2UU7A

Crystal structure of apo glutamine synthetase from dog (canis familiaris)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
370
structure length
370
Chain Sequence
TSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKGVEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Crystal Structures of Mammalian Glutamine Synthetases Illustrate Substrate-Induced Conformational Changes and Provide Opportunities for Drug and Herbicide Design.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Ligase
total genus 112
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2uu7A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2uu7A02
2GLSA 2D3BA 4LNFA 4LNKA 2LGSA 2D3CA 4LNNA 4LNOA 2QC8A 1HTOA 3FKYA 4BAXA 4ACFA 1HTQA 1F1HA 4HPPA 1F52A 2WHIA 4S0RA 4XYCA 2WGSA 4LNIA 3ZXRA 3NG0A 2BVCA 2D3AA 4S17A 2OJWA 3ZXVA 1FPYA 2UU7A 1LGRA
chains in the Genus database with same CATH superfamily
1ZOYB 3IBEA 3AI5A 4IW0A 2LGYA 3SFDB 1KJTA 4MSMB 2C5LC 3AE7B 3AEFB 4L1BA 3AE5B 5FKAC 1ROEA 3QCAA 2A4ZA 3SR6A 2JRHA 2KACA 2ASQA 3NZTA 2VZKB 3X23A 2ZVOA 3PLUA 4K81A 4EFOA 1GG3A 1YNTE 1WYWB 2J0JA 2RPQA 3TUOA 4NJ6A 1SF0A 1WRDB 1MPEA 3PS6A 3U8ZA 3RI7C 3TIXA 3C19A 2GRIA 3L2DA 1PGBA 3VH4B 3WIMA 1AYFA 3R2IA 3A33B 2YVCA 2MH7A 1PDXA 3FILB 5JH5C 2KX3A 5G2NA 1XLPA 2RGFA 2QMTA 3N32A 3CMMB 2WXGA 2M19A 4FULA 3CWIA 3UIPB 1FFUA 2JXXA 2HD5B 4IC7B 1WM3A 3NOBA 2FCNA 2JRIB 1GPXA 4NAWB 1ZP0B 2KLGA 1PQSA 2JF5A 3DBHB 2BS4B 1M94A 4ICVA 1E7UA 2JX5A 4OHJA 4WH4A 2QHOA 2KN4A 3SU8X 2UU7A 3MHSD 2LVPA 3CSFA 5AUIA 2A5UA 4FJVB 3LB8C 3TEYA 3ZJVA 3UQAA 2L83A 1F1HA 4OVVA 4AJWA 1SB3C 1JWBD 2RMMA 1ZKHA 2IZVB 1JRPA 3P42A 1SD0A 4YWGG 1DOIA 1XD3B 1XT9B 4YTMB 1EF1A 1SE9A 1YN4A 2LUEA 3IXSA 3W9CB 5IOIA 3AU5A 1QOGA 1Y56A 1TT5B 2QC8A 1WSPA 2JZ3B 1EUVB 1UGMA 3L17A 1YJJA 1BUIC 4JLCA 3DBLB 3IG3A 2HTHA 2AEHA 3V05A 1WI0A 1QZEA 3BYYB 2C7MB 2LWPA 2GWDA 5BYQA 1EO6A 3VVWB 1E7PB 2Z0DB 3IT6B 4JE3B 2QCZA 3ENEA 1V5OA 3QK0A 1FM0D 2NMQA 4IDIA 2NPTB 3KUZA 5G5HA 3AEDB 2V3SA 4EKUA 3AE3B 5LXIB 2KT7A 3Q3JA 2BS2B 4I6NB 4C7YA 2E3TA 3RNGC 3ZNZB 4YSXB 1F2RI 2JU6X 4TUUA 4YTPB 3R7QA 2B76B 1HTQA 4M8NA 1GAQB 2M0XA 1ZGUB 4WJPA 2H89B 1GOZA 4A8XC 3M95A 2XBBC 2N9EB 2WXPA 2L7RA 1M4VA 2AL6A 2KJRA 3AE6B 5T8IA 1I4XA 3HVDA 2LRWA 2DZMA 1WGGA 2GLSA 3DBRI 4LCDE 1RRBA 3HHMA 1UWMA 2WQYB 4KZ0A 2LEKA 2INCC 5CTRC 1IP9A 2JSVX 4XZ4A 4MSQB 4IOIE 4LTUA 4RFBA 4C4VB 4CHKA 2WX0A 5FK9C 3BY4B 4TV3A 1WXAA 3R7RA 1N61A 3RULA 3K9PB 2N7EA 4A55A 2FCQA 4BKSD 2LASA 2JXTA 2JT4B 2KQ4X 1C79A 1NDDA 4C4VA 4RGTA 4W9IA 2C60A 2KAJA 3NVZA 1OQQA 3BK2A 2PPHA 5HHDG 1SIFA 3H1UA 3NS8A 1I35A 1WGYA 1V80A 4WAFA 1OQRA 1OFFA 3AEAB 4CYEA 1YOVB 3KWVA 3BIID 4FADA 4HXDA 2JZPA 1UZXB 2PMVA 3DWGC 5CHWA 1N6ZA 5H92C 1YX5B 1P7EA 3EA6A 3OLMD 4PYUA 3KUDB 2YLMA 2B3AA 4RCOA 1C1YB 3GE8C 1KLVA 2KO3A 4KX6B 2LXCA 4WJNA 4II3B 2CHZA 2GMIC 3H6NA 4MGYE 5AEKB 4WQOB 1JMLA 1FRRA 4DQOC 1KTKA 2MBHA 3T8MA 1FFVA 5EE9A 2HJ1A 4MGKE 2GB1A 3DRBA 2CHWA 5BYSA 2AWTA 2KC2A 4HCPB 1FCLA 2W55A 3VDZA 5HFYA 5LLIA 3CIRB 3C0RB 3DVGX 4ZRIA 1TY0A 3J9CA 4ACFA 2DX5B 4XWWA 2K8CA 2ZPNA 4RGMA 2N9LA 1I0EA 1UUPA 4XYCA 2LD9A 4W9GA 1WMHA 4DHJD 1UELA 3Q8CA 5LXHA 1OEYA 5GXGB 1S3SG 4P1CC 3KUCB 1PYWD 1OEYJ 4DXAB 2KFKB 2WDVB 4W9CA 4AQ7A 1KRHA 2LGSA 1CRKA 2DZJA 2NTTA 3H9DA 3VRAB 2N7JA 1WJ4A 2BF8B 3PSEB 1J7CA 2BGFA 2N0SB 2M8SA 4TMAB 1H8CA 3VH3B 4C80A 2KMAA 1P1AA 2TSSA 2KDMA 1QLBB 2J52A 4MELA 3LN6A 2K8BA 2DAFA 5KHOA 1MI0A 1STEA 4ZOHC 5IKCM 1WGDA 3I5JC 1RWSA 3VR9B 2ZJDA 1PFDA 2WS3B 1WZ3A 5IP4D 2N9XA 3AB5A 1Q1OA 2X38A 3UINB 3ZDMC 2HTME 2CS4A 2DAJA 3IG8A 1NBFC 2XEWA 2O2VA 3Q3FA 2AL3A 1D5ZC 4DHZB 2RSUA 1T0SC 3JQ3A 1SIJA 3IAM1 4LJPB 4GN1A 3RZFA 2LMCA 1WXSA 2YEPF 3ZRCA 2IYDB 2MJ3A 4HPMB 4B0MA 2L05A 3U7ZA 1VR9A 2D2QA 2K8HA 1GC7A 4K7WA 3EFCA 3ZTDA 2LJIA 2QIEB 3HK0A 3M62B 3OJ3A 4BOSC 3QX1A 1GJZA 2NR2A 1QQRA 1TKGA 4LNIA 