2UU7A

Crystal structure of apo glutamine synthetase from dog (canis familiaris)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
370
structure length
370
Chain Sequence
b'TSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKGVEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Crystal Structures of Mammalian Glutamine Synthetases Illustrate Substrate-Induced Conformational Changes and Provide Opportunities for Drug and Herbicide Design.
pubmed doi rcsb
source organism Canis familiaris
molecule tags Ligase
total genus 112
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2uu7A01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2uu7A02
2D3CA 1HTOA 1LGRA 3ZXRA 3FKYA 3ZXVA 2D3AA 1HTQA 4HPPA 2WHIA 1F1HA 4S17A 2OJWA 2WGSA 4LNFA 4LNIA 4XYCA 1FPYA 2UU7A 2D3BA 2GLSA 4LNOA 4LNNA 4BAXA 4ACFA 4S0RA 4LNKA 2LGSA 1F52A 2QC8A 2BVCA 3NG0A
chains in the Genus database with same CATH superfamily
3M95A 1EO6A 2ZJDA 2PE6B 4GOCA 2MRPA 3TSSA 1V81A 3RNFC 2WQYB 2VH1A 2LJ5A 4W9CA 4D2KA 3GE3C 3VAWA 1OQQA 1SIFA 2LGSA 4HCNB 1XLPA 2V4LA 3NS8A 1LO5D 3I9V1 3JW0X 2Q5WD 5IOIA 1E8ZA 5EDSA 4MGZE 3WIMA 2KDFB 2WLBA 4GIVA 1TKYA 5G5GA 4LJOB 4RFBA 1UGMA 4URKA 1AYFA 3B2GA 2HTME 3VFKA 4CO7A 1L6UA 2DWQA 4WAFA 4P1CC 1SE9A 1DOYA 3LJ3A 4USAA 1K8RB 2G4DB 3DREA 2JZ3B 2DYMA 2LVPA 2KANA 2O6VB 1WZ3A 4KDIC 5HHDG 3E56A 1YD8U 3ABVB 4NAWA 1P0RA 4IC7B 4YSYB 3V6EB 3NRZA 3APCA 1TZOA 1WM3A 3I3TB 4YTMB 4NZLB 2KMMA 3IXSA 1OGWA 3N20C 2ZW1A 3IG3A 1QQRA 2N9PC 2K6DB 1RLFA 4HEA1 4OVVA 1P3QU 4A90A 1E5WA 4CQNA 1FNVA 1V6EA 4DHZB 3PZ8A 2V0GA 3I57A 1L5PA 4KZ0A 4A8XC 1BT0A 3SFEB 4W9IA 1M94A 1IPGA 2ONQA 2O2VB 3UINB 2DAJA 2WX1A 4US9A 3R3MA 4FN2A 2W82A 4J3OD 2V1YA 3KWLA 1WGKA 2D33A 2LZ6A 2WXJA 1C76A 4HPMB 4LNKA 4C00A 2JQRB 1WYWB 1DOIA 1YOVB 5D94A 3WAOA 2IYDB 1C77A 4TKNA 3VTWA 4C4VB 5MPOA 3AE2B 4IM3A 3AU5A 3DWGC 3QJZA 1WY8A 2K8CA 3I63C 2INPE 4A55A 3VUXA 5G2NA 1IP9A 3AU4A 5D2MB 3W5UB 4RF0A 1E90A 4C7ZA 2KX3A 3DVNV 2BPSA 2JPHA 4W9GA 2DZMA 4YWGG 4GDLB 2PMVA 5G5HA 2KQ7A 3P4QB 4EFOA 5IO9A 4PK1A 2CU1A 2FCNA 1JWBD 1V86A 5IKCM 1FPYA 1RAXA 2XK5A 3B6RA 3L4PA 2EKEC 3KWVA 2MLBA 4LDTB 2IO0B 2NR2A 1P98A 3RFZB 3ENEA 3NZUA 1ZKHA 3X23A 2BS2B 3WAPA 1PUTA 3Q8EA 4DXGA 4WWNA 2JY6A 2M4NA 3IAM1 3RNCC 2IGGA 4NAMA 2CU3A 3PS6A 3GS2A 3P4RB 2KVRA 4NJ6A 1TZ1A 5H8YE 4NQKE 5HFYA 2E3TA 2D3AA 4TV3A 1QH4A 4LK0M 1WZ0A 3NOBA 4KSKC 2WX0A 3DOWA 4MT5A 1AARA 4GB9A 2CS4A 5EE1A 2X38A 4RM8A 3WANA 5L95C 1VA6A 4HROA 2PIAA 3ML9A 3B9JA 4WWOA 2IBIB 1WI0A 2HD5B 1V9JA 3X0WA 1JWUD 2M1MA 4HVBA 4KIKB 1ZDXA 5CHFA 2CRKA 3GOEA 3U52E 3RI7C 1E7PB 1WE7A 1ZOYB 4ACFA 3HHMA 1S3SG 1UUPA 1EU4A 1KH0A 1F77A 4BG4A 1XD3B 5CX3A 3ZTCA 2DBYA 1V1PA 3NG0A 2JWZA 2BWFA 2D3CA 2HDEA 2MP2B 4RMAA 2JZPA 2NMQA 2WWZA 2O6VD 2PW9A 1M15A 2UU7A 2D3BA 4RM9A 4HCPB 3NVYA 5D3DA 2WXNA 1TGZB 1YN3A 5GMVA 1VDVA 1N61A 2M56B 4IM2A 5AUIA 4DWFA 4BKTA 1K50A 3A1QB 3L54A 4MM3A 2OJRA 2D32A 2BS3B 3V61A 3ONSA 3ZRCA 3ML8A 2BWES 3ZNZB 4AP4C 2D2QA 4YL8A 4W9FA 1KJTA 3SFDB 4P16A 2H89B 2KNBA 2WXLA 2XEWA 2ZPNA 1TS4A 2L00B 2RDBC 1A70A 2JT4B 3AECB 2BTEA 4DQOC 1C4PA 1ZXHA 1YQ3B 1Q1OA 3KUDB 2KO3A 4JWSC 2D11A 2AYOB 2JF5A 1D5MC 2MBBB 2WU2B 1KRHA 5E6OA 1GB1A 4F7ZA 4ANUA 1MJDA 1DGJA 2ASQA 5H92C 4IWQA 4LJPB 2J52A 2LXCA 3SU8X 2PLPA 2PE9A 5DPWA 4HDOA 4L23A 1WGDA 1UELA 3L16A 1PDXA 1FFUA 2IY0B 4BAXA 4AJWA 4RGTA 1YMHE 2REXA 3W1YA 1WIAA 2L32A 4L2YA 3U8ZA 1VD2A 4M02A 2FIFA 4K3CA 1WJNA 3PT2B 2UYZB 2LRUA 3AXCA 3HUIA 1NVID 1SSNA 1EF1A 3LXFA 1ET6A 5J17A 3LDZE 2KFKB 3AH7A 2K1FA 4LDTD 3ZXVA 2KDBA 3VUYA 5CTRC 2N0SB 2WHIA 3A9KB 4BKGA 2Z59B 4XDCA 1WYGA 4M01A 1CZPA 3NVVA 2AWTA 3MFGA 1WF9A 3E9SA 2PVGC 3OWEB 3AEBB 1FMAD 2VZKB 4MSQB 1FFVA 3MHZA 2WU5B 2IGDA 4TQ1A 5J18A 2KDMA 2LRWA 4BFRA 2FAZA 1EU3A 1I4PA 1VJKA 2BYTA 2D5GA 1UF0A 3KLSX 1GAQB 1TBEA 3BIID 4IM0A 3IT4B 2AQ1B 1CRKA 4OVZA 1LFDA 1KFYB 3N30A 