3SVWC

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3svwC00
4FB1C 4FA5C 1MDAL 2HKMD 2I0SD 4L3GC 2IAAB 2MTAL 2Q7QD 3RN1C 3SXTC 2HJBD 3ORVC 2IUQD 2BBKL 1MAFL 4L3HC 2GC4B 2J55L 2OJYD 1MAEL 3PXWC 2AGXD 2AGLD 3SVWC 3SJLC 2IUPD 2J56L 2H47B 2HXCD 2AGZD 2AGWD 2AGYD 2HKRD 1MG3B 4FANC 4O1QC 2AH1D 3C75L 4L1QC 3RLMC 2IUVD 3SWSC 2OK4D 3L4OC 4Y5RC 3L4MC 1MG2B 2AH0D 4FA4C 4FAVC 2I0TD 4K3IC 2GC7B 2HJ4D 2IURD 4FA1C 3PXSC 3RMZC 2MADL 3SLEC 2OIZD 2H3XB 3PXTC 4FA9C 2OK6D 3RN0C 2J57K 2I0RD
chains in the Genus database with same CATH superfamily
4FB1C 4FA5C 1MDAL 2HKMD 2I0SD 4L3GC 2IAAB 2MTAL 2Q7QD 3RN1C 3SXTC 2HJBD 3ORVC 2IUQD 2BBKL 1MAFL 4L3HC 2GC4B 2J55L 2OJYD 1MAEL 3PXWC 2AGXD 2AGLD 3SVWC 3SJLC 2IUPD 2J56L 2H47B 2HXCD 2AGZD 2AGWD 2AGYD 2HKRD 1MG3B 4FANC 4O1QC 2AH1D 3C75L 4L1QC 3RLMC 2IUVD 3SWSC 2OK4D 3L4OC 4Y5RC 3L4MC 1MG2B 2AH0D 4FA4C 4FAVC 2I0TD 4K3IC 2GC7B 2HJ4D 2IURD 4FA1C 3PXSC 3RMZC 2MADL 3SLEC 2OIZD 2H3XB 3PXTC 4FA9C 2OK6D 3RN0C 2J57K 2I0RD
chains in the Genus database with same CATH topology
4FB1C 4FA5C 1MDAL 2HKMD 2I0SD 4L3GC 2IAAB 2MTAL 2Q7QD 3RN1C 3SXTC 2HJBD 3ORVC 2IUQD 2BBKL 1MAFL 4L3HC 2GC4B 2J55L 2OJYD 1MAEL 3PXWC 2AGXD 2AGLD 3SVWC 3SJLC 2IUPD 2J56L 2H47B 2HXCD 2AGZD 2AGWD 2AGYD 2HKRD 1MG3B 4FANC 4O1QC 2AH1D 3C75L 4L1QC 3RLMC 2IUVD 3SWSC 2OK4D 3L4OC 4Y5RC 3L4MC 1MG2B 2AH0D 4FA4C 4FAVC 2I0TD 4K3IC 2GC7B 2HJ4D 2IURD 4FA1C 3PXSC 3RMZC 2MADL 3SLEC 2OIZD 2H3XB 3PXTC 4FA9C 2OK6D 3RN0C 2J57K 2I0RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FB1 C;  4FA5 C;  1MDA L;  2HKM D;  2I0S D;  4L3G C;  2IAA B;  2MTA L;  2Q7Q D;  3RN1 C;  3SXT C;  2HJB D;  3ORV C;  2IUQ D;  2BBK L;  1MAF L;  4L3H C;  2GC4 B;  2J55 L;  2OJY D;  1MAE L;  3PXW C;  2AGX D;  2AGL D;  3SVW C;  3SJL C;  2IUP D;  2J56 L;  2H47 B;  2HXC D;  2AGZ D;  2AGW D;  2AGY D;  2HKR D;  1MG3 B;  4FAN C;  4O1Q C;  2AH1 D;  3C75 L;  4L1Q C;  3RLM C;  2IUV D;  3SWS C;  2OK4 D;  3L4O C;  4Y5R C;  3L4M C;  1MG2 B;  2AH0 D;  4FA4 C;  4FAV C;  2I0T D;  4K3I C;  2GC7 B;  2HJ4 D;  2IUR D;  4FA1 C;  3PXS C;  3RMZ C;  2MAD L;  3SLE C;  2OIZ D;  2H3X B;  3PXT C;  4FA9 C;  2OK6 D;  3RN0 C;  2J57 K;  2I0R D; 
#chains in the Genus database with same CATH topology
 4FB1 C;  4FA5 C;  1MDA L;  2HKM D;  2I0S D;  4L3G C;  2IAA B;  2MTA L;  2Q7Q D;  3RN1 C;  3SXT C;  2HJB D;  3ORV C;  2IUQ D;  2BBK L;  1MAF L;  4L3H C;  2GC4 B;  2J55 L;  2OJY D;  1MAE L;  3PXW C;  2AGX D;  2AGL D;  3SVW C;  3SJL C;  2IUP D;  2J56 L;  2H47 B;  2HXC D;  2AGZ D;  2AGW D;  2AGY D;  2HKR D;  1MG3 B;  4FAN C;  4O1Q C;  2AH1 D;  3C75 L;  4L1Q C;  3RLM C;  2IUV D;  3SWS C;  2OK4 D;  3L4O C;  4Y5R C;  3L4M C;  1MG2 B;  2AH0 D;  4FA4 C;  4FAV C;  2I0T D;  4K3I C;  2GC7 B;  2HJ4 D;  2IUR D;  4FA1 C;  3PXS C;  3RMZ C;  2MAD L;  3SLE C;  2OIZ D;  2H3X B;  3PXT C;  4FA9 C;  2OK6 D;  3RN0 C;  2J57 K;  2I0R D; 
#chains in the Genus database with same CATH homology
 4FB1 C;  4FA5 C;  1MDA L;  2HKM D;  2I0S D;  4L3G C;  2IAA B;  2MTA L;  2Q7Q D;  3RN1 C;  3SXT C;  2HJB D;  3ORV C;  2IUQ D;  2BBK L;  1MAF L;  4L3H C;  2GC4 B;  2J55 L;  2OJY D;  1MAE L;  3PXW C;  2AGX D;  2AGL D;  3SVW C;  3SJL C;  2IUP D;  2J56 L;  2H47 B;  2HXC D;  2AGZ D;  2AGW D;  2AGY D;  2HKR D;  1MG3 B;  4FAN C;  4O1Q C;  2AH1 D;  3C75 L;  4L1Q C;  3RLM C;  2IUV D;  3SWS C;  2OK4 D;  3L4O C;  4Y5R C;  3L4M C;  1MG2 B;  2AH0 D;  4FA4 C;  4FAV C;  2I0T D;  4K3I C;  2GC7 B;  2HJ4 D;  2IUR D;  4FA1 C;  3PXS C;  3RMZ C;  2MAD L;  3SLE C;  2OIZ D;  2H3X B;  3PXT C;  4FA9 C;  2OK6 D;  3RN0 C;  2J57 K;  2I0R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...