3ML8A 1L6UA 1WH3A 4C7ZA 1N5XA 3V60A 4ASWC 1Q5WB 1PGAA 1KM7A 3B1LX 2W82A 4R3DA 2L1AA 3N20C 3EGRA 4BVUC 3DHGC 3L08A 2WDTB 1E8ZA 2BWES 4GLSC 2JYTA 5D6JB 1WX9A 4HROA 2I2YA 3RNEC 3DCGA 2IO1B 3H7PB 1WR6E 3NY5A 3R66C 4A3PA 3RN9C 4JQWC 2MRPA 5DPRA 4O1NA 5C2TB 2I1KA 5DPWA 1L0YB 2N9KA 3ZVVA 1BMLC 3V6CB 1WY8A 2W54A 3EFUA 3ZRFA 4RF8A 1GNUA 3ECIA 2M0AA 2KTRA 1JWAD 3B2FA 3ETRA 4WQMA 1P52A 1BXTA 2J53A 3KWLA 4WAAA 4RF6A 3ZNGC 2MQJA 2KWVB 4KV2A 1L2NA 2KVZA 5CHVC 3DQVA 3OJ4B 2MBOA 3DVNV 3ZO5B 3SEBA 2R2OA 1QF6A 1VCBA 1CQVA 2ZVNA 1T5XD 2IO2B 2AQ2B 2HE7A 3APFA 3PZ8A 4M0WB 3MC9A 3DHHC 1YQ4B 4KKJA 1WJNA 4HVBA 1UH6A 1P3QU 3Q3NC 4FN2A 4WURA 3AE9B 2RDHA 2DYMA 2N7DA 3BK1A 4KGTA 1UBQA 3VTVA 1VD2A 2MA9B 2J42A 2MX2A 2K1FA 5DPTA 3PRPB 3ZJUA 4F8CB 1I42A 3D32A 2SAKA 1WXQA 4DK5A 3L0WB 3VUWA 1UF0A 4AOFA 3T9LA 4RM9A 1V49A 2L8JA 2XK5A 5J2RA 2Q5WD 1J8CA 1JROA 2IO0B 4IM3A 4MH0E 2V3NA 1TS5A 5FR3A 1J19A 1P98A 2IPKD 5AUKA 1NI3A 4J3OD 2V1YA 1T3QA 3BVZA 1RM6C 2G3QB 1YN3A 2KLCA 4HJKA 3E9SA 3RNFC 4US8A 3A4RA 2KQ7A 3PZDA 2OOBB 3LVWA 3W5VB 1R4NI 5C23A 1XCQL 2WGSA 1RFKA 1WX7A 4DWFA 4LDTD 5D94A 3BZDB 2LGDA 4HDOA 4YSYB 5D3DA 3WAOA 1K51A 4OZCA 1CK1A 2D3CA 4BKTA 2IY1B 4GXBA 2IY0B 5C3JB 4FHKA 4PS3A 3AXCA 5JHBA 4K3CA 1WJUA 1QKZA 5E6PA 1VZ8A 1EF5A 4OW0A 1WE6A 3B08A 2JQRB 3ML9A 2UYZB 3GS2A 1RFAA 3TBLD 2EMSA 3N1XC 2IO3B 2VH2A 4WWNA 2CU3A 2LVQA 3LJ3A 4JX1C 3Q8BA 2KWCA 4JPSA 2G45B 4ZRKA 1ZDXA 3GZNI 2ZW0A 3MTNB 3NZ3A 4TSSA 3JVZX 4KGRA 1NENB 2WXMA 3U4EG 4DDGD 1J7AA 2MCNB 2K22A 3B6RA 1V9JA 4RNAA 3Q8FA 1JRUA 4KZCA 1F52A 2GI9A 2VH1A 1HQRD 4GW0A 2C7HA 2MBEA 3RCZA 3I63C 1EU4A 1QOFA 1E90A 2WLBA 2BB6A 2Z8LA 3W1SA 3JSVB 1WIAA 4BAXA 3AULA 1ET6A 5IAAC 5C1ZA 2FUHB 1FNUA 2K6QA 4E71A 2BKRB 1FD6A 1IUEA 2YEPB 1R4MB 2KJHB 3DVGY 3JSVA 1SEBD 1GB4A 2BT6A 3EUB2 1HZ5A 2KWUB 3A1QA 3PHWB 1ET9A 5BMHA 1BG0A 3NJTA 4HJGE 3NVVA 2LRUA 2WP9B 1C3TA 1IGDA 2BWFA 1ZUD2 3QARA 4ARIA 3VFKA 4P1BC 4GSWA 4A6QA 4JWUC 2O6VD 2MBBB 3AE2B 1FXAA 2D07B 1V5TA 4E74A 1ISNA 2ONQA 2ZW1A 2XN9C 4NJCA 5CX3A 1G0WA 2O6VA 2GBNA 2MWSB 5JZEB 2K6DB 2QEJC 2Z59B 3DBHI 3FAHA 3RPFC 3B0AA 2EKEC 2Y5PA 1P50A 1NI2A 4ANVA 4MM3B 1E8WA 3RNCC 5G55A 4W9JA 4GGQA 1LM8B 2K39A 3AEEB 5L83A 4DXGA 1V81A 1E8XA 3FKYA 4KIKA 4MM3A 4BKSA 2WXQA 1LO5D 4DXFA 2IGGA 1X1MA 1FXTB 2JWUA 1IBXB 2C7NB 4RF7A 3QJZA 3DVNU 1JWMD 2BPSA 3RNAC 2INPE 4GDLA 3AEBB 2R61A 3UQBA 3RFZB 3O13A 2JUOA 1IBXA 1EM7A 2REXA 3WA0A 2EMTA 2FCMA 3IT4B 2BQQA 2V9HA 2D10A 3MP9A 3OAWA 1L6VA 3TMPB 2M56B 4F7ZA 3DBLI 4CQNA 3FC4A 1RYJA 4YSZB 1ESFA 1TKYA 4G11A 1OQYA 1WRIA 3VXWA 3ZXVA 4EZLA 4CO7A 1FEHA 4OVUA 1YX6B 2JVCA 2NBUA 1P7FA 1T0QC 3CF6E 3OWEB 4H2AA 3QA8A 2BYTA 1K50A 4USAA 4BBNF 1I4RA 2MBQA 1VRPA 1YN5A 1XCTL 3DREA 5L95C 1UBIA 1FPYA 3ZGZA 4AUQC 2AX5A 4IWQA 2CRKA 1WMHB 4I6LB 3IFWB 1Q0WB 2L3ZA 4A90A 1TS3A 1E5WA 2BYFA 2K25A 3R3MA 1E8YA 2LHDA 4MGZE 1U4AA 1YQ3B 1IPGA 1MG8A 4K7UA 3BVGA 4DHJB 4OVZA 1SSNA 2N9PC 4P7IA 1UGJA 4G3XB 4M8MA 4E3CA 3HRDD 1I4GA 2ZZPB 4BZAA 2Y3AA 4OZBA 4HCNB 3IHPC 3N30A 1UWXA 1SE3A 3UIOB 5MPOA 3ZQ4A 3ZJTA 1K8RB 4P6VF 5AZFA 2DZIA 3PO0A 2AYOB 4XX5A 3LVVA 5J17A 3HIZA 2W3SA 3LDZE 1RLFA 2JYEA 4PS8A 1FMAD 4KGSA 1WR1A 1V1PA 3PVLA 2DZKA 2O2VB 1PGXA 4HDQA 4KDIC 2J0KA 3NVYA 3DBSA 2DBYA 5EE3A 2J7QB 1V4GA 4BG4B 4Q2RA 1DGJA 1TJEA 1RAXA 2K5PA 3QQ8B 2FNJB 3AE4B 4RMAA 1UD7A 4XDCA 1K53A 1WGKA 1V8CA 1TGZB 2G1EA 1SE4A 5D7GA 1LQBA 4BG4A 1OGWA 2SEBD 4AJYB 1KLGD 3ZDTA 4ARCA 1Z5SB 2KVRA 1TTNA 3VTWA 4EEWA 4ZHOA 1VA6A 1ACCA 1JWSD 2JPHA 3RZWC 3ABVB 2OJRA 4JIOU 3A4SC 2NBWB 1XO3A 2KDEB 2DWQA 2ICIA 5EE1A 3RMKC 2WXLA 4HPPA 3MHZA 2WHIA 1TS4A 5BO4B 3WALA 3BVMA 2HJ8A 3L2EB 1D5MC 2KKCA 3O65B 4QAYA 1KOTA 1MJDA 2D11A 3MFGA 3WANA 3L2EA 2PKOA 5J9AA 2LGIA 4TKNA 3W1YA 2NTSA 1WE7A 3V62A 2PW9A 1SXTA 3JU5A 4GU2A 1UNSA 2J4XA 1TZ1A 2X8XX 5HG2A 4MDKE 5EE0A 3ZIMA 3AN1A 3NS1A 1QK1A 2MSED 1BT0A 2KTRB 2RR9A 2CJOA 3JYUA 