3SVWC

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3svwC00
1MG3B 2J57K 2HJBD 2OJYD 3RN0C 2HXCD 1MAEL 3SXTC 2IURD 2Q7QD 3RMZC 2J55L 4FA5C 4FA1C 2AGXD 3PXTC 2HJ4D 3RN1C 1MAFL 2AGWD 3C75L 3PXWC 2AH1D 1MG2B 2AH0D 2IUPD 2OK4D 4L3HC 3SJLC 3L4OC 2IAAB 1MDAL 2AGZD 4FANC 3L4MC 2GC4B 2OIZD 2J56L 3SWSC 4FB1C 2HKRD 4O1QC 2MADL 4K3IC 3PXSC 3SLEC 2H3XB 4FA4C 4FAVC 2I0SD 3SVWC 2AGLD 2GC7B 4FA9C 2OK6D 3ORVC 2I0RD 2HKMD 4L3GC 2BBKL 4Y5RC 2H47B 2MTAL 2AGYD 3RLMC 2IUVD 4L1QC 2I0TD 2IUQD
chains in the Genus database with same CATH superfamily
1MG3B 2J57K 2HJBD 2OJYD 3RN0C 2HXCD 1MAEL 3SXTC 2IURD 2Q7QD 3RMZC 2J55L 4FA5C 4FA1C 2AGXD 3PXTC 2HJ4D 3RN1C 1MAFL 2AGWD 3C75L 3PXWC 2AH1D 1MG2B 2AH0D 2IUPD 2OK4D 4L3HC 3SJLC 3L4OC 2IAAB 1MDAL 2AGZD 4FANC 3L4MC 2GC4B 2OIZD 2J56L 3SWSC 4FB1C 2HKRD 4O1QC 2MADL 4K3IC 3PXSC 3SLEC 2H3XB 4FA4C 4FAVC 2I0SD 3SVWC 2AGLD 2GC7B 4FA9C 2OK6D 3ORVC 2I0RD 2HKMD 4L3GC 2BBKL 4Y5RC 2H47B 2MTAL 2AGYD 3RLMC 2IUVD 4L1QC 2I0TD 2IUQD
chains in the Genus database with same CATH topology
1MG3B 2J57K 2HJBD 2OJYD 3RN0C 2HXCD 1MAEL 3SXTC 2IURD 2Q7QD 3RMZC 2J55L 4FA5C 4FA1C 2AGXD 3PXTC 2HJ4D 3RN1C 1MAFL 2AGWD 3C75L 3PXWC 2AH1D 1MG2B 2AH0D 2IUPD 2OK4D 4L3HC 3SJLC 3L4OC 2IAAB 1MDAL 2AGZD 4FANC 3L4MC 2GC4B 2OIZD 2J56L 3SWSC 4FB1C 2HKRD 4O1QC 2MADL 4K3IC 3PXSC 3SLEC 2H3XB 4FA4C 4FAVC 2I0SD 3SVWC 2AGLD 2GC7B 4FA9C 2OK6D 3ORVC 2I0RD 2HKMD 4L3GC 2BBKL 4Y5RC 2H47B 2MTAL 2AGYD 3RLMC 2IUVD 4L1QC 2I0TD 2IUQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 B;  2J57 K;  2HJB D;  2OJY D;  3RN0 C;  2HXC D;  1MAE L;  3SXT C;  2IUR D;  2Q7Q D;  3RMZ C;  2J55 L;  4FA5 C;  4FA1 C;  2AGX D;  3PXT C;  2HJ4 D;  3RN1 C;  1MAF L;  2AGW D;  3C75 L;  3PXW C;  2AH1 D;  1MG2 B;  2AH0 D;  2IUP D;  2OK4 D;  4L3H C;  3SJL C;  3L4O C;  2IAA B;  1MDA L;  2AGZ D;  4FAN C;  3L4M C;  2GC4 B;  2OIZ D;  2J56 L;  3SWS C;  4FB1 C;  2HKR D;  4O1Q C;  2MAD L;  4K3I C;  3PXS C;  3SLE C;  2H3X B;  4FA4 C;  4FAV C;  2I0S D;  3SVW C;  2AGL D;  2GC7 B;  4FA9 C;  2OK6 D;  3ORV C;  2I0R D;  2HKM D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2MTA L;  2AGY D;  3RLM C;  2IUV D;  4L1Q C;  2I0T D;  2IUQ D; 
#chains in the Genus database with same CATH topology
 1MG3 B;  2J57 K;  2HJB D;  2OJY D;  3RN0 C;  2HXC D;  1MAE L;  3SXT C;  2IUR D;  2Q7Q D;  3RMZ C;  2J55 L;  4FA5 C;  4FA1 C;  2AGX D;  3PXT C;  2HJ4 D;  3RN1 C;  1MAF L;  2AGW D;  3C75 L;  3PXW C;  2AH1 D;  1MG2 B;  2AH0 D;  2IUP D;  2OK4 D;  4L3H C;  3SJL C;  3L4O C;  2IAA B;  1MDA L;  2AGZ D;  4FAN C;  3L4M C;  2GC4 B;  2OIZ D;  2J56 L;  3SWS C;  4FB1 C;  2HKR D;  4O1Q C;  2MAD L;  4K3I C;  3PXS C;  3SLE C;  2H3X B;  4FA4 C;  4FAV C;  2I0S D;  3SVW C;  2AGL D;  2GC7 B;  4FA9 C;  2OK6 D;  3ORV C;  2I0R D;  2HKM D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2MTA L;  2AGY D;  3RLM C;  2IUV D;  4L1Q C;  2I0T D;  2IUQ D; 
#chains in the Genus database with same CATH homology
 1MG3 B;  2J57 K;  2HJB D;  2OJY D;  3RN0 C;  2HXC D;  1MAE L;  3SXT C;  2IUR D;  2Q7Q D;  3RMZ C;  2J55 L;  4FA5 C;  4FA1 C;  2AGX D;  3PXT C;  2HJ4 D;  3RN1 C;  1MAF L;  2AGW D;  3C75 L;  3PXW C;  2AH1 D;  1MG2 B;  2AH0 D;  2IUP D;  2OK4 D;  4L3H C;  3SJL C;  3L4O C;  2IAA B;  1MDA L;  2AGZ D;  4FAN C;  3L4M C;  2GC4 B;  2OIZ D;  2J56 L;  3SWS C;  4FB1 C;  2HKR D;  4O1Q C;  2MAD L;  4K3I C;  3PXS C;  3SLE C;  2H3X B;  4FA4 C;  4FAV C;  2I0S D;  3SVW C;  2AGL D;  2GC7 B;  4FA9 C;  2OK6 D;  3ORV C;  2I0R D;  2HKM D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2MTA L;  2AGY D;  3RLM C;  2IUV D;  4L1Q C;  2I0T D;  2IUQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...