1WXAA 2V9HA 3BYTB 4NPNA 2DYOA 4RF1A 3R7QA 1P50A 1C3TA 3TL5A 1BMLC 2KQSA 2AQ2B 3W1SA 4MSMB 1R4NB 4A20A 2LGDA 3Q3MC 2OJWA 2GWCA 2BKFA 2QIEB 2HJ1A 4ZRKA 3NZTA 3BZDB 4B6WA 3AE5B 5T8IA 1JCKB 1WJ6A 2YEPF 3O13A 4RCOA 2KJ6A 3NY5A 2AL6A 3DVNU 3RMKC 1ROEA 3AMZA 5I4DA 4HPLB 4KVGB 2AEHA 1RRBA 1JROA 3ZKJC 2CJOA 4YSXB 3DWMA 4ZYSA 1TS2A 3ZQ4A 4KGRA 1HZ6A 1E10A 1ISNA 4NAWB 2WYQA 3U4EG 1P9DU 1UWMA 1ZW7A 1GPXA 1SXTA 5JHBA 5D3IB 5BO4B 2IGHA 1C79A 2JX5A 1I4XA 2V3PA 2PJHA 1XF5L 3L10B 4BKSA 2N7DA 1XEEA 4BZAA 1N5XA 3V62A 2DLBA 3HVDA 2HJ8A 3C8YA 3RYTA 3NVZA 2I38A 2NVUI 5GXGB 3PPAA 4I6PA 3UIOB 2W54A 1RFAA 4XWWA 3LN6A 1GC6A 4BBNC 4J6IA 2GI9A 4FADA 2FUG1 3AE1B 4JIOU 4CHKA 4GSWA 2I2YA 4ZRIA 2LHEA 3MJWA 4N9F4 4A3PA 2A4ZA 4MELA 2MWSB 3UQBA 2KWUB 3VHTC 5J99A 1H4RA 3NZ3A 4JPSA 3S2AA 5DPTA 5AEKB 2YEPB 4WJNA 1C4AA 1T0QC 3TEYA 1B9RA 1QILA 4PS7A 3JQ3A 4US8A 1N6ZA 2JRHA 2NCNA 4HWIB 1UGJA 3P63A 3M63B 1WR6E 2KK8A 1P7FA 2KTFA 3NVWA 4KV2A 2HTHA 2L3ZA 4GW2A 3EGRA 2KKCA 3ZRFA 2WXFA 5G55A 1EF5A 4GGQA 4JLCA 1DOXA 1WE6A 5C23A 4WJQA 3ZDMC 4NNJB 4PS3A 2IO3B 1B1ZA 4S0RA 1V49A 2DHZA 3OAWA 2WDVB 4WAAA 3BINA 3I5JC 1VRAB 3M3JA 2XK5B 2BB6A 4W9DA 1DYQA 4MGYE 3QC8B 1E6EB 2NS5A 5IN7A 1IBXA 1XLQA 2Y5PA 2OHFA 2C7MB 1ACCA 5DPRA 1FRRA 2VZKD 4G0NB 4BBNF 2SEBD 3LVVA 3VH4B 2KACA 1OEYJ 2WXMA 2V4IB 3A4SC 4MJSB 3HRDD 2QILA 3IFWB 3Q8AA 1WFYA 3EECA 2LUMA 2L8JA 2WDTB 3Q8BA 2VH2A 1GG3A 2XNAC 3CSFA 3BK2A 4LNNA 3U7ZA 3QK0A 2LEKA 3K9OB 1J0GA 1FEHA 1Z2MA 1L2NA 3R66C 1FCLA 3VTUA 3KVFB 5BYSA 1E0ZA 1YIWA 1C1YB 2JRIB 5J2RA 1WGYA 5BMGA 1TT5B 2JZZA 1TS3A 1WGGA 4IW0A 5LXHA 1GC7A 2Z8LA 3LB8C 2M17A 3ZXRA 3DBHB 4QAYA 3RCZA 4EEWA 4KKIA 1N63A 5EE9A 1WMHA 5LNK1 4OZAA 3TJPA 3LN7A 3AE4B 1T5XD 4WURA 5J9AA 4XC2A 5JH5C 2LWPA 2V3SA 1F2RI 4DDID 3D32A 1SJHD 2KZRA 4GU2A 2FNJB 3KW5B 3AE8B 3NJTA 1VZ6A 4X57B 1HTQA 2BBCA 1XLNA 2TSSA 3ZVVA 4A9AA 2DYBA 3PTFC 1WJ4A 4XX5A 1LQBA 3BY4B 5C3JB 2K9XA 3JYUA 4MM3B 2LD9A 2QHOA 5IA7A 1L0VB 2PVOD 1XQQA 2ZCCA 3H1UA 1V80A 1F9JA 5FR3A 4IUMB 1U6RA 4H2AA 1QOGA 1R4MB 1N60A 2MBEA 2GRIA 1WH3A 2GB1A 3U7DA 3H8HA 2R2QA 2MHJA 3WAMA 2MQJA 5BMHA 3VQIA 1JALA 4UDUC 3ZLZA 1TS5A 2WXRA 2JVCA 3CSTA 4B95A 2FBWB 4KX6B 2N7EA 4AS1A 5LXIB 1TT4A 3QIJA 4W9LA 3V60A 1L4DB 4BOZB 3B1LX 1PYWD 3PZ7A 1WRIA 3BVZA 1WXMA 3DPDA 4OW0A 5FKAC 3GB1A 4N6EB 3IAS1 3TEZA 1FXIA 4EZKA 3PRPB 1CMXB 2QEJC 3DBSA 1I4RA 4JWUC 2LFIA 4HK2A 4IWOA 3ZW3A 2ZNVC 1ET9A 2RPVA 3RNBC 1NENB 2W9NA 2Y5BB 4REZA 3CWIA 2D3GA 2KFJA 3NZSA 3T3NA 3RN9C 1I42A 2LUEA 3HM3A 1G0WA 4ZRJA 1V5TA 4IWPA 2ZVOA 3FAHA 2WDQB 2O2VA 1NBFC 3URYA 1F52A 2KWDA 3K9PB 2AX5A 1XLOA 1JRUA 4OVUA 1P7EA 4A6QA 3LVWA 2KWCA 2L05A 4ANXA 4HKZE 3AB5A 4ZHOA 2JXTA 4G11A 1A5RA 3AULA 2KHWB 4ICUA 5C2TB 2BKRB 2DAFA 4W9EA 3C19A 3DBHI 1KLVA 2N1VA 2J42A 2KLCA 1FRDA 1L4ZB 4HJKA 1E8WA 3TIXA 4K7UA 3AN1A 3JSVB 1D6EC 4LCDE 5E6PA 2IJ0A 2QSDA 4EE2A 2XBBC 2H88B 1SJED 1PQSA 3IG8A 3FILA 2KWVB 2K5PA 2DX5B 3ZNGC 2BW2A 2MBQA 1HTOA 2KN5A 3AE9B 3RPFC 2NBUA 4Q2JA 4W9HA 1PGAA 3ECIA 1I4GA 4NQLB 3SEBA 3TBLD 2KOXA 4AOFA 3P4PB 4I6LB 2N9XA 1EUVB 4LTUA 2BYVE 1GB4A 1SEBD 2FCQA 3ZJVA 2QMTA 3DHIC 4RH6A 5LLIA 1UWXA 3M62B 1L7YA 1R4NI 4ITKA 3VR9B 1FM0D 1OTRB 3MJ5A 4PS8A 1MG4A 2GLSA 1RYJA 2INNE 3AV8A 5BYQA 3FC4A 1JQ4A 3GP7A 2MJ3A 1MHXA 1E9MA 5JHAA 2DZKA 3Q3FA 4KDLB 3U2SC 1FCCC 4IDIA 3TEXA 4NY0A 4G3XB 3V05A 1TKEA 2JWUA 4C80A 2RD0A 2IO2B 1V8CA 4KIKA 1WSPA 3DCGA 2J4XA 2LGIA 4XZ4A 2DNFA 1YNTE 2JSVX 1VR9A 3A9JA 1IGCA 3DQVA 1TY0A 3BVGA 4ICVA 3V6CB 3RUIB 3VRAB 5BMIA 3T8MA 1T0YA 2RGFA 4FULA 3L2EB 4WIPA 1I35A 4E74A 1HXYD 3N32A 2EELA 4M0WA 4ASWC 4JX1C 3Q8FA 4TQ0A 1WXVA 1V97A 2ZNVB 4ZOHC 1KTKA 4CYEA 2KTRB 2GOWA 3AE6B 1ZDVA 1C4CA 3W2DA 1JMLA 2RMMA 1JW9D 3CMMB 3KUZA 3R8BA 4DXFA 2MBOA 3KUCB 4KGTA 2NPTA 3PLVA 1K53A 3Q3NC 1SE4A 3PLUA 3Q14C 2WXKA 2ON8A 1GNUA 3LYYA 1Q10A 3UQAA 5IP4D 1HZ5A 2PKOA 3V3XA 3N3KB 3RD2A 4ZRPA 3PZDA 