1MAEL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(chnh2(d)-deaminating)
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
total genus 31
structure length 123
sequence length 124
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1maeL00
2HJ4D 2H47B 2J57K 4Y5RC 2OJYD 2MTAL 2OIZD 3L4OC 4L3HC 3SWSC 2OK4D 2AGXD 3RLMC 3L4MC 1MDAL 2IUPD 4L3GC 2HKRD 3ORVC 3SLEC 3SVWC 2HJBD 2J56L 1MAFL 2Q7QD 1MG2B 2H3XB 2I0SD 2HXCD 3PXSC 3C75L 1MG3B 4K3IC 4FA9C 4FA5C 3PXWC 2AH1D 2BBKL 2IUQD 2I0RD 4FA4C 4FAVC 2AGLD 1MAEL 2IUVD 2I0TD 2MADL 3RN1C 4FB1C 2GC4B 2AGWD 3PXTC 2GC7B 2AGYD 2HKMD 2AH0D 2OK6D 2IAAB 3RMZC 3SXTC 4L1QC 2IURD 4O1QC 4FANC 3SJLC 2J55L 4FA1C 2AGZD 3RN0C
chains in the Genus database with same CATH superfamily
2HJ4D 2H47B 2J57K 4Y5RC 2OJYD 2MTAL 2OIZD 3L4OC 4L3HC 3SWSC 2OK4D 2AGXD 3RLMC 3L4MC 1MDAL 2IUPD 4L3GC 2HKRD 3ORVC 3SLEC 3SVWC 2HJBD 2J56L 1MAFL 2Q7QD 1MG2B 2H3XB 2I0SD 2HXCD 3PXSC 3C75L 1MG3B 4K3IC 4FA9C 4FA5C 3PXWC 2AH1D 2BBKL 2IUQD 2I0RD 4FA4C 4FAVC 2AGLD 1MAEL 2IUVD 2I0TD 2MADL 3RN1C 4FB1C 2GC4B 2AGWD 3PXTC 2GC7B 2AGYD 2HKMD 2AH0D 2OK6D 2IAAB 3RMZC 3SXTC 4L1QC 2IURD 4O1QC 4FANC 3SJLC 2J55L 4FA1C 2AGZD 3RN0C
chains in the Genus database with same CATH topology
2HJ4D 2H47B 2J57K 4Y5RC 2OJYD 2MTAL 2OIZD 3L4OC 4L3HC 3SWSC 2OK4D 2AGXD 3RLMC 3L4MC 1MDAL 2IUPD 4L3GC 2HKRD 3ORVC 3SLEC 3SVWC 2HJBD 2J56L 1MAFL 2Q7QD 1MG2B 2H3XB 2I0SD 2HXCD 3PXSC 3C75L 1MG3B 4K3IC 4FA9C 4FA5C 3PXWC 2AH1D 2BBKL 2IUQD 2I0RD 4FA4C 4FAVC 2AGLD 1MAEL 2IUVD 2I0TD 2MADL 3RN1C 4FB1C 2GC4B 2AGWD 3PXTC 2GC7B 2AGYD 2HKMD 2AH0D 2OK6D 2IAAB 3RMZC 3SXTC 4L1QC 2IURD 4O1QC 4FANC 3SJLC 2J55L 4FA1C 2AGZD 3RN0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ4 D;  2H47 B;  2J57 K;  4Y5R C;  2OJY D;  2MTA L;  2OIZ D;  3L4O C;  4L3H C;  3SWS C;  2OK4 D;  2AGX D;  3RLM C;  3L4M C;  1MDA L;  2IUP D;  4L3G C;  2HKR D;  3ORV C;  3SLE C;  3SVW C;  2HJB D;  2J56 L;  1MAF L;  2Q7Q D;  1MG2 B;  2H3X B;  2I0S D;  2HXC D;  3PXS C;  3C75 L;  1MG3 B;  4K3I C;  4FA9 C;  4FA5 C;  3PXW C;  2AH1 D;  2BBK L;  2IUQ D;  2I0R D;  4FA4 C;  4FAV C;  2AGL D;  1MAE L;  2IUV D;  2I0T D;  2MAD L;  3RN1 C;  4FB1 C;  2GC4 B;  2AGW D;  3PXT C;  2GC7 B;  2AGY D;  2HKM D;  2AH0 D;  2OK6 D;  2IAA B;  3RMZ C;  3SXT C;  4L1Q C;  2IUR D;  4O1Q C;  4FAN C;  3SJL C;  2J55 L;  4FA1 C;  2AGZ D;  3RN0 C; 
#chains in the Genus database with same CATH topology
 2HJ4 D;  2H47 B;  2J57 K;  4Y5R C;  2OJY D;  2MTA L;  2OIZ D;  3L4O C;  4L3H C;  3SWS C;  2OK4 D;  2AGX D;  3RLM C;  3L4M C;  1MDA L;  2IUP D;  4L3G C;  2HKR D;  3ORV C;  3SLE C;  3SVW C;  2HJB D;  2J56 L;  1MAF L;  2Q7Q D;  1MG2 B;  2H3X B;  2I0S D;  2HXC D;  3PXS C;  3C75 L;  1MG3 B;  4K3I C;  4FA9 C;  4FA5 C;  3PXW C;  2AH1 D;  2BBK L;  2IUQ D;  2I0R D;  4FA4 C;  4FAV C;  2AGL D;  1MAE L;  2IUV D;  2I0T D;  2MAD L;  3RN1 C;  4FB1 C;  2GC4 B;  2AGW D;  3PXT C;  2GC7 B;  2AGY D;  2HKM D;  2AH0 D;  2OK6 D;  2IAA B;  3RMZ C;  3SXT C;  4L1Q C;  2IUR D;  4O1Q C;  4FAN C;  3SJL C;  2J55 L;  4FA1 C;  2AGZ D;  3RN0 C; 
#chains in the Genus database with same CATH homology
 2HJ4 D;  2H47 B;  2J57 K;  4Y5R C;  2OJY D;  2MTA L;  2OIZ D;  3L4O C;  4L3H C;  3SWS C;  2OK4 D;  2AGX D;  3RLM C;  3L4M C;  1MDA L;  2IUP D;  4L3G C;  2HKR D;  3ORV C;  3SLE C;  3SVW C;  2HJB D;  2J56 L;  1MAF L;  2Q7Q D;  1MG2 B;  2H3X B;  2I0S D;  2HXC D;  3PXS C;  3C75 L;  1MG3 B;  4K3I C;  4FA9 C;  4FA5 C;  3PXW C;  2AH1 D;  2BBK L;  2IUQ D;  2I0R D;  4FA4 C;  4FAV C;  2AGL D;  1MAE L;  2IUV D;  2I0T D;  2MAD L;  3RN1 C;  4FB1 C;  2GC4 B;  2AGW D;  3PXT C;  2GC7 B;  2AGY D;  2HKM D;  2AH0 D;  2OK6 D;  2IAA B;  3RMZ C;  3SXT C;  4L1Q C;  2IUR D;  4O1Q C;  4FAN C;  3SJL C;  2J55 L;  4FA1 C;  2AGZ D;  3RN0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...