5TR5A 1P0RA 4NAMA 4FXCA 1HEZE 1JW9D 4BKGA 3PT2B 2HDEA 1ZE3D 4WJOA 1FNVA 1IGCA 1NEKB 1SGHA 3ZKJC 2LFIA 4IG7B 2J0MA 3V61A 4MH8A 4GMVA 2KOXA 4W9KA 1VZ6A 4HPLB 3PHXB 5E6JA 1XQQA 3AH7A 1MG4A 1CZPA 4II2B 2CR5A 1CMXB 1TS2A 4KSKC 4MJSA 1HZ6A 3JU6A 4HWIB 4ZYSA 1G6JA 1E7VA 2KX0A 3I9V1 4LNKA 2Y5CA 2KDBA 2ZNVB 1EWCA 2D3GA 3IVFA 1L5PA 1KH0A 4A20A 2OHFA 3ALBA 1MVKA 1TBEA 3R8BA 3NVWA 3V6EB 2WU2B 4PT5A 2ZPYA 1WJ6A 1R7SA 4GW2A 3PTFC 4IWPA 3W1SC 2KHWB 2XK5B 1C4PA 4RF0A 1AARA 3L54A 2DYBA 3H7SA 1ZPSA 1ZW7A 3I3TB 4KSLC 2QSDA 1F9JA 1TT4A 2KWDA 4NZLB 5HI1A 1WX8A 4WIPA 3EHVA 4YL8A 4ICUA 1D4BA 4YT0B 3HM3A 3ZNHB 3W5UB 1C4AA 4OZAA 3JPZA 2BYEA 2DLBA 1XXGA 1AW7A 2PIAA 1DOXA 4LK0M 1KFYB 2RD0A 2H88B 4M00A 1N62A 1C76A 4P16A 1N5WA 3U30A 2GBKA 4XE0A 1I4PA 5TSSA 3TL5A 2WXIA 1HE8A 5FR6A 5IN7A 3WCQA 2RDBC 4RF9A 1SJHD 3AU4A 3ZLZA 4AS1A 4FA6A 3KLSX 2KZRA 4HKQA 4L2YA 1NYRA 3QC8B 2LJ5A 3NUHB 4LDTB 2LHEA 4FHJA 2VZKD 3E56A 3VQIA 1D6EC 1XEEA 1U6RA 1Y8RC 3UF8A 3P4SB 2R2QA 4Z9MA 2W3RA 3KH0A 1VRAB 4FBJB 1NVID 1YMHE 2PLPA 2QDFA 4IUMB 2QILA 1WGHA 3Q3OC 3T3OA 2K0PA 1GUAB 3DWMA 1ENFA 1P9DU 4AP4C 2N4FA 3Q69A 3QHTA 3Q2AC 1QT9A 3ZUNA 2ACZB 2M4NA 2N1WA 4UDUC 4L23A 1J0GA 3P4RB 2KDFB 2JY6A 1MHXA 1IYFA 1C4CA 3BWUD 4PYZA 2BS3B 4A3OA 3DBRB 1KF6B 1E6EB 3M3JA 3FILA 2WX1A 4N58A 1FO4A 3N9YC 2FE8A 1VDVA 2J1QA 1I4QA 4ZDVA 2GOWA 4URKA 4ZRJA 3SHQA 1F77A 1DYQA 3M10A 3L4PA 2Z0EB 4W9DA 3RT3B 5EDSA 2CKHB 4NAWA 4XDDA 3HM6X 3IAS1 2D5GA 4ZHPA 1C9FA 4NNJB 2LGXA 3U2SC 2CJNA 2D32A 1YQBA 4ZYNA 1LXDA 2LZ6A 2E6XA 3P1MA 1E0ZA 4REZA 4ZRQA 2KQSA 3P4QB 3HVZA 1SBBB 3AMZA 2CHXA 3DOWA 4XWTA 3A1QB 2KTFA 3CSTA 2KMCA 4M01A 4EZKA 5BMIA 4M02A 3ZYYX 1M15A 4FLHA 4C56C 1XLOA 2IGHA 3QWZB 1TKEA 3TSSA 3A9JB 2D3BA 2IDYA 2JZZA 1HXYD 5GMVA 2L32A 1FCCC 1AN8A 4EZJA 5J99A 2FIDA 4BFRA 1WF9A 3BINA 3GE3C 2K3UA 4W9LA 3A9JA 1GC6A 3BYTB 2O6VB 4RH6A 2L00B 4GDKB 2INNE 5AZHA 3W2DA 2VRRB 3X0WA 3ZTCA 1T6BX 3NZSA 4HRSA 1QOBA 2NBVB 4LNFA 2WXOA 2FUG1 3RD2A 2NPTA 1A70A 4B0EA 1JWUD 2M1MA 1AWDA 3AM9A 2D33A 4GDKA 1LFDA 2NVUI 2ZEQA 3N1YC 4WWMA 1TIFA 3H8HA 3Q8AA 3NG0A 5I4DA 4NQKE 4KIKB 2V3PA 4B9KA 3L16A 2PEAA 4AM1A 4GOCA 4HK2A 1T0RC 3S2AA 4KKIA 4LNNA 1XLQA 2BB5A 3AV8A 4GDLB 1L0VB 1JQ4A 1E10A 2V4LA 4N59A 2ZCCA 3TJPA 2OEDA 3IG5A 2EELA 3AE1B 5DPSA 2DHZA 4NQLB 5E6OA 5IO9A 1N63A 1FRDA 1R8GA 5E6NA 2V4IB 2DNFA 2NCNA 3NRZA 3VUXA 1JCKB 3L13A 4WJQA 4MACA 4ANXA 1MHHE 2EKIA 2WDQB 1YIWA 4KVGB 1QH4A 3EC8A 2KJ6A 2GWCA 3T3NA 5AZGA 3Q8EA 1FXIA 4ANUA 3HUIA 3B9JA 1D5XC 3ZNID 2PJHA 3KVFB 3M63B 4D2KA 1H4RA 4RM8A 1WFYA 3MC8A 2WXJA 3SFEB 1S1QB 2KANA 3TEWA 1V2YA 5JHAA 3VAWA 3QIJA 1WYGA 2L52A 4WWOA 1YJ1A 4I6PA 3P4PB 1WGRA 2G9HD 1R4MI 2KNBA 3VRBB 2PE6B 5LNK1 1A5RA 2INDC 2G4DB 2W9NA 4IWOA 1WXMA 2KXJA 4F1SA 5DCNA 3RNBC 2PVGC 2AQ3B 3WAMA 1WZ0A 1XLNA 3PLVA 4LJOB 4IKGA 3VHTC 2BTEA 4NPNA 3NHEB 2LXAA 2BVCA 4DBGA 2MW5A 1TYGB 1B9RA 2K9XA 4DHZE 4MT5A 2KFJA 3MC0B 4XC2A 5HKHA 4EOYA 4EE2A 3RYTA 1WXVA 1QILA 4LNOA 4IM2A 4DDID 4HKZE 4RF1A 3LN7A 1V1OA 4Q2JA 4W9HA 1V1PB 4S17A 1C78A 2LI5A 1Z2MA 1SE2A 1K52A 4X57B 1EU3A 1OTRB 2BKFA 2KFKA 4RGOS 2ZNVC 3TEZA 3DPDA 3NZUA 4KDLB 1RL9A 1E9MA 1L7YA 4A9AA 3UGBB 3N1ZC 4WWPA 3P2BA 3TCAA 3KYDD 3APCA 2IBIB 4YTNB 5D3IB 2RDGA 2FIFA 2V0GA 1HTOA 4ZRPA 2FBWB 3AECB 4FJZA 4LLGM 2GBJA 2C9WB 4IM0A 2GBRA 3Q6BA 4ANWA 4K3BA 2LUMA 2UWQA 2GBMA 1D3ZA 3VUYA 3APDA 1F0ZA 4N6EB 1FNWA 1V86A 3MJ5A 3SD5A 3QAQA 5CHFA 3AE8B 2WXKA 2WYQA 3EECA 2DENB 2NS5A 3LYYA 3LXFA 4US9A 2PE9A 3K9OB 1T0YA 4BHLA 4GVYA 3P63A 2RPVA 4MGIE 2OJWA 1TZOA 4JL9A 4K7SA 2DYOA 1HA5A 4J6IA 2CU1A 1YD8U 3GB1A 2ZCBA 2AQ1B 3GP7A 5BYRA 5KHQA 3OG5A 4YXDB 5BMGA 2WNMA 2FCSA 1L4DB 2MEKA 1J7BA 1B1ZA 1C77A 2N1VA 3PRZA 4FJYA 4GVZA 5J18A 2KC1A 2MP2B 4BBNC 3Q3MC 4W9FA 1L4ZB 5G5GA 2MLBA 3ONSA 4PS7A 2KYWA 2I38A 2IGDA 2L0TA 2MP2A 1JALA 3KW5B 4NY0A 4NJ7A 3ZW3A 3DDCB 5H8YE 1VJKA 2Y5BB 3U7DA 1F2RC 