2PTLA 3PGEA 1NYRA 4OZBA 2RSUA 1XCTL 1N5WA 3JPZA 1Z5SB 1VZ8A 2KMCA 3ZNID 3N1ZC 4MACA 1G6JA 2NBWB 3Q3JA 1F0ZA 3JU5A 3T9LA 1TKGA 1GOZA 5AZHA 3HK0A 3RULA 1FNWA 4RF6A 1OQRA 2HE7A 4WQOB 1BUIC 2N4FA 2ZEQA 2KJRA 1NYQA 3PHWB 1S1QB 1D5ZC 3ZJUA 1VZ7A 3QARA 2WNMA 1K52A 3SD5A 1PGXA 3GZNB 4PT5A 1Q5WB 1L6VA 4W9KA 2N1WA 2G3QB 2C9WB 1IUEA 4LNOA 3KH0A 2DENB 1E8XA 2E6XA 2BVCA 2GBMA 1ZE3D 2BF8B 3TEWA 3BK1A 3ZDTA 3O65B 2EKIA 4DHZE 2QDFA 4TSSA 3W5VB 5FR6A 1F1HA 4JGHB 2LGYA 4EZJA 2L0FA 4LNIA 3DBLB 2WXPA 3VRBB 3EHVA 1C78A 3MHSD 1SE2A 3DBRB 4ZDVA 1T6BX 3A9KA 2L83A 5AUKA 2C5LC 2KLGA 1SD0A 2BQQA 4FBJB 1YN5A 3B08A 5CHVC 3TUOA 4GLSC 1J7BA 3BWUD 4TMAB 1KOTA 4RF9A 2G4SA 2QCZA 4G50A 1TTNA 3M10A 1YX5B 2WXHA 3VDZA 3ZNHB 1E7VA 2NTSA 1WMHB 2B3AA 3AEFB 3VH3B 2K22A 2J0JA 4M8MA 1WXSA 2LXAA 3AEGB 5DPSA 2WXIA 4E71A 2FIDA 3TMPB 3IVFA 3BYYB 4FHKA 2PEAA 4FHJA 1TJEA 2INCC 1HQRD 2A5UA 1ZP0B 3CF6E 2BGFA 2MX2A 5KHOA 2NBVB 2LHDA 4GXBA 2LJIA 3AM9A 1XO3A 1KM7A 3APDA 4BKSD 4P6VF 1ZGUB 1AW7A 3Q69A 1CK1A 1MVKA 1WX8A 2LMCA 2FCMA 4ZYNA 4LNFA 3DVGY 2CR5A 2WDRB 3VVWB 2WP9B 2C7HA 1V5OA 4P1BC 1E7UA 2BT6A 2M8SA 1JRPA 3AEEB 2J1QA 1R4MI 3EUB2 3H7PA 4JE3B 2JXXA 3WA0A 1JWSD 3AEAB 4FA6A 1QLBB 3AI5A 1RL9A 2W55A 3QA8A 2KMAA 2CJNA 2CHZA 3A33B 4AQ7A 2WXQA 1F2RC 2SAKA 1WGRA 3U30A 4A3OA 3OJ4B 1GUAB 2L52A 1FO4A 2KN4A 3SHQA 4GW0A 2WXOA 1N62A 1H8CA 2EMTA 2OOBB 1VLBA 1MPEA 2I1JA 5AZFA 4HKQA 2L1AA 3ZJTA 3QHTA 2W3SA 2ACZB 4HDQA 5D6JB 2BYFA 3UGBB 3SR6A 4YTPB 2CHXA 4GDKA 1OFFA 2KD0A 1V1OA 2J0MA 2KJHB 4JQWC 4DDGD 1BG0A 2JUOA 2R2OA 2K0PA 4O1NA 4E3CA 4GVZA 3ZTDA 4F1SA 3BVMA 4BG4B 1QZEA 3UIPB 1E8YA 2N9EB 1V1PB 3L2DA 4FJZA 5KHQA 1BXTA 4II2B 5AZGA 5JXVA 3P4SB 1WRDB 3W1SC 3UF8A 4PYUA 1J7AA 2RR9A 1KLGD 4DK5A 3L17A 4BVUC 2GWDA 2KVZA 4ANWA 2KC2A 1YJIA 1P52A 1OEYA 1XT9B 4M8NA 2V3NA 4RF8A 1CQVA 1UZXB 3IT6B 2LASA 3H6NA 1HA5A 2R61A 2Y3AA 3HVZA 4R3DA 2WS3B 1UH6A 3QQ8B 2CKHB 1AN8A 2D10A 1VCBA 5EE0A 1LXDA 3HM6X 2D07B 5HI1A 2N9KA 3FILB 2EMSA 1YQ4B 1UNSA 3J9CA 4EKUA 2GBKA 2ZZPB 3QAQA 4WJOA 3TCAA 2INDC 3OG5A 2MA9B 1UBIA 1LM8B 2YVCA 1D4BA 2N7JA 3DRBA 1AWDA 3APFA 4AUQC 2KDEB 1MFWA 2O6VA 3VXWA 2KQ4X 3Q3OC 4Q2RA 1P1AA 4IOIE 1PGBA 4YXDB 1T0SC 3PSEB 4GMVA 1KF6B 2AQ3B 3RZFA 4K3BA 4YTNB 4ARIA 4XGAB 3N1YC 4EOYA 2MJEA 4KKJA 2AL3A 3EC8A 1WJUA 2K25A 1FXTB 4MJSA 1MG8A 2KDIA 2XN9C 1ENFA 4B0EA 3SDLC 4KGSA 3ZUNA 3L13A 2FUHB 3FKYA 3ZYYX 2IZVB 2MJDA 3VR8B 3RZWC 1ZPSA 4WWPA 3A4RA 1SBBB 2BB5A 4DHJB 4AJYB 2FCSA 3MC9A 1WXQA 1WM2A 3QCAA 2MH7A 1YQBA 2DZJA 3C0RB 5EE3A 4K81A 4RGOS 1XCQL 3PHXB 4NJCA 2MEKA 2J53A 3RNGC 1M4VA 1D3ZA 1Y8RC 3KYCD 3DHGC 2M0XA 3R2TA 3VTVA 4WQMA 1R7SA 2FE8A 4XE0A 4RF7A 2M19A 3A9JB 5BYRA 2K3UA 4WWMA 1T0RC 3P42A 3Q6BA 2OEDA 1I0EA 4C4VA 4WJPA 2VRRB 1NDDA 1L0YB 2BYEA 2Z0DB 3DHHC 4M0WB 2IDYA 4B0MA 4FJVB 3QWZB 5D7GA 1TY2A 4Z9MA 4ZHPA 3Q8CA 1QF6A 2JYTA 1QOAA 4F8CB 2GMIC 1SE3A 4GDLA 1QK1A 3WALA 2KYWA 3P1MA 5JZEB 3RNAC 2C60A 1WX9A 3AE3B 3R7RA 3PV1A 1FD6A 2NPTB 5DCNA 2J0KA 3H9DA 3UI3A 4HJGE 5HG2A 3RNEC 5C1ZA 2CHWA 1I7HA 2GBRA 2C7NB 2Z0EB 2L0TA 2DZIA 1HE8A 3DVGX 1WGHA 4ZRQA 2K8BA 3GE8C 4M00A 1WWTA 4PYZA 1STEA 3IG5A 2G9HD 4IKGA 4MGKE 3MTNB 2B76B 4NJ7A 3ZIMA 1NI3A 3MP9A 1EM7A 1XXGA 4N59A 3IHPC 1TYGB 4DBGA 3EFCA 4RGMA 3QX1A 1K51A 3EA6A 1SB3C 4L1BA 5FK9C 2LVQA 1UD7A 1IGDA 3PRZA 3WCQA 3AE7B 4RGNA 4K7SA 1FXAA 4FJYA 4MEMA 3H7SA 3GZNI 1LGRA 1C9FA 1JWMD 1YX6B 1SF0A 2IPKD 4IG7B 2JU6X 2K8HA 4XYCA 3PRMB 1J7CA 3T3OA 1NEKB 2MP2A 1TIFA 4WH4A 1NI2A 4EZLA 2IO1B 4BHLA 1I4QA 3HIZA 2WXGA 1HEZE 4W9JA 3B2FA 1QOFA 4HRSA 3L08A 5IAAC 2KAJA 3PREA 3ZO5B 3IBEA 1I4HA 4MDKE 3DBLI 2ZVNA 3ALBA 2KX0A 2N9LA 2I1KA 3R2IA 3DBRI 2G45B 1ZXIA 3MC0B 4KZCA 4BOSC 1EWCA 1MI0A 3A1QA 3Q2AC 5HKHA 2RDHA 4HXDA 4K1RB 1L0XB 2ZW0A 3JSVA 2RPQA 2MBHA 3OJ3A 3PVLA 1QT9A 5TR5A 5CHWA 4II3B 3OLMD 2L7RA 1RM6C 4MH8A 4I6NB 3MC8A 2RDGA 3NHEB 2ICIA 1YJJA 2LGXA 2LVOA 4KSLC 