ0 A;  3VDZ A;  1TYG B;  3OJ3 A;  1KF6 B;  1ZP0 B;  2WYQ A;  1G6J A;  4KDL B;  4N9F 4;  4E71 A;  3QK0 A;  4BHL A;  1JWB D;  3ZXV A;  2WX0 A;  2N7E A;  1C9F A;  4L2Y A;  2K0P A;  3ZJT A;  3L10 B;  2W3R A;  2CHZ A;  3ZO5 B;  3B08 A;  3C8Y A;  2KDM A;  2CHX A;  1E90 A;  2KLG A;  1E8X A;  4FXC A;  3B1L X;  3MHS D;  2ZCC A;  2NBU A;  1GC6 A;  2XEW A;  3JPZ A;  4DHJ D;  2EEL A;  1EU3 A;  3QWZ B;  1OEY J;  2KO3 A;  3EEC A;  5GXG B;  2V0G A;  2BTE A;  2BYV E;  3URY A;  3W5U B;  1N5W A;  2W55 A;  1V97 A;  2GOW A;  3GZN I;  4HXD A;  2JX5 A;  2MJE A;  3FIL B;  1TJE A;  2JRH A;  4XYC A;  2ACZ B;  1EWC A;  2LRW A;  2I38 A;  2K6D B;  2WQY B;  4KGS A;  2MSE D;  3A1Q A;  2RPQ A;  1TS5 A;  1XT9 B;  2PKO A;  3H7S A;  4KDI C;  4O1N A;  3N30 A;  3KW5 B;  3PHW B;  1TTN A;  4WJO A;  2JWU A;  2W9N A;  1F1H A;  3IAS 1;  3L17 A;  5DCN A;  2J4X A;  1KTK A;  3ZDM C;  2LEK A;  2LFI A;  2NMQ A;  3TIX A;  2O2V A;  4ICU A;  2QSD A;  1TZO A;  2I1J A;  2KXJ A;  2BWF A;  2LUM A;  3NG0 A;  2O2V B;  4RM9 A;  2ZCB A;  1UD7 A;  4IOI E;  2IJ0 A;  4WH4 A;  4W9I A;  1CRK A;  1WJU A;  2NBW B;  2IGG A;  4URK A;  2LHD A;  3Q3N C;  3Q8C A;  3RZF A;  3LN6 A;  4DHZ B;  1F2R C;  2IDY A;  3NS1 A;  4BBN C;  4WJQ A;  1TS4 A;  2KVZ A;  3NZU A;  1K51 A;  4IWP A;  2LXA A;  1EF1 A;  2M56 B;  3EC8 A;  3QJZ A;  3SEB A;  3J9C A;  3Q6B A;  1VZ6 A;  1TKG A;  2G1E A;  5FR6 A;  2RSU A;  5AZG A;  3AE3 B;  1MFW A;  4QAY A;  3APC A;  4ACF A;  2INC C;  2WU5 B;  2Y5C A;  2E3T A;  4JQW C;  1R7S A;  2JF5 A;  3KYD D;  2KD0 A;  2XN9 C;  2K39 A;  2CHW A;  1MVK A;  2GBK A;  4FJV B;  3C0R B;  1VRP A;  2BVC A;  1DOY A;  1WGG A;  1BG0 A;  1R4M I;  2IPK D;  1SB3 C;  1WGK A;  2KT7 A;  3ZRC A;  1WX9 A;  4JWS C;  3U2S C;  1HQR D;  2M0X A;  4US9 A;  3PSE B;  3B9J A;  3SU8 X;  2L1A A;  4XZ4 A;  4NJ6 A;  2LGY A;  2LGD A;  2AQ3 B;  3ZGZ A;  1OEY A;  4HPP A;  2VH2 A;  3N3K B;  2ZZP B;  1TS3 A;  2HJ1 A;  4M8N A;  2ZNV C;  1WMH B;  1YOV B;  3A33 B;  2JYE A;  3WAP A;  4B9K A;  3ONS A;  4M0W A;  2DZM A;  1LGR A;  3WIM A;  1FO4 A;  5LNK 1;  5BMG A;  3NVW A;  3VUY A;  4M0W B;  5G2N A;  1QZE A;  3UGB B;  4S17 A;  3DDC B;  3MP9 A;  1L0Y B;  2RDG A;  4ZRI A;  3GE8 C;  