1L0XB 2FAZA 3VTUA 2BBCA 3KYCD 1QOAA 2BW2A 3U52E 4HEA1 4GB9A 4AWJA 2WXFA 4PK1A 3H7PA 1I7HA 4MJSB 2MJEA 3R2TA 1N60A 4TQ1A 1R4NB 5JXVA 4C00A 4JWSC 3GOEA 3ZXRA 2BYVE 3PZ7A 4G50A 4TQ0A 2KMMA 3PGEA 2M17A 3Q14C 3UI3A 1CJEA 3L10B 3MJWA 2WXNA 3B2GA 1ZXHA 2XNAC 3AEGB 3URYA 2MJDA 2L76A 2G4SA 3SDLC 2WDRB 1KLUD 1V97A 4S0RA 1WM2A 4EUTA 3N3KB 1V6EA 1YJIA 2ON8A 4RGNA 3WAPA 3V3XA 1NYQA 4MEMA 2WXHA 3DHIC 4JGHB 4XGAB 4HLEA 1LGRA 1SJED 4G0NB 1MFWA 4GIVA 4K1RB 1WWTA 1EWYC 2MHJA 3I57A 2L0FA 2WU5B 2JWZA 4M0WA 4W9EA 3TEXA 3JW0X 2QJLA 2WWZA 3PREA 2KN5A 4BOZB 3GZNB 2D3AA 2I1JA 2PVOD 3A9KB 2IJ0A 1XF5L 1VLBA 4B95A 1FIQA 4B6WA 3C8YA 2KK8A 5IA7A 2WXRA 3PPAA 1DOYA 1GB1A 3KQ4A 5D2MB 1PUTA 1TY2A 2PTLA 3A9KA 2KD0A 3RUIB 1VZ7A 3PRMB 1Q10A 1ZDVA 4ITKA 4N9F4 1ZXIA 3VR8B 3PV1A 1I4HA 2KDIA 2LVOA
chains in the Genus database with same CATH topology
2GLSA 2D3BA 4LNFA 4LNKA 2LGSA 2D3CA 2GWDA 4LNNA 4LNOA 2QC8A 1HTOA 3FKYA 4BAXA 4ACFA 1HTQA 1F1HA 3LVWA 4HPPA 1F52A 2D33A 1TT4A 2WHIA 4S0RA 4XYCA 2WGSA 2D32A 2GWCA 3LN7A 4LNIA 1V4GA 3ZXRA 3NG0A 3IG5A 2BVCA 1VA6A 3NZTA 2D3AA 4S17A 2OJWA 3ZXVA 1FPYA 1R8GA 3LN6A 3IG8A 3LVVA 2UU7A 1LGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLS A;  2D3B A;  4LNF A;  4LNK A;  2LGS A;  2D3C A;  4LNN A;  4LNO A;  2QC8 A;  1HTO A;  3FKY A;  4BAX A;  4ACF A;  1HTQ A;  1F1H A;  4HPP A;  1F52 A;  2WHI A;  4S0R A;  4XYC A;  2WGS A;  4LNI A;  3ZXR A;  3NG0 A;  2BVC A;  2D3A A;  4S17 A;  2OJW A;  3ZXV A;  1FPY A;  2UU7 A;  1LGR A; 
#chains in the Genus database with same CATH topology
 1ZOY B;  3IBE A;  3AI5 A;  4IW0 A;  2LGY A;  3SFD B;  1KJT A;  4MSM B;  2C5L C;  3AE7 B;  3AEF B;  4L1B A;  3AE5 B;  5FKA C;  1ROE A;  3QCA A;  2A4Z A;  3SR6 A;  2JRH A;  2KAC A;  2ASQ A;  3NZT A;  2VZK B;  3X23 A;  2ZVO A;  3PLU A;  4K81 A;  4EFO A;  1GG3 A;  1YNT E;  1WYW B;  2J0J A;  2RPQ A;  3TUO A;  4NJ6 A;  1SF0 A;  1WRD B;  1MPE A;  3PS6 A;  3U8Z A;  3RI7 C;  3TIX A;  3C19 A;  2GRI A;  3L2D A;  1PGB A;  3VH4 B;  3WIM A;  1AYF A;  3R2I A;  3A33 B;  2YVC A;  2MH7 A;  1PDX A;  3FIL B;  5JH5 C;  2KX3 A;  5G2N A;  1XLP A;  2RGF A;  2QMT A;  3N32 A;  3CMM B;  2WXG A;  2M19 A;  4FUL A;  3CWI A;  3UIP B;  1FFU A;  2JXX A;  2HD5 B;  4IC7 B;  1WM3 A;  3NOB A;  2FCN A;  2JRI B;  1GPX A;  4NAW B;  1ZP0 B;  2KLG A;  1PQS A;  2JF5 A;  3DBH B;  2BS4 B;  1M94 A;  4ICV A;  1E7U A;  2JX5 A;  4OHJ A;  4WH4 A;  2QHO A;  2KN4 A;  3SU8 X;  2UU7 A;  3MHS D;  2LVP A;  3CSF A;  5AUI A;  2A5U A;  4FJV B;  3LB8 C;  3TEY A;  3ZJV A;  3UQA A;  2L83 A;  1F1H A;  4OVV A;  4AJW A;  1SB3 C;  1JWB D;  2RMM A;  1ZKH A;  2IZV B;  1JRP A;  3P42 A;  1SD0 A;  4YWG G;  1DOI A;  1XD3 B;  1XT9 B;  4YTM B;  1EF1 A;  1SE9 A;  1YN4 A;  2LUE A;  3IXS A;  3W9C B;  5IOI A;  3AU5 A;  1QOG A;  1Y56 A;  1TT5 B;  2QC8 A;  1WSP A;  2JZ3 B;  1EUV B;  1UGM A;  3L17 A;  1YJJ A;  1BUI C;  4JLC A;  3DBL B;  3IG3 A;  2HTH A;  2AEH A;  3V05 A;  1WI0 A;  1QZE A;  3BYY B;  2C7M B;  2LWP A;  2GWD A;  5BYQ A;  1EO6 A;  3VVW B;  1E7P B;  2Z0D B;  3IT6 B;  4JE3 B;  2QCZ A;  3ENE A;  1V5O A;  3QK0 A;  1FM0 D;  2NMQ A;  4IDI A;  2NPT B;  3KUZ A;  5G5H A;  3AED B;  2V3S A;  4EKU A;  3AE3 B;  5LXI B;  2KT7 A;  3Q3J A;  2BS2 B;  4I6N B;  4C7Y A;  2E3T A;  3RNG C;  3ZNZ B;  4YSX B;  1F2R I;  2JU6 X;  4TUU A;  4YTP B;  3R7Q A;  2B76 B;  1HTQ A;  4M8N A;  1GAQ B;  2M0X A;  1ZGU B;  4WJP A;  2H89 B;  1GOZ A;  4A8X C;  3M95 A;  2XBB C;  2N9E B;  2WXP A;  2L7R A;  1M4V A;  2AL6 A;  2KJR A;  3AE6 B;  5T8I A;  1I4X A;  3HVD A;  2LRW A;  2DZM A;  1WGG A;  2GLS A;  3DBR I;  4LCD E;  1RRB A;  3HHM A;  1UWM A;  2WQY B;  4KZ0 A;  2LEK A;  2INC C;  5CTR C;  1IP9 A;  2JSV X;  4XZ4 A;  4MSQ B;  4IOI E;  4LTU A;  4RFB A;  4C4V B;  4CHK A;  2WX0 A;  5FK9 C;  3BY4 B;  4TV3 A;  1WXA A;  3R7R A;  1N61 A;  3RUL A;  3K9P