1IYFA 1J8CA 2MW5A 1X1MA 4DHJD 2MCNB 1R8GA 4FXCA 3W9CB 2IY1B 4AM1A 1SIJA 4N58A 2MSED 4C56C 3JU6A 2QC8A 3KYDD 2L76A 4RNAA 4OHJA 1Q0WB 4MH0E 2GBNA 1CJEA 3P2BA 1OQYA 2M0AA 4C7YA 1ZUD2 2JYEA 1GJZA 1V4GA 2ZCBA 2LI5A 1MHHE 2YLMA 1QKZA 1RWSA 3NS1A 1RFKA 1WX7A 1U4AA 1IBXB 2QJLA 2K39A 3RT3B 3L0WB 4S17A 4HLEA 2UWQA 1WR1A 5L83A 5TSSA 1JWAD 3ETRA 3H7PB 5E6NA 1T3QA 3N9YC 2J7QB 4JL9A 4LLGM 3N1XC 4XDDA 2X8XX 4P7IA 1Y56A 1VRPA 4MGIE 3CIRB 2Y5CA 1QOBA 4GN1A 2GBJA 3DDCB 3JVZX 2WGSA 2KFKA 2BS4B 4XWTA 1D5XC 3NUHB 1J19A 1V2YA 1ESFA 3VUWA 3AEDB 1EWYC 4AWJA 3B0AA 4B9KA 4ARCA 3L2EA 2KXJA 2NTTA 4YSZB 4TUUA 2KT7A 1UBQA 1SGHA 4EUTA 4HPPA 4YT0B 2W3RA 1YJ1A 4FLHA 2KC1A 1FIQA 3PO0A 1KLUD 3ZGZA 2ZPYA 1YN4A 4GDKB 3EFUA 2PPHA 1FNUA 4ANVA 2KTRA 2G1EA 2K6QA 3KQ4A 1PFDA 4OZCA 5E6JA 4GVYA 4K7WA 4DXAB
chains in the Genus database with same CATH topology
2D3CA 1HTOA 1LGRA 3ZXRA 3FKYA 3ZXVA 2D3AA 1HTQA 2GWDA 3LVWA 4HPPA 2D32A 2WHIA 1F1HA 4S17A 2OJWA 2WGSA 2GWCA 4LNFA 3LN6A 4LNIA 4XYCA 1FPYA 1V4GA 2UU7A 3LN7A 3NZTA 2D3BA 2GLSA 4LNOA 4LNNA 3IG5A 2D33A 4BAXA 1R8GA 4ACFA 4S0RA 1VA6A 3IG8A 4LNKA 2LGSA 1TT4A 1F52A 2QC8A 2BVCA 3LVVA 3NG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3C A;  1HTO A;  1LGR A;  3ZXR A;  3FKY A;  3ZXV A;  2D3A A;  1HTQ A;  4HPP A;  2WHI A;  1F1H A;  4S17 A;  2OJW A;  2WGS A;  4LNF A;  4LNI A;  4XYC A;  1FPY A;  2UU7 A;  2D3B A;  2GLS A;  4LNO A;  4LNN A;  4BAX A;  4ACF A;  4S0R A;  4LNK A;  2LGS A;  1F52 A;  2QC8 A;  2BVC A;  3NG0 A; 
#chains in the Genus database with same CATH topology
 3M95 A;  1EO6 A;  2ZJD A;  2PE6 B;  4GOC A;  2MRP A;  3TSS A;  1V81 A;  3RNF C;  2WQY B;  2VH1 A;  2LJ5 A;  4W9C A;  4D2K A;  3GE3 C;  3VAW A;  1OQQ A;  1SIF A;  2LGS A;  4HCN B;  1XLP A;  2V4L A;  3NS8 A;  1LO5 D;  3I9V 1;  3JW0 X;  2Q5W D;  5IOI A;  1E8Z A;  5EDS A;  4MGZ E;  3WIM A;  2KDF B;  2WLB A;  4GIV A;  1TKY A;  5G5G A;  4LJO B;  4RFB A;  1UGM A;  4URK A;  1AYF A;  3B2G A;  2HTM E;  3VFK A;  4CO7 A;  1L6U A;  2DWQ A;  4WAF A;  4P1C C;  1SE9 A;  1DOY A;  3LJ3 A;  4USA A;  1K8R B;  2G4D B;  3DRE A;  2JZ3 B;  2DYM A;  2LVP A;  2KAN A;  2O6V B;  1WZ3 A;  4KDI C;  5HHD G;  3E56 A;  1YD8 U;  3ABV B;  4NAW A;  1P0R A;  4IC7 B;  4YSY B;  3V6E B;  3NRZ A;  3APC A;  1TZO A;  1WM3 A;  3I3T B;  4YTM B;  4NZL B;  2KMM A;  3IXS A;  1OGW A;  3N20 C;  2ZW1 A;  3IG3 A;  1QQR A;  2N9P C;  2K6D B;  1RLF A;  4HEA 1;  4OVV A;  1P3Q U;  4A90 A;  1E5W A;  4CQN A;  1FNV A;  1V6E A;  4DHZ B;  3PZ8 A;  2V0G A;  3I57 A;  1L5P A;  4KZ0 A;  4A8X C;  1BT0 A;  3SFE B;  4W9I A;  1M94 A;  1IPG A;  2ONQ A;  2O2V B;  3UIN B;  2DAJ A;  2WX1 A;  4US9 A;  3R3M A;  4FN2 A;  2W82 A;  4J3O D;  2V1Y A;  3KWL A;  1WGK A;  2D33 A;  2LZ6 A;  2WXJ A;  1C76 A;  4HPM B;  4LNK A;  4C00 A;  2JQR B;  1WYW B;  1DOI A;  1YOV B;  5D94 A;  3WAO A;  2IYD B;  1C77 A;  4TKN A;  3VTW A;  4C4V B;  5MPO A;  3AE2 B;  4IM3 A;  3AU5 A;  3DWG C;  3QJZ A;  1WY8 A;  2K8C A;  3I63 C;  2INP E;  4A55 A;  3VUX A;  5G2N A;  1IP9 A;  3AU4 A;  5D2M B;  3W5U B;  4RF0 A;  1E90 A;  4C7Z A;  2KX3 A;  3DVN V;  2BPS A;  2JPH A;  4W9G A;  2DZM A;  4YWG G;  4GDL B;  2PMV A;  5G5H A;  2KQ7 A;  3P4Q B;  4EFO A;  5IO9 A;  4PK1 A;  2CU1 A;  2FCN A;  1JWB D;  1V86 A;  5IKC M;  1FPY A;  1RAX A;  2XK5 A;  3B6R A;  3L4P A;  2EKE C;  3KWV A;  2MLB A;  4LDT B;  2IO0 B;  2NR2 A;  1P98 A;  3RFZ B;  3ENE A;  3NZU A;  1ZKH A;  3X23 A;  2BS2 B;  3WAP A;  1PUT A;  3Q8E A;  4DXG A;  4WWN A;  2JY6 A;  2M4N A;  3IAM 1;  3RNC C;  2IGG A;  4NAM A;  2CU3 A;  3PS6 A;  3GS2 A;  3P4R B;  2KVR A;  4NJ6 A;  1TZ1 A;  5H8Y E;  4NQK E;  5HFY A;  2E3T A;  2D3A A;  4TV3 A;  1QH4 A;  4LK0 M;  1WZ0 A;  3NOB A;  4KSK C;  2WX0 A;  3DOW A;  4MT5 A;  1AAR A;  4GB9 A;  2CS4 A;  5EE1 A;  2X38 A;  4RM8 A;  3WAN A;  5L95 C;  1VA6 A;  4HRO