4MDK E;  2N4F A;  1TY0 A;  3JSV A;  1L5P A;  4HJG E;  4JE3 B;  1JAL A;  2FID A;  1SIF A;  3RD2 A;  3KUZ A;  1IGC A;  1L7Y A;  2WHI A;  2DHZ A;  1XCT L;  3JSV B;  1EO6 A;  5T8I A;  4LLG M;  2UU7 A;  1GPX A;  1SE3 A;  2KN4 A;  1WR6 E;  1UGJ A;  2KX3 A;  2MP2 A;  1STE A;  2XK5 A;  3V60 A;  2HJ8 A;  1FNU A;  2D3G A;  3TBL D;  1VDV A;  2WXJ A;  4CYE A;  3SD5 A;  2ZVO A;  4KVG B;  3NUH B;  4WWP A;  2AYO B;  1TT4 A;  1GB4 A;  1IPG A;  3VTW A;  1E8Z A;  1TBE A;  1QF6 A;  1Q0W B;  4KIK A;  1C3T A;  1Z5S B;  2QDF A;  1MJD A;  2DLB A;  3MC0 B;  4KIK B;  3TEY A;  5C2T B;  3IVF A;  2PVO D;  1FNW A;  4KZ0 A;  4AJW A;  2QIL A;  3TMP B;  4MH8 A;  2L7R A;  1UH6 A;  3EFC A;  4MJS A;  3W2D A;  1J7C A;  5H8Y E;  4WJP A;  2K6Q A;  2NPT A;  1I4P A;  2AX5 A;  4MT5 A;  2INP E;  4MJS B;  1SEB D;  1HZ6 A;  2OJR A;  1QOG A;  3R8B A;  4ZYS A;  4MAC A;  3X0W A;  1SIJ A;  3VUW A;  1YMH E;  4DDG D;  2FE8 A;  1VZ7 A;  3JU5 A;  4ZHO A;  3H6N A;  1RAX A;  1RLF A;  2D07 B;  1FNV A;  4GW2 A;  1E8W A;  2R2O A;  3AH7 A;  1ROE A;  4MGI E;  3UQA A;  1HZ5 A;  3U30 A;  3R66 C;  1NBF C;  2MLB A;  1P7F A;  1JRO A;  1Q1O A;  2D3B A;  4YSX B;  2BBC A;  4N6E B;  2KHW B;  3VRA B;  3AE6 B;  4ARC A;  3NZS A;  1TT5 B;  1YN4 A;  3PRZ A;  1I4Q A;  4NQK E;  2K5P A;  2ZPN A;  2CR5 A;  2LZ6 A;  2Z8L A;  3AB5 A;  1J7A A;  2HTH A;  3R2T A;  1FFU A;  1V5T A;  2D33 A;  2VZK B;  3I57 A;  4W9C A;  3T8M A;  3HM6 X;  2LVQ A;  2WX1 A;  3AEC B;  1KLG D;  1KLU D;  4A6Q A;  2LRU A;  3PZD A;  2LD9 A;  2N1V A;  2AQ1 B;  2KJR A;  3ZKJ C;  1WJN A;  1M4V A;  2I2Y A;  4XGA B;  3CF6 E;  2JZZ A;  5DPW A;  1HTQ A;  2J53 A;  3TUO A;  3LYY A;  2K9X A;  3ECI A;  2OJW A;  3BVZ A;  4HCN B;  3AUL A;  3AEA B;  3KH0 A;  1L4Z B;  3ZNG C;  1BXT A;  2GBJ A;  3NZT A;  1E7P B;  3RCZ A;  1DGJ A;  3BVM A;  3TL5 A;  2A5U A;  3KUD B;  1E10 A;  3BYT B;  1DOX A;  2IGH A;  4HJK A;  4XWT A;  1K8R B;  3L54 A;  5TSS A;  2DYB A;  1FXT B;  5CHW A;  4HRS A;  4LNI A;  3DRE A;  1XF5 L;  4LK0 M;  3BIN A;  4DBG A;  2KWD A;  2LWP A;  4PYU A;  4BKS A;  2BKR B;  4AQ7 A;  1WI0 A;  1UZX B;  3M62 B;  3TEX A;  4FA6 A;  2LVP A;  2FCM A;  3ENE A;  4OZC A;  2RGF A;  2UYZ B;  1V80 A;  5BYR