1MAEL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
molecule tags Oxidoreductase(chnh2(d)-deaminating)
total genus 31
structure length 123
sequence length 124
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1maeL00
2IUPD 4FA4C 2AH0D 4L1QC 2AGZD 3RLMC 2BBKL 2I0TD 2J56L 2AGLD 1MDAL 2HXCD 4Y5RC 2HJBD 3RN0C 2MADL 4FAVC 3RMZC 2HKRD 4L3HC 2I0RD 2OIZD 3SLEC 3ORVC 2HKMD 1MAFL 2AGYD 2I0SD 2IUVD 2J57K 4FA5C 2GC4B 4L3GC 1MG3B 2AH1D 2IUQD 3PXTC 1MAEL 2AGXD 3SVWC 3PXSC 2H47B 4FA9C 3RN1C 3SJLC 3C75L 3SXTC 3L4OC 3PXWC 2HJ4D 2J55L 2OK6D 2IURD 2H3XB 2OJYD 4O1QC 2MTAL 2GC7B 3L4MC 4FANC 2IAAB 4K3IC 4FA1C 2AGWD 2OK4D 2Q7QD 4FB1C 3SWSC 1MG2B
chains in the Genus database with same CATH superfamily
2IUPD 4FA4C 2AH0D 4L1QC 2AGZD 3RLMC 2BBKL 2I0TD 2J56L 2AGLD 1MDAL 2HXCD 4Y5RC 2HJBD 3RN0C 2MADL 4FAVC 3RMZC 2HKRD 4L3HC 2I0RD 2OIZD 3SLEC 3ORVC 2HKMD 1MAFL 2AGYD 2I0SD 2IUVD 2J57K 4FA5C 2GC4B 4L3GC 1MG3B 2AH1D 2IUQD 3PXTC 1MAEL 2AGXD 3SVWC 3PXSC 2H47B 4FA9C 3RN1C 3SJLC 3C75L 3SXTC 3L4OC 3PXWC 2HJ4D 2J55L 2OK6D 2IURD 2H3XB 2OJYD 4O1QC 2MTAL 2GC7B 3L4MC 4FANC 2IAAB 4K3IC 4FA1C 2AGWD 2OK4D 2Q7QD 4FB1C 3SWSC 1MG2B
chains in the Genus database with same CATH topology
2IUPD 4FA4C 2AH0D 4L1QC 2AGZD 3RLMC 2BBKL 2I0TD 2J56L 2AGLD 1MDAL 2HXCD 4Y5RC 2HJBD 3RN0C 2MADL 4FAVC 3RMZC 2HKRD 4L3HC 2I0RD 2OIZD 3SLEC 3ORVC 2HKMD 1MAFL 2AGYD 2I0SD 2IUVD 2J57K 4FA5C 2GC4B 4L3GC 1MG3B 2AH1D 2IUQD 3PXTC 1MAEL 2AGXD 3SVWC 3PXSC 2H47B 4FA9C 3RN1C 3SJLC 3C75L 3SXTC 3L4OC 3PXWC 2HJ4D 2J55L 2OK6D 2IURD 2H3XB 2OJYD 4O1QC 2MTAL 2GC7B 3L4MC 4FANC 2IAAB 4K3IC 4FA1C 2AGWD 2OK4D 2Q7QD 4FB1C 3SWSC 1MG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUP D;  4FA4 C;  2AH0 D;  4L1Q C;  2AGZ D;  3RLM C;  2BBK L;  2I0T D;  2J56 L;  2AGL D;  1MDA L;  2HXC D;  4Y5R C;  2HJB D;  3RN0 C;  2MAD L;  4FAV C;  3RMZ C;  2HKR D;  4L3H C;  2I0R D;  2OIZ D;  3SLE C;  3ORV C;  2HKM D;  1MAF L;  2AGY D;  2I0S D;  2IUV D;  2J57 K;  4FA5 C;  2GC4 B;  4L3G C;  1MG3 B;  2AH1 D;  2IUQ D;  3PXT C;  1MAE L;  2AGX D;  3SVW C;  3PXS C;  2H47 B;  4FA9 C;  3RN1 C;  3SJL C;  3C75 L;  3SXT C;  3L4O C;  3PXW C;  2HJ4 D;  2J55 L;  2OK6 D;  2IUR D;  2H3X B;  2OJY D;  4O1Q C;  2MTA L;  2GC7 B;  3L4M C;  4FAN C;  2IAA B;  4K3I C;  4FA1 C;  2AGW D;  2OK4 D;  2Q7Q D;  4FB1 C;  3SWS C;  1MG2 B; 
#chains in the Genus database with same CATH topology
 2IUP D;  4FA4 C;  2AH0 D;  4L1Q C;  2AGZ D;  3RLM C;  2BBK L;  2I0T D;  2J56 L;  2AGL D;  1MDA L;  2HXC D;  4Y5R C;  2HJB D;  3RN0 C;  2MAD L;  4FAV C;  3RMZ C;  2HKR D;  4L3H C;  2I0R D;  2OIZ D;  3SLE C;  3ORV C;  2HKM D;  1MAF L;  2AGY D;  2I0S D;  2IUV D;  2J57 K;  4FA5 C;  2GC4 B;  4L3G C;  1MG3 B;  2AH1 D;  2IUQ D;  3PXT C;  1MAE L;  2AGX D;  3SVW C;  3PXS C;  2H47 B;  4FA9 C;  3RN1 C;  3SJL C;  3C75 L;  3SXT C;  3L4O C;  3PXW C;  2HJ4 D;  2J55 L;  2OK6 D;  2IUR D;  2H3X B;  2OJY D;  4O1Q C;  2MTA L;  2GC7 B;  3L4M C;  4FAN C;  2IAA B;  4K3I C;  4FA1 C;  2AGW D;  2OK4 D;  2Q7Q D;  4FB1 C;  3SWS C;  1MG2 B; 
#chains in the Genus database with same CATH homology
 2IUP D;  4FA4 C;  2AH0 D;  4L1Q C;  2AGZ D;  3RLM C;  2BBK L;  2I0T D;  2J56 L;  2AGL D;  1MDA L;  2HXC D;  4Y5R C;  2HJB D;  3RN0 C;  2MAD L;  4FAV C;  3RMZ C;  2HKR D;  4L3H C;  2I0R D;  2OIZ D;  3SLE C;  3ORV C;  2HKM D;  1MAF L;  2AGY D;  2I0S D;  2IUV D;  2J57 K;  4FA5 C;  2GC4 B;  4L3G C;  1MG3 B;  2AH1 D;  2IUQ D;  3PXT C;  1MAE L;  2AGX D;  3SVW C;  3PXS C;  2H47 B;  4FA9 C;  3RN1 C;  3SJL C;  3C75 L;  3SXT C;  3L4O C;  3PXW C;  2HJ4 D;  2J55 L;  2OK6 D;  2IUR D;  2H3X B;  2OJY D;  4O1Q C;  2MTA L;  2GC7 B;  3L4M C;  4FAN C;  2IAA B;  4K3I C;  4FA1 C;  2AGW D;  2OK4 D;  2Q7Q D;  4FB1 C;  3SWS C;  1MG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...