A;  2PIA A;  3ML9 A;  3B9J A;  4WWO A;  2IBI B;  1WI0 A;  2HD5 B;  1V9J A;  3X0W A;  1JWU D;  2M1M A;  4HVB A;  4KIK B;  1ZDX A;  5CHF A;  2CRK A;  3GOE A;  3U52 E;  3RI7 C;  1E7P B;  1WE7 A;  1ZOY B;  4ACF A;  3HHM A;  1S3S G;  1UUP A;  1EU4 A;  1KH0 A;  1F77 A;  4BG4 A;  1XD3 B;  5CX3 A;  3ZTC A;  2DBY A;  1V1P A;  3NG0 A;  2JWZ A;  2BWF A;  2D3C A;  2HDE A;  2MP2 B;  4RMA A;  2JZP A;  2NMQ A;  2WWZ A;  2O6V D;  2PW9 A;  1M15 A;  2UU7 A;  2D3B A;  4RM9 A;  4HCP B;  3NVY A;  5D3D A;  2WXN A;  1TGZ B;  1YN3 A;  5GMV A;  1VDV A;  1N61 A;  2M56 B;  4IM2 A;  5AUI A;  4DWF A;  4BKT A;  1K50 A;  3A1Q B;  3L54 A;  4MM3 A;  2OJR A;  2D32 A;  2BS3 B;  3V61 A;  3ONS A;  3ZRC A;  3ML8 A;  2BWE S;  3ZNZ B;  4AP4 C;  2D2Q A;  4YL8 A;  4W9F A;  1KJT A;  3SFD B;  4P16 A;  2H89 B;  2KNB A;  2WXL A;  2XEW A;  2ZPN A;  1TS4 A;  2L00 B;  2RDB C;  1A70 A;  2JT4 B;  3AEC B;  2BTE A;  4DQO C;  1C4P A;  1ZXH A;  1YQ3 B;  1Q1O A;  3KUD B;  2KO3 A;  4JWS C;  2D11 A;  2AYO B;  2JF5 A;  1D5M C;  2MBB B;  2WU2 B;  1KRH A;  5E6O A;  1GB1 A;  4F7Z A;  4ANU A;  1MJD A;  1DGJ A;  2ASQ A;  5H92 C;  4IWQ A;  4LJP B;  2J52 A;  2LXC A;  3SU8 X;  2PLP A;  2PE9 A;  5DPW A;  4HDO A;  4L23 A;  1WGD A;  1UEL A;  3L16 A;  1PDX A;  1FFU A;  2IY0 B;  4BAX A;  4AJW A;  4RGT A;  1YMH E;  2REX A;  3W1Y A;  1WIA A;  2L32 A;  4L2Y A;  3U8Z A;  1VD2 A;  4M02 A;  2FIF A;  4K3C A;  1WJN A;  3PT2 B;  2UYZ B;  2LRU A;  3AXC A;  3HUI A;  1NVI D;  1SSN A;  1EF1 A;  3LXF A;  1ET6 A;  5J17 A;  3LDZ E;  2KFK B;  3AH7 A;  2K1F A;  4LDT D;  3ZXV A;  2KDB A;  3VUY A;  5CTR C;  2N0S B;  2WHI A;  3A9K B;  4BKG A;  2Z59 B;  4XDC A;  1WYG A;  4M01 A;  1CZP A;  3NVV A;  2AWT A;  3MFG A;  1WF9 A;  3E9S A;  2PVG C;  3OWE B;  3AEB B;  1FMA D;  2VZK B;  4MSQ B;  1FFV A;  3MHZ A;  2WU5 B;  2IGD A;  4TQ1 A;  5J18 A;  2KDM A;  2LRW A;  4BFR A;  2FAZ A;  1EU3 A;  1I4P A;  1VJK A;  2BYT A;  2D5G A;  1UF0 A;  3KLS X;  1GAQ B;  1TBE A;  3BII D;  4IM0 A;  3IT4 B;  2AQ1 B;  1CRK A;  4OVZ A;  1LFD A;  1KFY B;  3N30 A;  1WXA A;  2V9H A;  3BYT B;  4NPN A;  2DYO A;  4RF1 A;  3R7Q A;  1P50 A;  1C3T A;  3TL5 A;  1BML C;  2KQS A;  2AQ2 B;  3W1S A;  4MSM B;  1R4N B;  4A20 A;  2LGD A;  3Q3M C;  2OJW A;  2GWC A;  2BKF A;  2QIE B;  2HJ1 A;  4ZRK A;  3NZT A;  3BZD B;  4B6W A;  3AE5 B;  5T8I A;  1JCK B;  1WJ6 A;  2YEP F;  3O13 A;  4RCO A;  2KJ6 A;  3NY5 A;  2AL6 A;  3DVN U;  3RMK C;  1ROE A;  3AMZ A;  5I4D A;  4HPL B;  4KVG B;  2AEH A;  1RRB A;  1JRO A;  3ZKJ C;  2CJO A;  4YSX B;  3DWM A;  4ZYS A;  1TS2 A;  3ZQ4 A;  4KGR A;  1HZ6 A;  1E10 A;  1ISN A;  4NAW B;  2WYQ A;  3U4E G;  1P9D U;  1UWM A;  1ZW7 A;  1GPX A;  1SXT A;  5JHB A;  5D3I B;  5BO4 B;  2IGH A;  1C79 A;  2JX5 A;  1I4X A;  2V3P A;  2PJH A;  1XF5 L;  3L10 B;  4BKS A;  2N7D A;  1XEE A;  4BZA A;  1N5X A;  3V62 A;  2DLB A;  3HVD A;  2HJ8 A;  3C8Y A;  3RYT A;  3NVZ A;  2I38 A;  2NVU I;  5GXG B;  3PPA A;  4I6P A;  3UIO B;  2W54 A;  1RFA A;  4XWW A;  3LN6 A;  1GC6 A;  4BBN C;  4J6I A;  2GI9 A;  4FAD A;  2FUG 1;  3AE1 B;  4JIO U;  4CHK A;  4GSW A;  2I2Y A;  4ZRI A;  2LHE A;  3MJW A;  4N9F 4;  4A3P A;  2A4Z A;  4MEL A;  2MWS B;  3UQB A;  2KWU B;  3VHT C;  5J99 A;  1H4R A;  3NZ3 A;  4JPS A;  3S2A A;  5DPT A;  5AEK B;  2YEP B;  4WJN A;  1C4A A;  1T0Q C;  3TEY A;  1B9R A;  1QIL A;  4PS7 A;  3JQ3 A;  4US8 A;  1N6Z A;  2JRH A;  2NCN A;  4HWI B;  1UGJ A;  3P63 A;  3M63 B;  1WR6 E;  2KK8 A;  1P7F A;  2KTF A;  3NVW A;  4KV2 A;  2HTH A;  2L3Z A;  4GW2 A;  3EGR A;  2KKC A;  3ZRF A;  2WXF A;  5G55 A;  1EF5 A;  4GGQ A;  4JLC A;  1DOX A;  1WE6 A;  5C23 A;  4WJQ A;  3ZDM C;  4NNJ B;  4PS3 A;  2IO3 B;  1B1Z A;  4S0R A;  1V49 A;  2DHZ A;  3OAW A;  2WDV B;  4WAA A;  3BIN A;  3I5J C;  1VRA B;  3M3J A;  2XK5 B;  2BB6 A;  4W9D A;  1DYQ A;  4MGY E;  3QC8 B;  