A;  3ZUN A;  2O6V B;  4WIP A;  3RT3 B;  4AOF A;  5E6J A;  1G0W A;  3NY5 A;  2BF8 B;  3A9J B;  5G5G A;  2N1W A;  2D5G A;  2GMI C;  3VXW A;  1HXY D;  4DQO C;  1P0R A;  2JY6 A;  2BS3 B;  2FUH B;  3DOW A;  4Q2J A;  4R3D A;  4CHK A;  1XCQ L;  4AUQ C;  1P52 A;  2KQ7 A;  3WAO A;  1Q10 A;  5G55 A;  1RFK A;  4WAA A;  2WDR B;  4WUR A;  1QQR A;  4P1C C;  2KDE B;  2EMS A;  2D32 A;  3DVN V;  3W9C B;  4EUT A;  1QOF A;  3ABV B;  4B0E A;  2N9P C;  2IGD A;  2D11 A;  3BK1 A;  2W3S A;  4KX6 B;  3M63 B;  1WRD B;  3EUB 2;  2W54 A;  4NY0 A;  4K3B A;  4II3 B;  4BG4 A;  1TY2 A;  4DHZ E;  2C60 A;  3ZXR A;  4ZRP A;  3VFK A;  3PHX B;  1V81 A;  1L4D B;  1AN8 A;  3DBS A;  4IWO A;  1CQV A;  1PYW D;  2LGS A;  1WJ4 A;  1RL9 A;  2RR9 A;  3PVL A;  1XLO A;  4FHJ A;  2KX0 A;  5EE3 A;  3PV1 A;  3HIZ A;  1CK1 A;  2V3P A;  5C1Z A;  1P9D U;  1KM7 A;  2R2Q A;  3V3X A;  1VA6 A;  2BYF A;  4FHK A;  2IO2 B;  5DPS A;  4D2K A;  3EGR A;  3V61 A;  1WXV A;  1OQR A;  3W1Y A;  4A3O A;  2M19 A;  3DCG A;  1E7U A;  2EKI A;  1ZPS A;  2LJI A;  3Q8B A;  3RNF C;  4DXG A;  4AM1 A;  4OVZ A;  2IO0 B;  2J1Q A;  3GB1 A;  4I6N B;  4MGZ E;  4NQL B;  4HPL B;  3PS6 A;  1K50 A;  4L1B A;  2OED A;  3ZNI D;  1V9J A;  2JYT A;  4RGM A;  2CKH B;  1E0Z A;  1B1Z A;  3LXF A;  1YN5 A;  1KJT A;  2BS4 B;  4W9L A;  1TS2 A;  4AWJ A;  1A5R A;  1XXG A;  2KMC A;  1E8Y A;  5AUI A;  1YQ3 B;  4K7U A;  3RN9 C;  2C9W B;  2NR2 A;  1J19 A;  2REX A;  1NEK B;  1P98 A;  1YJ1 A;  2RPV A;  2DYM A;  4GN1 A;  4ITK A;  3AE9 B;  3M95 A;  4C7Z A;  2KTF A;  1IP9 A;  3NJT A;  4HEA 1;  4GLS C;  4ZYN A;  3P2B A;  5IKC M;  1OGW A;  2FNJ B;  4YSY B;  3I63 C;  4BBN F;  2KAC A;  4ICV A;  2LMC A;  1GOZ A;  1EWY C;  4PT5 A;  3VRB B;  1MG4 A;  2KAN A;  4FLH A;  4FUL A;  4JGH B;  4GGQ A;  3N1X C;  4LNF A;  1V4G A;  3JYU A;  3MJ5 A;  4HK2 A;  4A90 A;  4NZL B;  1V86 A;  4NJC A;  2GI9 A;  4JX1 C;  1TZ1 A;  4MEM A;  1K53 A;  3ZW3 A;  2LUE A;  1DYQ A;  2L76 A;  1QOA A;  4JL9 A;  4RMA A;  4HKZ E;  1WY8 A;  1XLP A;  3L08 A;  3CWI A;  4W9F A;  4W9H A;  1AYF A;  3BWU D;  1L0V B;  2JWZ A;  3A4S C;  3TCA A;  4ZRK A;  3RNG C;  2WXR A;  1KH0 A;  3IXS A;  3HUI A;  1C4P A;  2JT4 B;  4HVB A;  1FPY