B;  2N7E A;  4A55 A;  2FCQ A;  4BKS D;  2LAS A;  2JXT A;  2JT4 B;  2KQ4 X;  1C79 A;  1NDD A;  4C4V A;  4RGT A;  4W9I A;  2C60 A;  2KAJ A;  3NVZ A;  1OQQ A;  3BK2 A;  2PPH A;  5HHD G;  1SIF A;  3H1U A;  3NS8 A;  1I35 A;  1WGY A;  1V80 A;  4WAF A;  1OQR A;  1OFF A;  3AEA B;  4CYE A;  1YOV B;  3KWV A;  3BII D;  4FAD A;  4HXD A;  2JZP A;  1UZX B;  2PMV A;  3DWG C;  5CHW A;  1N6Z A;  5H92 C;  1YX5 B;  1P7E A;  3EA6 A;  3OLM D;  4PYU A;  3KUD B;  2YLM A;  2B3A A;  4RCO A;  1C1Y B;  3GE8 C;  1KLV A;  2KO3 A;  4KX6 B;  2LXC A;  4WJN A;  4II3 B;  2CHZ A;  2GMI C;  3H6N A;  4MGY E;  5AEK B;  4WQO B;  1JML A;  1FRR A;  4DQO C;  1KTK A;  2MBH A;  3T8M A;  1FFV A;  5EE9 A;  2HJ1 A;  4MGK E;  2GB1 A;  3DRB A;  2CHW A;  5BYS A;  2AWT A;  2KC2 A;  4HCP B;  1FCL A;  2W55 A;  3VDZ A;  5HFY A;  5LLI A;  3CIR B;  3C0R B;  3DVG X;  4ZRI A;  1TY0 A;  3J9C A;  4ACF A;  2DX5 B;  4XWW A;  2K8C A;  2ZPN A;  4RGM A;  2N9L A;  1I0E A;  1UUP A;  4XYC A;  2LD9 A;  4W9G A;  1WMH A;  4DHJ D;  1UEL A;  3Q8C A;  5LXH A;  1OEY A;  5GXG B;  1S3S G;  4P1C C;  3KUC B;  1PYW D;  1OEY J;  4DXA B;  2KFK B;  2WDV B;  4W9C A;  4AQ7 A;  1KRH A;  2LGS A;  1CRK A;  2DZJ A;  2NTT A;  3H9D A;  3VRA B;  2N7J A;  1WJ4 A;  2BF8 B;  3PSE B;  1J7C A;  2BGF A;  2N0S B;  2M8S A;  4TMA B;  1H8C A;  3VH3 B;  4C80 A;  2KMA A;  1P1A A;  2TSS A;  2KDM A;  1QLB B;  2J52 A;  4MEL A;  3LN6 A;  2K8B A;  2DAF A;  5KHO A;  1MI0 A;  1STE A;  4ZOH C;  5IKC M;  1WGD A;  3I5J C;  1RWS A;  3VR9 B;  2ZJD A;  1PFD A;  2WS3 B;  1WZ3 A;  5IP4 D;  2N9X A;  3AB5 A;  1Q1O A;  2X38 A;  3UIN B;  3ZDM C;  2HTM E;  2CS4 A;  2DAJ A;  3IG8 A;  1NBF C;  2XEW A;  2O2V A;  3Q3F A;  2AL3 A;  1D5Z C;  4DHZ B;  2RSU A;  1T0S C;  3JQ3 A;  1SIJ A;  3IAM 1;  4LJP B;  4GN1 A;  3RZF A;  2LMC A;  1WXS A;  2YEP F;  3ZRC A;  2IYD B;  2MJ3 A;  4HPM B;  4B0M A;  2L05 A;  3U7Z A;  1VR9 A;  2D2Q A;  2K8H A;  1GC7 A;  4K7W A;  3EFC A;  3ZTD A;  2LJI A;  2QIE B;  3HK0 A;  3M62 B;  3OJ3 A;  4BOS C;  3QX1 A;  1GJZ A;  2NR2 A;  1QQR A;  1TKG A;  4LNI A;  3ML8 A;  1L6U A;  1WH3 A;  4C7Z A;  1N5X A;  3V60 A;  4ASW C;  1Q5W B;  1PGA A;  1KM7 A;  3B1L X;  2W82 A;  4R3D A;  2L1A A;  3N20 C;  3EGR A;  4BVU C;  3DHG C;  3L08 A;  2WDT B;  1E8Z A;  2BWE S;  4GLS C;  2JYT A;  5D6J B;  1WX9 A;  4HRO A;  2I2Y A;  3RNE C;  3DCG A;  2IO1 B;  3H7P B;  1WR6 E;  3NY5 A;  3R66 C;  4A3P A;  3RN9 C;  4JQW C;  2MRP A;  5DPR A;  4O1N A;  5C2T B;  2I1K A;  5DPW A;  1L0Y B;  2N9K A;  3ZVV A;  1BML C;  3V6C B;  1WY8 A;  2W54 A;  3EFU A;  3ZRF A;  4RF8 A;  1GNU A;  3ECI A;  2M0A A;  2KTR A;  1JWA D;  3B2F A;  3ETR A;  4WQM A;  1P52 A;  1BXT A;  2J53 A;  3KWL A;  4WAA A;  4RF6 A;  3ZNG C;  2MQJ A;  2KWV B;  4KV2 A;  1L2N A;  2KVZ A;  5CHV C;  3DQV A;  3OJ4 B;  2MBO A;  3DVN V;  3ZO5 B;  3SEB A;  2R2O A;  1QF6 A;  1VCB A;  1CQV A;  2ZVN A;  1T5X D;  2IO2 B;  2AQ2 B;  2HE7 A;  3APF A;  3PZ8 A;  4M0W B;  3MC9 A;  3DHH C;  1YQ4 B;  4KKJ A;  1WJN A;  4HVB A;  1UH6 A;  1P3Q U;  3Q3N C;  4FN2 A;  4WUR A;  3AE9 B;  2RDH A;  2DYM A;  2N7D A;  3BK1 A;  4KGT A;  1UBQ A;  3VTV A;  1VD2 A;  2MA9 B;  2J42 A;  2MX2 A;  2K1F A;  5DPT A;  3PRP B;  3ZJU A;  4F8C B;  1I42 A;  3D32 A;  2SAK A;  1WXQ A;  4DK5 A;  3L0W B;  3VUW A;  1UF0 A;  4AOF A;  3T9L A;  4RM9 A;  1V49 A;  2L8J A;  2XK5 A;  5J2R A;  2Q5W D;  1J8C A;  1JRO A;  2IO0 B;  4IM3 A;  4MH0 E;  2V3N A;  1TS5 A;  5FR3 A;  1J19 A;  1P98 A;  2IPK D;  5AUK A;  1NI3 A;  4J3O D;  2V1Y A;  1T3Q A;  3BVZ A;  1RM6 C;  2G3Q B;  1YN3 A;  2KLC A;  4HJK A;  3E9S A;  3RNF C;  4US8 A;  3A4R A;  2KQ7 A;  3PZD A;  2OOB B;  3LVW A;  3W5V B;  1R4N I;  5C23 A;  1XCQ L;  2WGS A;  1RFK A;  1WX7 A;  4DWF A;  4LDT D;  5D94 A;  3BZD B;  2LGD A;  4HDO A;  4YSY B;  5D3D A;  3WAO A;  1K51 A;  4OZC A;  1CK1 A;  2D3C