1E6E B;  2NS5 A;  5IN7 A;  1IBX A;  1XLQ A;  2Y5P A;  2OHF A;  2C7M B;  1ACC A;  5DPR A;  1FRR A;  2VZK D;  4G0N B;  4BBN F;  2SEB D;  3LVV A;  3VH4 B;  2KAC A;  1OEY J;  2WXM A;  2V4I B;  3A4S C;  4MJS B;  3HRD D;  2QIL A;  3IFW B;  3Q8A A;  1WFY A;  3EEC A;  2LUM A;  2L8J A;  2WDT B;  3Q8B A;  2VH2 A;  1GG3 A;  2XNA C;  3CSF A;  3BK2 A;  4LNN A;  3U7Z A;  3QK0 A;  2LEK A;  3K9O B;  1J0G A;  1FEH A;  1Z2M A;  1L2N A;  3R66 C;  1FCL A;  3VTU A;  3KVF B;  5BYS A;  1E0Z A;  1YIW A;  1C1Y B;  2JRI B;  5J2R A;  1WGY A;  5BMG A;  1TT5 B;  2JZZ A;  1TS3 A;  1WGG A;  4IW0 A;  5LXH A;  1GC7 A;  2Z8L A;  3LB8 C;  2M17 A;  3ZXR A;  3DBH B;  4QAY A;  3RCZ A;  4EEW A;  4KKI A;  1N63 A;  5EE9 A;  1WMH A;  5LNK 1;  4OZA A;  3TJP A;  3LN7 A;  3AE4 B;  1T5X D;  4WUR A;  5J9A A;  4XC2 A;  5JH5 C;  2LWP A;  2V3S A;  1F2R I;  4DDI D;  3D32 A;  1SJH D;  2KZR A;  4GU2 A;  2FNJ B;  3KW5 B;  3AE8 B;  3NJT A;  1VZ6 A;  4X57 B;  1HTQ A;  2BBC A;  1XLN A;  2TSS A;  3ZVV A;  4A9A A;  2DYB A;  3PTF C;  1WJ4 A;  4XX5 A;  1LQB A;  3BY4 B;  5C3J B;  2K9X A;  3JYU A;  4MM3 B;  2LD9 A;  2QHO A;  5IA7 A;  1L0V B;  2PVO D;  1XQQ A;  2ZCC A;  3H1U A;  1V80 A;  1F9J A;  5FR3 A;  4IUM B;  1U6R A;  4H2A A;  1QOG A;  1R4M B;  1N60 A;  2MBE A;  2GRI A;  1WH3 A;  2GB1 A;  3U7D A;  3H8H A;  2R2Q A;  2MHJ A;  3WAM A;  2MQJ A;  5BMH A;  3VQI A;  1JAL A;  4UDU C;  3ZLZ A;  1TS5 A;  2WXR A;  2JVC A;  3CST A;  4B95 A;  2FBW B;  4KX6 B;  2N7E A;  4AS1 A;  5LXI B;  1TT4 A;  3QIJ A;  4W9L A;  3V60 A;  1L4D B;  4BOZ B;  3B1L X;  1PYW D;  3PZ7 A;  1WRI A;  3BVZ A;  1WXM A;  3DPD A;  4OW0 A;  5FKA C;  3GB1 A;  4N6E B;  3IAS 1;  3TEZ A;  1FXI A;  4EZK A;  3PRP B;  1CMX B;  2QEJ C;  3DBS A;  1I4R A;  4JWU C;  2LFI A;  4HK2 A;  4IWO A;  3ZW3 A;  2ZNV C;  1ET9 A;  2RPV A;  3RNB C;  1NEN B;  2W9N A;  2Y5B B;  4REZ A;  3CWI A;  2D3G A;  2KFJ A;  3NZS A;  3T3N A;  3RN9 C;  1I42 A;  2LUE A;  3HM3 A;  1G0W A;  4ZRJ A;  1V5T A;  4IWP A;  2ZVO A;  3FAH A;  2WDQ B;  2O2V A;  1NBF C;  3URY A;  1F52 A;  2KWD A;  3K9P B;  2AX5 A;  1XLO A;  1JRU A;  4OVU A;  1P7E A;  4A6Q A;  3LVW A;  2KWC A;  2L05 A;  4ANX A;  4HKZ E;  3AB5 A;  4ZHO A;  2JXT A;  4G11 A;  1A5R A;  3AUL A;  2KHW B;  4ICU A;  5C2T B;  2BKR B;  2DAF A;  4W9E A;  3C19 A;  3DBH I;  1KLV A;  2N1V A;  2J42 A;  2KLC A;  1FRD A;  1L4Z B;  4HJK A;  1E8W A;  3TIX A;  4K7U A;  3AN1 A;  3JSV B;  1D6E C;  4LCD E;  5E6P A;  2IJ0 A;  2QSD A;  4EE2 A;  2XBB C;  2H88 B;  1SJE D;  1PQS A;  3IG8 A;  3FIL A;  2KWV B;  2K5P A;  2DX5 B;  3ZNG C;  2BW2 A;  2MBQ A;  1HTO A;  2KN5 A;  3AE9 B;  3RPF C;  2NBU A;  4Q2J A;  4W9H A;  1PGA A;  3ECI A;  1I4G A;  4NQL B;  3SEB A;  3TBL D;  2KOX A;  4AOF A;  3P4P B;  4I6L B;  2N9X A;  1EUV B;  4LTU A;  2BYV E;  1GB4 A;  1SEB D;  2FCQ A;  3ZJV A;  2QMT A;  3DHI C;  4RH6 A;  5LLI A;  1UWX A;  3M62 B;  1L7Y A;  1R4N I;  4ITK A;  3VR9 B;  1FM0 D;  1OTR B;  3MJ5 A;  4PS8 A;  1MG4 A;  2GLS A;  1RYJ A;  2INN E;  3AV8 A;  5BYQ A;  3FC4 A;  1JQ4 A;  3GP7 A;  2MJ3 A;  1MHX A;  1E9M A;  5JHA A;  2DZK A;  3Q3F A;  4KDL B;  3U2S C;  1FCC C;  4IDI A;  3TEX A;  4NY0 A;  4G3X B;  3V05 A;  1TKE A;  2JWU A;  4C80 A;  2RD0 A;  2IO2 B;  1V8C A;  4KIK A;  1WSP A;  3DCG A;  2J4X A;  2LGI A;  4XZ4 A;  2DNF A;  1YNT E;  2JSV X;  1VR9 A;  3A9J A;  1IGC A;  3DQV A;  1TY0 A;  3BVG A;  4ICV A;  3V6C B;  3RUI B;  3VRA B;  5BMI A;  3T8M A;  1T0Y A;  2RGF A;  4FUL A;  3L2E B;  4WIP A;  1I35 A;  4E74 A;  1HXY D;  3N32 A;  2EEL A;  4M0W A;  4ASW C;  4JX1 C;  3Q8F A;  4TQ0 A;  1WXV A;  1V97 A;  2ZNV B;  4ZOH C;  1KTK A;  4CYE A;  2KTR B;  2GOW A;  3AE6 B;  1ZDV A;  1C4C A;  3W2D A;  1JML A;  2RMM A;  1JW9 D;  3CMM B;  3KUZ A;  3R8B A;  4DXF A;  2MBO A;  3KUC B;  4KGT A;  2NPT A;  3PLV A;  1K53 A;  3Q3N C;  1SE4 A;  