A;  1LFD A;  3AE2 B;  3HHM A;  1UBQ A;  3AED B;  1WH3 A;  3DRB A;  3SFD B;  3QA8 A;  3A1Q B;  4IUM B;  1IGD A;  3FKY A;  1D6E C;  3ZYY X;  2IBI B;  3WAM A;  1QK1 A;  1YX6 B;  3AE7 B;  4TKN A;  4G11 A;  1T0Y A;  1K52 A;  3BZD B;  3K9O B;  3KWL A;  1GG3 A;  3OJ4 B;  2ZW1 A;  1GB1 A;  3P4R B;  3ZLZ A;  2BYT A;  3Q3M C;  1SSN A;  1FMA D;  1JRU A;  1AAR A;  2LJ5 A;  2YEP F;  2K8B A;  1JW9 D;  1SE9 A;  4GVZ A;  1UNS A;  1ESF A;  2D10 A;  3ALB A;  3VQI A;  1L6U A;  1C77 A;  2BS2 B;  4A3P A;  1ZOY B;  1JWS D;  1YJJ A;  3IHP C;  4GVY A;  2ZW0 A;  4ZDV A;  1IBX A;  2N0S B;  3W1S A;  5BO4 B;  4N58 A;  4US8 A;  2FCS A;  2KWC A;  3AI5 A;  3BY4 B;  4RGO S;  1IBX B;  1LQB A;  1T3Q A;  2EKE C;  5E6O A;  2C7M B;  2KJ6 A;  4S0R A;  4RF9 A;  3P1M A;  1GJZ A;  1JQ4 A;  3JW0 X;  4P6V F;  4C4V A;  4XDD A;  2DZI A;  5C23 A;  2KTR A;  5J2R A;  1S1Q B;  5D3I B;  4C4V B;  4A8X C;  2KFK A;  3NHE B;  3Q3O C;  2KTR B;  1L2N A;  4A20 A;  1I35 A;  3ZIM A;  2UWQ A;  5E6P A;  3SR6 A;  4OZA A;  3AM9 A;  4K81 A;  1YIW A;  1I4G A;  4KGT A;  1YD8 U;  3CMM B;  2FCN A;  1NEN B;  4MSQ B;  2RDB C;  3ETR A;  4HKQ A;  3AMZ A;  3Q8F A;  3PZ7 A;  2J0M A;  2GBN A;  1E5W A;  1R8G A;  4LNK A;  2ASQ A;  1XEE A;  2C7N B;  2CS4 A;  2PMV A;  2D3C A;  5D3D A;  1QKZ A;  2RDH A;  2WDV B;  3OAW A;  3Q14 C;  1SJH D;  1TKY A;  3RZW C;  4YWG G;  5EE9 A;  2MJ3 A;  2IND C;  4ASW C;  1P7E A;  2MCN B;  3P4S B;  1V2Y A;  4MGK E;  4IWQ A;  4LJP B;  2G9H D;  3UF8 A;  1D5X C;  4KSK C;  2LAS A;  2WLB A;  4USA A;  2MP2 B;  1C1Y B;  1MPE A;  2VZK D;  2CJO A;  2K8C A;  2JU6 X;  2XK5 B;  4NNJ B;  1ZXH A;  2MA9 B;  4B95 A;  3RI7 C;  2L8J A;  1FFV A;  1RFA A;  4NAW A;  3UI3 A;  3BK2 A;  2BB5 A;  3DVN U;  4EZK A;  1M94 A;  3IT4 B;  4NAW B;  4WWM A;  5DPR A;  4YL8 A;  2J0J A;  4L23 A;  1QLB B;  3KVF B;  2FBW B;  2DBY A;  1ZXI A;  2WDT B;  3E9S A;  3PT2 B;  3EHV A;  2WXG A;  5KHQ A;  3N32 A;  1HTO A;  4JIO U;  2M1M A;  1T0S C;  1V5O A;  3DWG C;  1PFD A;  2NPT B;  2XNA C;  2GRI A;  2KKC A;  2MQJ A;  4AP4 C;  3I3T B;  5JHB A;  2L00 B;  1I4X A;  3PTF C;  2MBB B;  3PRE A;  1MG8 A;  1I4H A;  3AEB B;  3OLM D;  1S3S G;  5D2M B;  2LVO A;  1NI3 A;  1C78 A;  