3SVWC

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3svwC00
4FA5C 3PXWC 1MG2B 3RMZC 3SLEC 2AGWD 4FA4C 2IUPD 3ORVC 2I0RD 1MAEL 2BBKL 3SXTC 2HJ4D 2HKRD 2J57K 3SWSC 2MTAL 3L4MC 2MADL 2GC7B 3RN0C 2AH1D 2HKMD 2H3XB 2AGLD 2HXCD 2IAAB 3PXTC 3C75L 4FA9C 1MDAL 4O1QC 4Y5RC 1MG3B 4L1QC 4L3HC 4FANC 2HJBD 1MAFL 2GC4B 4FAVC 2OK6D 3RLMC 2OIZD 4FB1C 2I0TD 2I0SD 4K3IC 2OJYD 2AH0D 2IUVD 2H47B 3L4OC 2J56L 2Q7QD 2AGZD 2J55L 2IUQD 2AGYD 2IURD 3RN1C 3SJLC 4FA1C 4L3GC 3SVWC 3PXSC 2OK4D 2AGXD
chains in the Genus database with same CATH superfamily
4FA5C 3PXWC 1MG2B 3RMZC 3SLEC 2AGWD 4FA4C 2IUPD 3ORVC 2I0RD 1MAEL 2BBKL 3SXTC 2HJ4D 2HKRD 2J57K 3SWSC 2MTAL 3L4MC 2MADL 2GC7B 3RN0C 2AH1D 2HKMD 2H3XB 2AGLD 2HXCD 2IAAB 3PXTC 3C75L 4FA9C 1MDAL 4O1QC 4Y5RC 1MG3B 4L1QC 4L3HC 4FANC 2HJBD 1MAFL 2GC4B 4FAVC 2OK6D 3RLMC 2OIZD 4FB1C 2I0TD 2I0SD 4K3IC 2OJYD 2AH0D 2IUVD 2H47B 3L4OC 2J56L 2Q7QD 2AGZD 2J55L 2IUQD 2AGYD 2IURD 3RN1C 3SJLC 4FA1C 4L3GC 3SVWC 3PXSC 2OK4D 2AGXD
chains in the Genus database with same CATH topology
4FA5C 3PXWC 1MG2B 3RMZC 3SLEC 2AGWD 4FA4C 2IUPD 3ORVC 2I0RD 1MAEL 2BBKL 3SXTC 2HJ4D 2HKRD 2J57K 3SWSC 2MTAL 3L4MC 2MADL 2GC7B 3RN0C 2AH1D 2HKMD 2H3XB 2AGLD 2HXCD 2IAAB 3PXTC 3C75L 4FA9C 1MDAL 4O1QC 4Y5RC 1MG3B 4L1QC 4L3HC 4FANC 2HJBD 1MAFL 2GC4B 4FAVC 2OK6D 3RLMC 2OIZD 4FB1C 2I0TD 2I0SD 4K3IC 2OJYD 2AH0D 2IUVD 2H47B 3L4OC 2J56L 2Q7QD 2AGZD 2J55L 2IUQD 2AGYD 2IURD 3RN1C 3SJLC 4FA1C 4L3GC 3SVWC 3PXSC 2OK4D 2AGXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 C;  3PXW C;  1MG2 B;  3RMZ C;  3SLE C;  2AGW D;  4FA4 C;  2IUP D;  3ORV C;  2I0R D;  1MAE L;  2BBK L;  3SXT C;  2HJ4 D;  2HKR D;  2J57 K;  3SWS C;  2MTA L;  3L4M C;  2MAD L;  2GC7 B;  3RN0 C;  2AH1 D;  2HKM D;  2H3X B;  2AGL D;  2HXC D;  2IAA B;  3PXT C;  3C75 L;  4FA9 C;  1MDA L;  4O1Q C;  4Y5R C;  1MG3 B;  4L1Q C;  4L3H C;  4FAN C;  2HJB D;  1MAF L;  2GC4 B;  4FAV C;  2OK6 D;  3RLM C;  2OIZ D;  4FB1 C;  2I0T D;  2I0S D;  4K3I C;  2OJY D;  2AH0 D;  2IUV D;  2H47 B;  3L4O C;  2J56 L;  2Q7Q D;  2AGZ D;  2J55 L;  2IUQ D;  2AGY D;  2IUR D;  3RN1 C;  3SJL C;  4FA1 C;  4L3G C;  3SVW C;  3PXS C;  2OK4 D;  2AGX D; 
#chains in the Genus database with same CATH topology
 4FA5 C;  3PXW C;  1MG2 B;  3RMZ C;  3SLE C;  2AGW D;  4FA4 C;  2IUP D;  3ORV C;  2I0R D;  1MAE L;  2BBK L;  3SXT C;  2HJ4 D;  2HKR D;  2J57 K;  3SWS C;  2MTA L;  3L4M C;  2MAD L;  2GC7 B;  3RN0 C;  2AH1 D;  2HKM D;  2H3X B;  2AGL D;  2HXC D;  2IAA B;  3PXT C;  3C75 L;  4FA9 C;  1MDA L;  4O1Q C;  4Y5R C;  1MG3 B;  4L1Q C;  4L3H C;  4FAN C;  2HJB D;  1MAF L;  2GC4 B;  4FAV C;  2OK6 D;  3RLM C;  2OIZ D;  4FB1 C;  2I0T D;  2I0S D;  4K3I C;  2OJY D;  2AH0 D;  2IUV D;  2H47 B;  3L4O C;  2J56 L;  2Q7Q D;  2AGZ D;  2J55 L;  2IUQ D;  2AGY D;  2IUR D;  3RN1 C;  3SJL C;  4FA1 C;  4L3G C;  3SVW C;  3PXS C;  2OK4 D;  2AGX D; 
#chains in the Genus database with same CATH homology
 4FA5 C;  3PXW C;  1MG2 B;  3RMZ C;  3SLE C;  2AGW D;  4FA4 C;  2IUP D;  3ORV C;  2I0R D;  1MAE L;  2BBK L;  3SXT C;  2HJ4 D;  2HKR D;  2J57 K;  3SWS C;  2MTA L;  3L4M C;  2MAD L;  2GC7 B;  3RN0 C;  2AH1 D;  2HKM D;  2H3X B;  2AGL D;  2HXC D;  2IAA B;  3PXT C;  3C75 L;  4FA9 C;  1MDA L;  4O1Q C;  4Y5R C;  1MG3 B;  4L1Q C;  4L3H C;  4FAN C;  2HJB D;  1MAF L;  2GC4 B;  4FAV C;  2OK6 D;  3RLM C;  2OIZ D;  4FB1 C;  2I0T D;  2I0S D;  4K3I C;  2OJY D;  2AH0 D;  2IUV D;  2H47 B;  3L4O C;  2J56 L;  2Q7Q D;  2AGZ D;  2J55 L;  2IUQ D;  2AGY D;  2IUR D;  3RN1 C;  3SJL C;  4FA1 C;  4L3G C;  3SVW C;  3PXS C;  2OK4 D;  2AGX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...