3PLU A;  3Q14 C;  2WXK A;  2ON8 A;  1GNU A;  3LYY A;  1Q10 A;  3UQA A;  5IP4 D;  1HZ5 A;  2PKO A;  3V3X A;  3N3K B;  3RD2 A;  4ZRP A;  3PZD A;  2PTL A;  3PGE A;  1NYR A;  4OZB A;  2RSU A;  1XCT L;  1N5W A;  3JPZ A;  1Z5S B;  1VZ8 A;  2KMC A;  3ZNI D;  3N1Z C;  4MAC A;  1G6J A;  2NBW B;  3Q3J A;  1F0Z A;  3JU5 A;  3T9L A;  1TKG A;  1GOZ A;  5AZH A;  3HK0 A;  3RUL A;  1FNW A;  4RF6 A;  1OQR A;  2HE7 A;  4WQO B;  1BUI C;  2N4F A;  2ZEQ A;  2KJR A;  1NYQ A;  3PHW B;  1S1Q B;  1D5Z C;  3ZJU A;  1VZ7 A;  3QAR A;  2WNM A;  1K52 A;  3SD5 A;  1PGX A;  3GZN B;  4PT5 A;  1Q5W B;  1L6V A;  4W9K A;  2N1W A;  2G3Q B;  2C9W B;  1IUE A;  4LNO A;  3KH0 A;  2DEN B;  1E8X A;  2E6X A;  2BVC A;  2GBM A;  1ZE3 D;  2BF8 B;  3TEW A;  3BK1 A;  3ZDT A;  3O65 B;  2EKI A;  4DHZ E;  2QDF A;  4TSS A;  3W5V B;  5FR6 A;  1F1H A;  4JGH B;  2LGY A;  4EZJ A;  2L0F A;  4LNI A;  3DBL B;  2WXP A;  3VRB B;  3EHV A;  1C78 A;  3MHS D;  1SE2 A;  3DBR B;  4ZDV A;  1T6B X;  3A9K A;  2L83 A;  5AUK A;  2C5L C;  2KLG A;  1SD0 A;  2BQQ A;  4FBJ B;  1YN5 A;  3B08 A;  5CHV C;  3TUO A;  4GLS C;  1J7B A;  3BWU D;  4TMA B;  1KOT A;  4RF9 A;  2G4S A;  2QCZ A;  4G50 A;  1TTN A;  3M10 A;  1YX5 B;  2WXH A;  3VDZ A;  3ZNH B;  1E7V A;  2NTS A;  1WMH B;  2B3A A;  3AEF B;  3VH3 B;  2K22 A;  2J0J A;  4M8M A;  1WXS A;  2LXA A;  3AEG B;  5DPS A;  2WXI A;  4E71 A;  2FID A;  3TMP B;  3IVF A;  3BYY B;  4FHK A;  2PEA A;  4FHJ A;  1TJE A;  2INC C;  1HQR D;  2A5U A;  1ZP0 B;  3CF6 E;  2BGF A;  2MX2 A;  5KHO A;  2NBV B;  2LHD A;  4GXB A;  2LJI A;  3AM9 A;  1XO3 A;  1KM7 A;  3APD A;  4BKS D;  4P6V F;  1ZGU B;  1AW7 A;  3Q69 A;  1CK1 A;  1MVK A;  1WX8 A;  2LMC A;  2FCM A;  4ZYN A;  4LNF A;  3DVG Y;  2CR5 A;  2WDR B;  3VVW B;  2WP9 B;  2C7H A;  1V5O A;  4P1B C;  1E7U A;  2BT6 A;  2M8S A;  1JRP A;  3AEE B;  2J1Q A;  1R4M I;  3EUB 2;  3H7P A;  4JE3 B;  2JXX A;  3WA0 A;  1JWS D;  3AEA B;  4FA6 A;  1QLB B;  3AI5 A;  1RL9 A;  2W55 A;  3QA8 A;  2KMA A;  2CJN A;  2CHZ A;  3A33 B;  4AQ7 A;  2WXQ A;  1F2R C;  2SAK A;  1WGR A;  3U30 A;  4A3O A;  3OJ4 B;  1GUA B;  2L52 A;  1FO4 A;  2KN4 A;  3SHQ A;  4GW0 A;  2WXO A;  1N62 A;  1H8C A;  2EMT A;  2OOB B;  1VLB A;  1MPE A;  2I1J A;  5AZF A;  4HKQ A;  2L1A A;  3ZJT A;  3QHT A;  2W3S A;  2ACZ B;  4HDQ A;  5D6J B;  2BYF A;  3UGB B;  3SR6 A;  4YTP B;  2CHX A;  4GDK A;  1OFF A;  2KD0 A;  1V1O A;  2J0M A;  2KJH B;  4JQW C;  4DDG D;  1BG0 A;  2JUO A;  2R2O A;  2K0P A;  4O1N A;  4E3C A;  4GVZ A;  3ZTD A;  4F1S A;  3BVM A;  4BG4 B;  1QZE A;  3UIP B;  1E8Y A;  2N9E B;  1V1P B;  3L2D A;  4FJZ A;  5KHQ A;  1BXT A;  4II2 B;  5AZG A;  5JXV A;  3P4S B;  1WRD B;  3W1S C;  3UF8 A;  4PYU A;  1J7A A;  2RR9 A;  1KLG D;  4DK5 A;  3L17 A;  4BVU C;  2GWD A;  2KVZ A;  4ANW A;  2KC2 A;  1YJI A;  1P52 A;  1OEY A;  1XT9 B;  4M8N A;  2V3N A;  4RF8 A;  1CQV A;  1UZX B;  3IT6 B;  2LAS A;  3H6N A;  1HA5 A;  2R61 A;  2Y3A A;  3HVZ A;  4R3D A;  2WS3 B;  1UH6 A;  3QQ8 B;  2CKH B;  1AN8 A;  2D10 A;  1VCB A;  5EE0 A;  1LXD A;  3HM6 X;  2D07 B;  5HI1 A;  2N9K A;  3FIL B;  2EMS A;  1YQ4 B;  1UNS A;  3J9C A;  4EKU A;  2GBK A;  2ZZP B;  3QAQ A;  4WJO A;  3TCA A;  2IND C;  3OG5 A;  2MA9 B;  1UBI A;  1LM8 B;  2YVC A;  1D4B A;  2N7J A;  3DRB A;  1AWD A;  3APF A;  4AUQ C;  2KDE B;  1MFW A;  2O6V A;  3VXW A;  2KQ4 X;  3Q3O C;  4Q2R A;  1P1A A;  4IOI E;  1PGB A;  4YXD B;  1T0S C;  3PSE B;  4GMV A;  1KF6 B;  2AQ3 B;  3RZF A;  4K3B A;  4YTN B;  4ARI A;  4XGA B;  3N1Y C;  4EOY A;  2MJE A;  4KKJ A;  2AL3 A;  3EC8 A;  1WJU A;  2K25 A;  1FXT B;  4MJS A;  1MG8 A;  2KDI A;  2XN9 C;  1ENF A;  4B0E A;  3SDL C;  4KGS A;  3ZUN A;  3L13 A;  2FUH B;  3FKY A;  3ZYY X;  2IZV B;  2MJD A;  3VR8 B;  3RZW C;  1ZPS A;  4WWP A;  3A4R A;  1SBB B;  2BB5 A;  4DHJ B;  4AJY B;  2FCS A;  3MC9 A;  1WXQ A;  1WM2 