4WJN A;  4TUU A;  4BKS D;  2L83 A;  4DXA B;  1A70 A;  4JLC A;  1JRP A;  1XLN A;  1JML A;  4BKT A;  1T5X D;  4RGN A;  2O6V D;  4ANU A;  4KKJ A;  5LLI A;  2RMM A;  3LB8 C;  5DPT A;  1U6R A;  4NPN A;  3ZDT A;  3TEW A;  2WP9 B;  1I0E A;  1P50 A;  4RF6 A;  3DVG Y;  3Q8E A;  1OQQ A;  3RNE C;  3A9K A;  4LTU A;  3AXC A;  2K8H A;  2GBR A;  3VR8 B;  3AE1 B;  4LNN A;  4PK1 A;  2FUG 1;  3A9K B;  2PJH A;  4MEL A;  4RF1 A;  1J7B A;  3DPD A;  2GWC A;  2NS5 A;  3NVZ A;  3DWM A;  1N60 A;  3UIO B;  3R7Q A;  3H7P A;  2IZV B;  2CU1 A;  2KQ4 X;  3M10 A;  3KUC B;  4IDI A;  4IG7 B;  1WWT A;  3QIJ A;  3QHT A;  4KV2 A;  3DBR B;  2FCQ A;  1FXA A;  4YTP B;  2DWQ A;  2JZP A;  1FM0 D;  4MM3 A;  1WGD A;  4KGR A;  1E7V A;  2D3A A;  1VR9 A;  2C7H A;  1MHX A;  2DZK A;  2WGS A;  4MM3 B;  2QHO A;  1JWM D;  3GS2 A;  4Q2R A;  5BMI A;  1FCL A;  3Q8A A;  3Q3J A;  3N9Y C;  4YTN B;  4F7Z A;  2SEB D;  1WE7 A;  3PRP B;  1ZE3 D;  1V1O A;  4OW0 A;  3V05 A;  2KYW A;  1NYQ A;  1J0G A;  4I6L B;  4OHJ A;  2MJD A;  2AEH A;  4W9E A;  2LGI A;  1MHH E;  3VUX A;  4MH0 E;  4W9J A;  4DK5 A;  2IYD B;  2CRK A;  4HRO A;  2QMT A;  2K1F A;  3CST A;  2L32 A;  2MWS B;  4Z9M A;  2KDF B;  1E9M A;  1VCB A;  1KOT A;  1FXI A;  1P3Q U;  5HG2 A;  4RFB A;  2ZEQ A;  1V1P A;  1R4N B;  4YXD B;  1V1P B;  3KYC D;  3L13 A;  1TGZ B;  1QIL A;  2IO3 B;  3DBH B;  3QAR A;  1BUI C;  4W9G A;  2V3N A;  2MBH A;  1ACC A;  1ISN A;  4YT0 B;  3JQ3 A;  1WFY A;  2KFJ A;  3W5V B;  4ANV A;  3PLU A;  1Z2M A;  1H8C A;  2PW9 A;  4GDK A;  2V4L A;  1HEZ E;  2PE9 A;  2LHE A;  3U7Z A;  1XLQ A;  4IW0 A;  4GDK B;  1VZ8 A;  2NTT A;  3V6E B;  1ET9 A;  2HTM E;  4W9D A;  4BG4 B;  4GXB A;  1B9R A;  2BQQ A;  1I7H A;  3T3N A;  1N62 A;  1D5Z C;  4EZL A;  2CJN A;  2Y3A A;  2WXL A;  4LDT B;  1CMX B;  4FN2 A;  1ZKH A;  1XO3 A;  4BOS C;  5EE0 A;  5IP4 D;  2NBV B;  3SFE B;  4X57 B;  3IFW B;  1WSP A;  3M3J A;  1Q5W B;  3OWE B;  3ZTD A;  1NVI D;  2BPS A;  3WA0 A;  5CHF A;  3RUL A;  3ML8 A;  4M8M A;  2YVC A;  1T0Q C;  1OTR B;  1WIA A;  2GBM A;  5D94 A;  2Z0E B;  3H1U A;  2VRR B;  4MSM B;  1FD6 A;  2IY0 B;  2KNB A;  3HRD D;  4KZC A;  5AEK B;  3PPA A;  4XX5 A;  4RM8 A;  4XWW A;  5IAA C;  4HCP