A;  4BKT A;  2IY1 B;  4GXB A;  2IY0 B;  5C3J B;  4FHK A;  4PS3 A;  3AXC A;  5JHB A;  4K3C A;  1WJU A;  1QKZ A;  5E6P A;  1VZ8 A;  1EF5 A;  4OW0 A;  1WE6 A;  3B08 A;  2JQR B;  3ML9 A;  2UYZ B;  3GS2 A;  1RFA A;  3TBL D;  2EMS A;  3N1X C;  2IO3 B;  2VH2 A;  4WWN A;  2CU3 A;  2LVQ A;  3LJ3 A;  4JX1 C;  3Q8B A;  2KWC A;  4JPS A;  2G45 B;  4ZRK A;  1ZDX A;  3GZN I;  2ZW0 A;  3MTN B;  3NZ3 A;  4TSS A;  3JVZ X;  4KGR A;  1NEN B;  2WXM A;  3U4E G;  4DDG D;  1J7A A;  2MCN B;  2K22 A;  3B6R A;  1V9J A;  4RNA A;  3Q8F A;  1JRU A;  4KZC A;  1F52 A;  2GI9 A;  2VH1 A;  1HQR D;  4GW0 A;  2C7H A;  2MBE A;  3RCZ A;  3I63 C;  1EU4 A;  1QOF A;  1E90 A;  2WLB A;  2BB6 A;  2Z8L A;  3W1S A;  3JSV B;  1WIA A;  4BAX A;  3AUL A;  1ET6 A;  5IAA C;  5C1Z A;  2FUH B;  1FNU A;  2K6Q A;  4E71 A;  2BKR B;  1FD6 A;  1IUE A;  2YEP B;  1R4M B;  2KJH B;  3DVG Y;  3JSV A;  1SEB D;  1GB4 A;  2BT6 A;  3EUB 2;  1HZ5 A;  2KWU B;  3A1Q A;  3PHW B;  1ET9 A;  5BMH A;  1BG0 A;  3NJT A;  4HJG E;  3NVV A;  2LRU A;  2WP9 B;  1C3T A;  1IGD A;  2BWF A;  1ZUD 2;  3QAR A;  4ARI A;  3VFK A;  4P1B C;  4GSW A;  4A6Q A;  4JWU C;  2O6V D;  2MBB B;  3AE2 B;  1FXA A;  2D07 B;  1V5T A;  4E74 A;  1ISN A;  2ONQ A;  2ZW1 A;  2XN9 C;  4NJC A;  5CX3 A;  1G0W A;  2O6V A;  2GBN A;  2MWS B;  5JZE B;  2K6D B;  2QEJ C;  2Z59 B;  3DBH I;  3FAH A;  3RPF C;  3B0A A;  2EKE C;  2Y5P A;  1P50 A;  1NI2 A;  4ANV A;  4MM3 B;  1E8W A;  3RNC C;  5G55 A;  4W9J A;  4GGQ A;  1LM8 B;  2K39 A;  3AEE B;  5L83 A;  4DXG A;  1V81 A;  1E8X A;  3FKY A;  4KIK A;  4MM3 A;  4BKS A;  2WXQ A;  1LO5 D;  4DXF A;  2IGG A;  1X1M A;  1FXT B;  2JWU A;  1IBX B;  2C7N B;  4RF7 A;  3QJZ A;  3DVN U;  1JWM D;  2BPS A;  3RNA C;  2INP E;  4GDL A;  3AEB B;  2R61 A;  3UQB A;  3RFZ B;  3O13 A;  2JUO A;  1IBX A;  1EM7 A;  2REX A;  3WA0 A;  2EMT A;  2FCM A;  3IT4 B;  2BQQ A;  2V9H A;  2D10 A;  3MP9 A;  3OAW A;  1L6V A;  3TMP B;  2M56 B;  4F7Z A;  3DBL I;  4CQN A;  3FC4 A;  1RYJ A;  4YSZ B;  1ESF A;  1TKY A;  4G11 A;  1OQY A;  1WRI A;  3VXW A;  3ZXV A;  4EZL A;  4CO7 A;  1FEH A;  4OVU A;  1YX6 B;  2JVC A;  2NBU A;  1P7F A;  1T0Q C;  3CF6 E;  3OWE B;  4H2A A;  3QA8 A;  2BYT A;  1K50 A;  4USA A;  4BBN F;  1I4R A;  2MBQ A;  1VRP A;  1YN5 A;  1XCT L;  3DRE A;  5L95 C;  1UBI A;  1FPY A;  3ZGZ A;  4AUQ C;  2AX5 A;  4IWQ A;  2CRK A;  1WMH B;  4I6L B;  3IFW B;  1Q0W B;  2L3Z A;  4A90 A;  1TS3 A;  1E5W A;  2BYF A;  2K25 A;  3R3M A;  1E8Y A;  2LHD A;  4MGZ E;  1U4A A;  1YQ3 B;  1IPG A;  1MG8 A;  4K7U A;  3BVG A;  4DHJ B;  4OVZ A;  1SSN A;  2N9P C;  4P7I A;  1UGJ A;  4G3X B;  4M8M A;  4E3C A;  3HRD D;  1I4G A;  2ZZP B;  4BZA A;  2Y3A A;  4OZB A;  4HCN B;  3IHP C;  3N30 A;  1UWX A;  1SE3 A;  3UIO B;  5MPO A;  3ZQ4 A;  3ZJT A;  1K8R B;  4P6V F;  5AZF A;  2DZI A;  3PO0 A;  2AYO B;  4XX5 A;  3LVV A;  5J17 A;  3HIZ A;  2W3S A;  3LDZ E;  1RLF A;  2JYE A;  4PS8 A;  1FMA D;  4KGS A;  1WR1 A;  1V1P A;  3PVL A;  2DZK A;  2O2V B;  1PGX A;  4HDQ A;  4KDI C;  2J0K A;  3NVY A;  3DBS A;  2DBY A;  5EE3 A;  2J7Q B;  1V4G A;  4BG4 B;  4Q2R A;  1DGJ A;  1TJE A;  1RAX A;  2K5P A;  3QQ8 B;  2FNJ B;  3AE4 B;  4RMA A;  1UD7 A;  4XDC A;  1K53 A;  1WGK A;  1V8C A;  1TGZ B;  2G1E A;  1SE4 A;  5D7G A;  1LQB A;  4BG4 A;  1OGW A;  2SEB D;  4AJY B;  1KLG D;  3ZDT A;  4ARC A;  1Z5S B;  2KVR A;  1TTN A;  3VTW A;  4EEW A;  4ZHO A;  1VA6 A;  1ACC A;  1JWS D;  2JPH A;  3RZW C;  3ABV B;  2OJR A;  4JIO U;  3A4S C;  2NBW B;  1XO3 A;  2KDE B;  2DWQ A;  2ICI A;  5EE1 A;  3RMK C;  2WXL A;  4HPP A;  3MHZ A;  2WHI A;  1TS4 A;  5BO4 B;  3WAL A;  3BVM A;  2HJ8 A;  3L2E B;  1D5M C;  2KKC A;  3O65 B;  4QAY A;  1KOT A;  1MJD A;  2D11 A;  3MFG A;  3WAN A;  3L2E A;  2PKO A;  5J9A A;  2LGI A;  4TKN A;  3W1Y A;  2NTS A;  1WE7 A;  3V62 A;  2PW9 A;  1SXT A;  3JU5 A;  4GU2 