A;  3QCA A;  2MH7 A;  1YQB A;  2DZJ A;  3C0R B;  5EE3 A;  4K81 A;  4RGO S;  1XCQ L;  3PHX B;  4NJC A;  2MEK A;  2J53 A;  3RNG C;  1M4V A;  1D3Z A;  1Y8R C;  3KYC D;  3DHG C;  2M0X A;  3R2T A;  3VTV A;  4WQM A;  1R7S A;  2FE8 A;  4XE0 A;  4RF7 A;  2M19 A;  3A9J B;  5BYR A;  2K3U A;  4WWM A;  1T0R C;  3P42 A;  3Q6B A;  2OED A;  1I0E A;  4C4V A;  4WJP A;  2VRR B;  1NDD A;  1L0Y B;  2BYE A;  2Z0D B;  3DHH C;  4M0W B;  2IDY A;  4B0M A;  4FJV B;  3QWZ B;  5D7G A;  1TY2 A;  4Z9M A;  4ZHP A;  3Q8C A;  1QF6 A;  2JYT A;  1QOA A;  4F8C B;  2GMI C;  1SE3 A;  4GDL A;  1QK1 A;  3WAL A;  2KYW A;  3P1M A;  5JZE B;  3RNA C;  2C60 A;  1WX9 A;  3AE3 B;  3R7R A;  3PV1 A;  1FD6 A;  2NPT B;  5DCN A;  2J0K A;  3H9D A;  3UI3 A;  4HJG E;  5HG2 A;  3RNE C;  5C1Z A;  2CHW A;  1I7H A;  2GBR A;  2C7N B;  2Z0E B;  2L0T A;  2DZI A;  1HE8 A;  3DVG X;  1WGH A;  4ZRQ A;  2K8B A;  3GE8 C;  4M00 A;  1WWT A;  4PYZ A;  1STE A;  3IG5 A;  2G9H D;  4IKG A;  4MGK E;  3MTN B;  2B76 B;  4NJ7 A;  3ZIM A;  1NI3 A;  3MP9 A;  1EM7 A;  1XXG A;  4N59 A;  3IHP C;  1TYG B;  4DBG A;  3EFC A;  4RGM A;  3QX1 A;  1K51 A;  3EA6 A;  1SB3 C;  4L1B A;  5FK9 C;  2LVQ A;  1UD7 A;  1IGD A;  3PRZ A;  3WCQ A;  3AE7 B;  4RGN A;  4K7S A;  1FXA A;  4FJY A;  4MEM A;  3H7S A;  3GZN I;  1LGR A;  1C9F A;  1JWM D;  1YX6 B;  1SF0 A;  2IPK D;  4IG7 B;  2JU6 X;  2K8H A;  4XYC A;  3PRM B;  1J7C A;  3T3O A;  1NEK B;  2MP2 A;  1TIF A;  4WH4 A;  1NI2 A;  4EZL A;  2IO1 B;  4BHL A;  1I4Q A;  3HIZ A;  2WXG A;  1HEZ E;  4W9J A;  3B2F A;  1QOF A;  4HRS A;  3L08 A;  5IAA C;  2KAJ A;  3PRE A;  3ZO5 B;  3IBE A;  1I4H A;  4MDK E;  3DBL I;  2ZVN A;  3ALB A;  2KX0 A;  2N9L A;  2I1K A;  3R2I A;  3DBR I;  2G45 B;  1ZXI A;  3MC0 B;  4KZC A;  4BOS C;  1EWC A;  1MI0 A;  3A1Q A;  3Q2A C;  5HKH A;  2RDH A;  4HXD A;  4K1R B;  1L0X B;  2ZW0 A;  3JSV A;  2RPQ A;  2MBH A;  3OJ3 A;  3PVL A;  1QT9 A;  5TR5 A;  5CHW A;  4II3 B;  3OLM D;  2L7R A;  1RM6 C;  4MH8 A;  4I6N B;  3MC8 A;  2RDG A;  3NHE B;  2ICI A;  1YJJ A;  2LGX A;  2LVO A;  4KSL C;  1IYF A;  1J8C A;  2MW5 A;  1X1M A;  4DHJ D;  2MCN B;  1R8G A;  4FXC A;  3W9C B;  2IY1 B;  4AM1 A;  1SIJ A;  4N58 A;  2MSE D;  4C56 C;  3JU6 A;  2QC8 A;  3KYD D;  2L76 A;  4RNA A;  4OHJ A;  1Q0W B;  4MH0 E;  2GBN A;  1CJE A;  3P2B A;  1OQY A;  2M0A A;  4C7Y A;  1ZUD 2;  2JYE A;  1GJZ A;  1V4G A;  2ZCB A;  2LI5 A;  1MHH E;  2YLM A;  1QKZ A;  1RWS A;  3NS1 A;  1RFK A;  1WX7 A;  1U4A A;  1IBX B;  2QJL A;  2K39 A;  3RT3 B;  3L0W B;  4S17 A;  4HLE A;  2UWQ A;  1WR1 A;  5L83 A;  5TSS A;  1JWA D;  3ETR A;  3H7P B;  5E6N A;  1T3Q A;  3N9Y C;  2J7Q B;  4JL9 A;  4LLG M;  3N1X C;  4XDD A;  2X8X X;  4P7I A;  1Y56 A;  1VRP A;  4MGI E;  3CIR B;  2Y5C A;  1QOB A;  4GN1 A;  2GBJ A;  3DDC B;  3JVZ X;  2WGS A;  2KFK A;  2BS4 B;  4XWT A;  1D5X C;  3NUH B;  1J19 A;  1V2Y A;  1ESF A;  3VUW A;  3AED B;  1EWY C;  4AWJ A;  3B0A A;  4B9K A;  4ARC A;  3L2E A;  2KXJ A;  2NTT A;  4YSZ B;  4TUU A;  2KT7 A;  1UBQ A;  1SGH A;  4EUT A;  4HPP A;  4YT0 B;  2W3R A;  1YJ1 A;  4FLH A;  2KC1 A;  1FIQ A;  3PO0 A;  1KLU D;  3ZGZ A;  2ZPY A;  1YN4 A;  4GDK B;  3EFU A;  2PPH A;  1FNU A;  4ANV A;  2KTR A;  2G1E A;  2K6Q A;  3KQ4 A;  1PFD A;  4OZC A;  5E6J A;  4GVY A;  4K7W A;  4DXA B; 
#chains in the Genus database with same CATH homology
 2D3C A;  1HTO A;  1LGR A;  3ZXR A;  3FKY A;  3ZXV A;  2D3A A;  1HTQ A;  2GWD A;  3LVW A;  4HPP A;  2D32 A;  2WHI A;  1F1H A;  4S17 A;  2OJW A;  2WGS A;  2GWC A;  4LNF A;  3LN6 A;  4LNI A;  4XYC A;  1FPY A;  1V4G A;  2UU7 A;  3LN7 A;  3NZT A;  2D3B A;  2GLS A;  4LNO A;  4LNN A;  3IG5 A;  2D33 A;  4BAX A;  1R8G A;  4ACF A;  4S0R A;  1VA6 A;  3IG8 A;  4LNK A;  2LGS A;  1TT4 A;  1F52 A;  2QC8 A;  2BVC A;  3LVV A;  3NG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...