B;  3BVG A;  1LXD A;  2MW5 A;  1M15 A;  3B6R A;  3RNB C;  3H8H A;  1VD2 A;  4E74 A;  3E56 A;  5E6N A;  1ZDV A;  1IYF A;  2AQ2 B;  1KRH A;  3PO0 A;  2V1Y A;  3APD A;  1QH4 A;  2KLC A;  3P42 A;  4MGY E;  2KC1 A;  3SDL C;  2OOB B;  3B2G A;  2DYO A;  3L2D A;  3EFU A;  2ZVN A;  4G3X B;  3AEF B;  2G4D B;  1ZDX A;  4GMV A;  2Y5B B;  4M02 A;  2BYE A;  1RWS A;  2WXH A;  3DBR I;  3IT6 B;  5TR5 A;  3A4R A;  4G50 A;  4DDI D;  4EKU A;  2BGF A;  1LO5 D;  4AS1 A;  2AL3 A;  5HI1 A;  3R2I A;  3PRM B;  4WQO B;  3S2A A;  1RRB A;  2YLM A;  1HA5 A;  1WXM A;  2DAJ A;  4BVU C;  2K22 A;  4LCD E;  1WXQ A;  1BT0 A;  2WXK A;  2X8X X;  3AN1 A;  5AZH A;  4IM2 A;  3GOE A;  2NCN A;  2KJH B;  2KAJ A;  3ZTC A;  2JRI B;  4YTM B;  2M17 A;  5EE1 A;  1VJK A;  2PVG C;  1C4A A;  2ON8 A;  3U8Z A;  3PLV A;  1PUT A;  5CX3 A;  2LI5 A;  3DHH C;  2WXQ A;  3VTV A;  3BYY B;  3U52 E;  3QQ8 B;  4EOY A;  2MEK A;  2KDI A;  2WXN A;  1R4N I;  3L16 A;  2G3Q B;  3FIL A;  5BYQ A;  1QOB A;  2DX5 B;  3KWV A;  2WXI A;  5CHV C;  3VR9 B;  4F8C B;  3DBH I;  5HHD G;  4LNO A;  1YN3 A;  5HKH A;  1RYJ A;  2PPH A;  1V8C A;  2WU2 B;  4C7Y A;  4YSZ B;  3DBL B;  3V62 A;  3IBE A;  3R3M A;  1JWU D;  1H4R A;  2KC2 A;  1NDD A;  2A4Z A;  3O65 B;  4P1B C;  1FRR A;  1EUV B;  2K3U A;  4CQN A;  3HVD A;  4IM3 A;  1EF5 A;  1CJE A;  4II2 B;  3I9V 1;  5JH5 C;  3DHI C;  3L4P A;  3SHQ A;  5IO9 A;  1UUP A;  2MBO A;  3AE8 B;  5IN7 A;  3RNA C;  2BWE S;  4N59 A;  1GNU A;  5CTR C;  3NVY A;  2TSS A;  3ZRF A;  1N5X A;  3ZJV A;  4EEW A;  2PE6 B;  1J8C A;  2B76 B;  1ET6 A;  1L0X B;  1WGR A;  3U7D A;  1ZW7 A;  2MBQ A;  3B2F A;  2HDE A;  5I4D A;  4GSW A;  2L0T A;  3HVZ A;  4HDQ A;  3WAL A;  3AU5 A;  3PGE A;  4FJZ A;  3B0A A;  1SJE D;  5H92 C;  1WR1 A;  4DHJ B;  2KFK B;  2WNM A;  1GC7 A;  1WM2 A;  4TQ0 A;  4RGT A;  3TEZ A;  1SD0 A;  1XD3 B;  2NVU I;  4I6P A;  4XC2 A;  1UGM A;  3OG5 A;  2KWV B;  2X38 A;  3ZNZ B;  1WGY A;  2DZJ A;  1WJ6 A;  4GU2 A;  3LDZ E;  1GUA B;  1WZ3 A;  1F52 A;  1N61 A;  3LVW A;  3EA6 A;  3FC4 A;  5LXH A;  1V49 A;  4PS7 A;  4WWN A;  3ZNH B;  3LJ3 A;  1KLV A;  2Z59 B;  2KZR A;  3AE5 B;  2DAF A;  4K7W A;  2DNF A;  1WMH A;  1X1M A;  1AWD A;  1SBB B;  