A;  1UNS A;  2J4X A;  1TZ1 A;  2X8X X;  5HG2 A;  4MDK E;  5EE0 A;  3ZIM A;  3AN1 A;  3NS1 A;  1QK1 A;  2MSE D;  1BT0 A;  2KTR B;  2RR9 A;  2CJO A;  3JYU A;  5TR5 A;  1P0R A;  4NAM A;  4FXC A;  1HEZ E;  1JW9 D;  4BKG A;  3PT2 B;  2HDE A;  1ZE3 D;  4WJO A;  1FNV A;  1IGC A;  1NEK B;  1SGH A;  3ZKJ C;  2LFI A;  4IG7 B;  2J0M A;  3V61 A;  4MH8 A;  4GMV A;  2KOX A;  4W9K A;  1VZ6 A;  4HPL B;  3PHX B;  5E6J A;  1XQQ A;  3AH7 A;  1MG4 A;  1CZP A;  4II2 B;  2CR5 A;  1CMX B;  1TS2 A;  4KSK C;  4MJS A;  1HZ6 A;  3JU6 A;  4HWI B;  4ZYS A;  1G6J A;  1E7V A;  2KX0 A;  3I9V 1;  4LNK A;  2Y5C A;  2KDB A;  2ZNV B;  1EWC A;  2D3G A;  3IVF A;  1L5P A;  1KH0 A;  4A20 A;  2OHF A;  3ALB A;  1MVK A;  1TBE A;  3R8B A;  3NVW A;  3V6E B;  2WU2 B;  4PT5 A;  2ZPY A;  1WJ6 A;  1R7S A;  4GW2 A;  3PTF C;  4IWP A;  3W1S C;  2KHW B;  2XK5 B;  1C4P A;  4RF0 A;  1AAR A;  3L54 A;  2DYB A;  3H7S A;  1ZPS A;  1ZW7 A;  3I3T B;  4KSL C;  2QSD A;  1F9J A;  1TT4 A;  2KWD A;  4NZL B;  5HI1 A;  1WX8 A;  4WIP A;  3EHV A;  4YL8 A;  4ICU A;  1D4B A;  4YT0 B;  3HM3 A;  3ZNH B;  3W5U B;  1C4A A;  4OZA A;  3JPZ A;  2BYE A;  2DLB A;  1XXG A;  1AW7 A;  2PIA A;  1DOX A;  4LK0 M;  1KFY B;  2RD0 A;  2H88 B;  4M00 A;  1N62 A;  1C76 A;  4P16 A;  1N5W A;  3U30 A;  2GBK A;  4XE0 A;  1I4P A;  5TSS A;  3TL5 A;  2WXI A;  1HE8 A;  5FR6 A;  5IN7 A;  3WCQ A;  2RDB C;  4RF9 A;  1SJH D;  3AU4 A;  3ZLZ A;  4AS1 A;  4FA6 A;  3KLS X;  2KZR A;  4HKQ A;  4L2Y A;  1NYR A;  3QC8 B;  2LJ5 A;  3NUH B;  4LDT B;  2LHE A;  4FHJ A;  2VZK D;  3E56 A;  3VQI A;  1D6E C;  1XEE A;  1U6R A;  1Y8R C;  3UF8 A;  3P4S B;  2R2Q A;  4Z9M A;  2W3R A;  3KH0 A;  1VRA B;  4FBJ B;  1NVI D;  1YMH E;  2PLP A;  2QDF A;  4IUM B;  2QIL A;  1WGH A;  3Q3O C;  3T3O A;  2K0P A;  1GUA B;  3DWM A;  1ENF A;  1P9D U;  4AP4 C;  2N4F A;  3Q69 A;  3QHT A;  3Q2A C;  1QT9 A;  3ZUN A;  2ACZ B;  2M4N A;  2N1W A;  4UDU C;  4L23 A;  1J0G A;  3P4R B;  2KDF B;  2JY6 A;  1MHX A;  1IYF A;  1C4C A;  3BWU D;  4PYZ A;  2BS3 B;  4A3O A;  3DBR B;  1KF6 B;  1E6E B;  3M3J A;  3FIL A;  2WX1 A;  4N58 A;  1FO4 A;  3N9Y C;  2FE8 A;  1VDV A;  2J1Q A;  1I4Q A;  4ZDV A;  2GOW A;  4URK A;  4ZRJ A;  3SHQ A;  1F77 A;  1DYQ A;  3M10 A;  3L4P A;  2Z0E B;  4W9D A;  3RT3 B;  5EDS A;  2CKH B;  4NAW A;  4XDD A;  3HM6 X;  3IAS 1;  2D5G A;  4ZHP A;  1C9F A;  4NNJ B;  2LGX A;  3U2S C;  2CJN A;  2D32 A;  1YQB A;  4ZYN A;  1LXD A;  2LZ6 A;  2E6X A;  3P1M A;  1E0Z A;  4REZ A;  4ZRQ A;  2KQS A;  3P4Q B;  3HVZ A;  1SBB B;  3AMZ A;  2CHX A;  3DOW A;  4XWT A;  3A1Q B;  2KTF A;  3CST A;  2KMC A;  4M01 A;  4EZK A;  5BMI A;  4M02 A;  3ZYY X;  1M15 A;  4FLH A;  4C56 C;  1XLO A;  2IGH A;  3QWZ B;  1TKE A;  3TSS A;  3A9J B;  2D3B A;  2IDY A;  2JZZ A;  1HXY D;  5GMV A;  2L32 A;  1FCC C;  1AN8 A;  4EZJ A;  5J99 A;  2FID A;  4BFR A;  1WF9 A;  3BIN A;  3GE3 C;  2K3U A;  4W9L A;  3A9J A;  1GC6 A;  3BYT B;  2O6V B;  4RH6 A;  2L00 B;  4GDK B;  2INN E;  5AZH A;  3W2D A;  2VRR B;  3X0W A;  3ZTC A;  1T6B X;  3NZS A;  4HRS A;  1QOB A;  2NBV B;  4LNF A;  2WXO A;  2FUG 1;  3RD2 A;  2NPT A;  1A70 A;  4B0E A;  1JWU D;  2M1M A;  1AWD A;  3AM9 A;  2D33 A;  4GDK A;  1LFD A;  2NVU I;  2ZEQ A;  3N1Y C;  4WWM A;  1TIF A;  3H8H A;  3Q8A A;  3NG0 A;  5I4D A;  4NQK E;  4KIK B;  2V3P A;  4B9K A;  3L16 A;  2PEA A;  4AM1 A;  4GOC A;  4HK2 A;  1T0R C;  3S2A A;  4KKI A;  4LNN A;  1XLQ A;  2BB5 A;  3AV8 A;  4GDL B;  1L0V B;  1JQ4 A;  1E10 A;  2V4L A;  4N59 A;  2ZCC A;  3TJP A;  2OED A;  3IG5 A;  2EEL A;  3AE1 B;  5DPS A;  2DHZ A;  4NQL B;  5E6O A;  5IO9 A;  1N63 A;  1FRD A;  1R8G A;  5E6N A;  2V4I B;  2DNF A;  2NCN A;  3NRZ A;  3VUX A;  1JCK B;  3L13 A;  4WJQ A;  4MAC A;  4ANX A;  1MHH E;  2EKI A;  2WDQ B;  1YIW A;  4KVG B;  1QH4 A;  3EC8 A;  2KJ6 A;  2GWC A;  3T3N A;  5AZG A;  3Q8E A;  1FXI A;  4ANU A;  3HUI A;  3B9J A;  1D5X C;  3ZNI D;  2PJH A;  3KVF B;  3M63 B;  4D2K A;  1H4R A;  4RM8 A;  1WFY A;  3MC8 A;  2WXJ A;  3SFE B;  1S1Q B;  2KAN A;  3TEW A;  1V2Y A;  5JHA A;  3VAW A;  3QIJ A;  1WYG A;  2L52 A;  4WWO A;  1YJ1 A;  4I6P A;  3P4P B;  1WGR A;  2G9H D;  1R4M I;  2KNB A;  3VRB B;  2PE6 B;  5LNK 1;  1A5R A;  2IND C;  2G4D B;  2W9N A;  4IWO A;  1WXM A;  2KXJ A;  4F1S A;  5DCN A;  3RNB C;  2PVG C;  2AQ3 B;  3WAM A;  1WZ0 A;  1XLN A;  3PLV A;  4LJO B;  4IKG A;  3VHT C;  2BTE A;  4NPN A;  3NHE B;  2LXA A;  2BVC A;  4DBG A;  2MW5 A;  1TYG B;  1B9R A;  2K9X A;  4DHZ E;  4MT5 A;  2KFJ A;  3MC0 B;  4XC2 A;  5HKH A;  4EOY A;  4EE2 A;  3RYT A;  1WXV A;  1QIL A;  4LNO A;  4IM2 A;  4DDI D;  4HKZ E;  4RF1 A;  3LN7 A;  1V1O A;  4Q2J A;  4W9H A;  1V1P B;  4S17 A;  1C78 A;  2LI5 A;  1Z2M A;  1SE2 A;  1K52 A;  4X57 B;  1EU3 A;  1OTR B;  2BKF A;  2KFK A;  4RGO S;  2ZNV C;  3TEZ A;  3DPD A;  3NZU A;  4KDL B;  1RL9 A;  1E9M A;  1L7Y A;  4A9A A;  3UGB B;  3N1Z C;  4WWP A;  3P2B A;  3TCA A;  3KYD D;  3APC A;  2IBI B;  4YTN B;  5D3I B;  2RDG A;  2FIF A;  2V0G A;  1HTO A;  4ZRP A;  2FBW B;  3AEC B;  4FJZ A;  4LLG M;  2GBJ A;  2C9W B;  4IM0 A;  2GBR A;  3Q6B A;  4ANW A;  4K3B A;  2LUM A;  2UWQ A;  2GBM A;  1D3Z A;  3VUY A;  3APD A;  1F0Z A;  4N6E B;  1FNW A;  1V86 A;  3MJ5 A;  3SD5 A;  3QAQ A;  5CHF A;  3AE8 B;  2WXK A;  2WYQ A;  3EEC A;  2DEN B;  2NS5 A;  3LYY A;  3LXF A;  4US9 A;  2PE9 A;  3K9O B;  1T0Y A;  4BHL A;  4GVY A;  3P63 A;  2RPV A;  4MGI E;  2OJW A;  1TZO A;  4JL9 A;  4K7S A;  2DYO A;  1HA5 A;  4J6I A;  2CU1 A;  1YD8 U;  3GB1 A;  2ZCB A;  2AQ1 B;  3GP7 A;  5BYR A;  5KHQ A;  3OG5 A;  4YXD B;  5BMG A;  2WNM A;  2FCS A;  1L4D B;  2MEK A;  1J7B A;  1B1Z A;  1C77 A;  2N1V A;  3PRZ A;  4FJY A;  4GVZ A;  5J18 A;  2KC1 A;  2MP2 B;  4BBN C;  3Q3M C;  4W9F A;  1L4Z B;  5G5G A;  2MLB A;  3ONS A;  4PS7 A;  2KYW A;  2I38 A;  2IGD A;  2L0T A;  2MP2 A;  1JAL A;  3KW5 B;  4NY0 A;  4NJ7 A;  3ZW3 A;  3DDC B;  5H8Y E;  1VJK A;  2Y5B B;  3U7D A;  1F2R C;  1L0X B;  2FAZ A;  3VTU A;  2BBC A;  3KYC D;  1QOA A;  2BW2 A;  3U52 E;  4HEA 1;  4GB9 A;  4AWJ A;  2WXF A;  4PK1 A;  3H7P A;  1I7H A;  4MJS B;  2MJE A;  3R2T A;  1N60 A;  4TQ1 A;  1R4N B;  5JXV A;  4C00 A;  4JWS C;  3GOE A;  3ZXR A;  2BYV E;  3PZ7 A;  4G50 A;  4TQ0 A;  2KMM A;  3PGE A;  2M17 A;  3Q14 C;  3UI3 A;  1CJE A;  3L10 B;  3MJW A;  2WXN A;  3B2G A;  1ZXH A;  2XNA C;  3AEG B;  3URY A;  2MJD A;  2L76 A;  2G4S A;  3SDL C;  2WDR B;  1KLU D;  1V97 A;  4S0R A;  1WM2 A;  4EUT A;  3N3K B;  1V6E A;  1YJI A;  2ON8 A;  4RGN A;  3WAP A;  3V3X A;  1NYQ A;  4MEM A;  2WXH A;  3DHI C;  4JGH B;  4XGA B;  4HLE A;  1LGR A;  1SJE D;  4G0N B;  1MFW A;  4GIV A;  4K1R B;  1WWT A;  1EWY C;  2MHJ A;  3I57 A;  2L0F A;  2WU5 B;  2JWZ A;  4M0W A;  4W9E A;  3TEX A;  3JW0 X;  2QJL A;  2WWZ A;  3PRE A;  2KN5 A;  4BOZ B;  3GZN B;  2D3A A;  2I1J A;  2PVO D;  3A9K B;  2IJ0 A;  1XF5 L;  1VLB A;  4B95 A;  1FIQ A;  4B6W A;  3C8Y A;  2KK8 A;  5IA7 A;  2WXR A;  3PPA A;  1DOY A;  1GB1 A;  3KQ4 A;  5D2M B;  1PUT A;  1TY2 A;  2PTL A;  3A9K A;  2KD0 A;  3RUI B;  1VZ7 A;  3PRM B;  1Q10 A;  1ZDV A;  4ITK A;  4N9F 4;  1ZXI A;  3VR8 B;  3PV1 A;  1I4H A;  2KDI A;  2LVO A; 
#chains in the Genus database with same CATH homology
 2GLS A;  2D3B A;  4LNF A;  4LNK A;  2LGS A;  2D3C A;  2GWD A;  4LNN A;  4LNO A;  2QC8 A;  1HTO A;  3FKY A;  4BAX A;  4ACF A;  1HTQ A;  1F1H A;  3LVW A;  4HPP A;  1F52 A;  2D33 A;  1TT4 A;  2WHI A;  4S0R A;  4XYC A;  2WGS A;  2D32 A;  2GWC A;  3LN7 A;  4LNI A;  1V4G A;  3ZXR A;  3NG0 A;  3IG5 A;  2BVC A;  1VA6 A;  3NZT A;  2D3A A;  4S17 A;  2OJW A;  3ZXV A;  1FPY A;  1R8G A;  3LN6 A;  3IG8 A;  3LVV A;  2UU7 A;  1LGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...