4M01 A;  4KSL C;  2JPH A;  3NVV A;  3PZ8 A;  1I42 A;  1XQQ A;  2KQS A;  1ZGU B;  2HD5 B;  1WM3 A;  4RF0 A;  1IUE A;  3TJP A;  5BYS A;  3D32 A;  2EMT A;  3VVW B;  1YJI A;  4NJ7 A;  1D5M C;  5D7G A;  4JWU C;  4B0M A;  2DEN B;  3MC8 A;  3GE3 C;  4K7S A;  2L3Z A;  1ZUD 2;  4G0N B;  1WX7 A;  2SAK A;  1D4B A;  3NRZ A;  2MRP A;  3H9D A;  3UIP B;  5J9A A;  4TMA B;  3NOB A;  5J18 A;  5BMH A;  3ML9 A;  2WS3 B;  2RD0 A;  1C76 A;  4HLE A;  4PYZ A;  4ZHP A;  1UWX A;  2JZ3 B;  3N20 C;  4NAM A;  2WXO A;  5HFY A;  2KDB A;  2QC8 A;  3V6C B;  4TQ1 A;  3VH4 B;  3LN7 A;  2J52 A;  4OVV A;  4HWI B;  4W9K A;  1I4R A;  5GMV A;  1CZP A;  4P16 A;  2MHJ A;  3N1Y C;  3T9L A;  2G4S A;  3BII D;  4ANW A;  1PGA A;  3KQ4 A;  4XE0 A;  4WQM A;  4DWF A;  2ONQ A;  1GAQ B;  4IM0 A;  4A9A A;  3DBL I;  1P1A A;  2GB1 A;  1PDX A;  1SGH A;  4M00 A;  5AZF A;  2WXF A;  2JQR B;  1YQB A;  3CIR B;  2QJL A;  3ZVV A;  1PGB A;  2B3A A;  2L05 A;  3RMK C;  1DOI A;  1D3Z A;  1SXT A;  2INN E;  3JU6 A;  1JWA D;  3AV8 A;  3KLS X;  4REZ A;  3RFZ B;  1OQY A;  3RUI B;  3AEG B;  2KN5 A;  3ZQ4 A;  5C3J B;  2GWD A;  2KVR A;  2NTS A;  4RH6 A;  4EZJ A;  2N7D A;  2WXM A;  4RF7 A;  2KWU B;  4OZB A;  2LGX A;  5FKA C;  4GDL A;  2BKF A;  4XDC A;  1F9J A;  2ZNV B;  2H89 B;  1NYR A;  3MJW A;  4GDL B;  2BW2 A;  4OVU A;  3WAN A;  1PQS A;  3QCA A;  4H2A A;  4WAF A;  2VH1 A;  3VH3 B;  2JUO A;  3IG3 A;  3DHG C;  1WX8 A;  3FAH A;  1N63 A;  1YQ4 B;  3K9P B;  4EFO A;  4C80 A;  2J0K A;  4KKI A;  1UWM A;  3HK0 A;  5EDS A;  5FR3 A;  2PIA A;  1N6Z A;  2BT6 A;  1FEH A;  2YEP B;  1WYG A;  3I5J C;  1NI2 A;  2PLP A;  5J99 A;  3DVG X;  5JXV A; 
#chains in the Genus database with same CATH homology
 1F52 A;  1TT4 A;  2WGS A;  3LVW A;  2QC8 A;  2UU7 A;  2LGS A;  3LN7 A;  2GWD A;  3NZT A;  1LGR A;  4LNF A;  3FKY A;  2BVC A;  1V4G A;  4S0R A;  2D32 A;  3IG5 A;  1F1H A;  4LNO A;  4LNN A;  1HTO A;  4LNK A;  4XYC A;  1R8G A;  4S17 A;  2D33 A;  2D3B A;  3LN6 A;  1HTQ A;  3ZXV A;  2D3C A;  3NG0 A;  2GWC A;  1FPY A;  3IG8 A;  2D3A A;  2WHI A;  4HPP A;  2OJW A;  1VA6 A;  2GLS A;  3LVV A;  4ACF A;  4BAX A;  4LNI A;  3ZXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...