3SWSC

Crystal structure of the quinone form of methylamine dehydrogenase in complex with the diferric form of maug
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
125
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 125
sequence length 126
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3swsC00
1MG2B 3PXWC 4L1QC 4Y5RC 3L4OC 2OK4D 2HXCD 2GC4B 2H47B 2J56L 2I0SD 3SWSC 3RMZC 2IAAB 3C75L 4K3IC 2HJ4D 2MADL 3RN1C 4FA5C 3SVWC 4O1QC 3PXTC 2H3XB 4FA9C 4FA4C 2IUQD 3RLMC 2BBKL 2GC7B 2AH0D 3SJLC 1MAEL 2MTAL 2IUVD 2I0RD 4L3GC 3PXSC 4FA1C 2IURD 1MAFL 2AGZD 2HJBD 2J57K 1MDAL 3ORVC 2AGLD 2AH1D 4FAVC 1MG3B 2HKRD 4FANC 2OIZD 2Q7QD 2OK6D 2AGWD 2HKMD 2AGYD 3RN0C 4FB1C 2AGXD 2I0TD 2IUPD 3L4MC 3SXTC 3SLEC 2J55L 4L3HC 2OJYD
chains in the Genus database with same CATH superfamily
1MG2B 3PXWC 4L1QC 4Y5RC 3L4OC 2OK4D 2HXCD 2GC4B 2H47B 2J56L 2I0SD 3SWSC 3RMZC 2IAAB 3C75L 4K3IC 2HJ4D 2MADL 3RN1C 4FA5C 3SVWC 4O1QC 3PXTC 2H3XB 4FA9C 4FA4C 2IUQD 3RLMC 2BBKL 2GC7B 2AH0D 3SJLC 1MAEL 2MTAL 2IUVD 2I0RD 4L3GC 3PXSC 4FA1C 2IURD 1MAFL 2AGZD 2HJBD 2J57K 1MDAL 3ORVC 2AGLD 2AH1D 4FAVC 1MG3B 2HKRD 4FANC 2OIZD 2Q7QD 2OK6D 2AGWD 2HKMD 2AGYD 3RN0C 4FB1C 2AGXD 2I0TD 2IUPD 3L4MC 3SXTC 3SLEC 2J55L 4L3HC 2OJYD
chains in the Genus database with same CATH topology
1MG2B 3PXWC 4L1QC 4Y5RC 3L4OC 2OK4D 2HXCD 2GC4B 2H47B 2J56L 2I0SD 3SWSC 3RMZC 2IAAB 3C75L 4K3IC 2HJ4D 2MADL 3RN1C 4FA5C 3SVWC 4O1QC 3PXTC 2H3XB 4FA9C 4FA4C 2IUQD 3RLMC 2BBKL 2GC7B 2AH0D 3SJLC 1MAEL 2MTAL 2IUVD 2I0RD 4L3GC 3PXSC 4FA1C 2IURD 1MAFL 2AGZD 2HJBD 2J57K 1MDAL 3ORVC 2AGLD 2AH1D 4FAVC 1MG3B 2HKRD 4FANC 2OIZD 2Q7QD 2OK6D 2AGWD 2HKMD 2AGYD 3RN0C 4FB1C 2AGXD 2I0TD 2IUPD 3L4MC 3SXTC 3SLEC 2J55L 4L3HC 2OJYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG2 B;  3PXW C;  4L1Q C;  4Y5R C;  3L4O C;  2OK4 D;  2HXC D;  2GC4 B;  2H47 B;  2J56 L;  2I0S D;  3SWS C;  3RMZ C;  2IAA B;  3C75 L;  4K3I C;  2HJ4 D;  2MAD L;  3RN1 C;  4FA5 C;  3SVW C;  4O1Q C;  3PXT C;  2H3X B;  4FA9 C;  4FA4 C;  2IUQ D;  3RLM C;  2BBK L;  2GC7 B;  2AH0 D;  3SJL C;  1MAE L;  2MTA L;  2IUV D;  2I0R D;  4L3G C;  3PXS C;  4FA1 C;  2IUR D;  1MAF L;  2AGZ D;  2HJB D;  2J57 K;  1MDA L;  3ORV C;  2AGL D;  2AH1 D;  4FAV C;  1MG3 B;  2HKR D;  4FAN C;  2OIZ D;  2Q7Q D;  2OK6 D;  2AGW D;  2HKM D;  2AGY D;  3RN0 C;  4FB1 C;  2AGX D;  2I0T D;  2IUP D;  3L4M C;  3SXT C;  3SLE C;  2J55 L;  4L3H C;  2OJY D; 
#chains in the Genus database with same CATH topology
 1MG2 B;  3PXW C;  4L1Q C;  4Y5R C;  3L4O C;  2OK4 D;  2HXC D;  2GC4 B;  2H47 B;  2J56 L;  2I0S D;  3SWS C;  3RMZ C;  2IAA B;  3C75 L;  4K3I C;  2HJ4 D;  2MAD L;  3RN1 C;  4FA5 C;  3SVW C;  4O1Q C;  3PXT C;  2H3X B;  4FA9 C;  4FA4 C;  2IUQ D;  3RLM C;  2BBK L;  2GC7 B;  2AH0 D;  3SJL C;  1MAE L;  2MTA L;  2IUV D;  2I0R D;  4L3G C;  3PXS C;  4FA1 C;  2IUR D;  1MAF L;  2AGZ D;  2HJB D;  2J57 K;  1MDA L;  3ORV C;  2AGL D;  2AH1 D;  4FAV C;  1MG3 B;  2HKR D;  4FAN C;  2OIZ D;  2Q7Q D;  2OK6 D;  2AGW D;  2HKM D;  2AGY D;  3RN0 C;  4FB1 C;  2AGX D;  2I0T D;  2IUP D;  3L4M C;  3SXT C;  3SLE C;  2J55 L;  4L3H C;  2OJY D; 
#chains in the Genus database with same CATH homology
 1MG2 B;  3PXW C;  4L1Q C;  4Y5R C;  3L4O C;  2OK4 D;  2HXC D;  2GC4 B;  2H47 B;  2J56 L;  2I0S D;  3SWS C;  3RMZ C;  2IAA B;  3C75 L;  4K3I C;  2HJ4 D;  2MAD L;  3RN1 C;  4FA5 C;  3SVW C;  4O1Q C;  3PXT C;  2H3X B;  4FA9 C;  4FA4 C;  2IUQ D;  3RLM C;  2BBK L;  2GC7 B;  2AH0 D;  3SJL C;  1MAE L;  2MTA L;  2IUV D;  2I0R D;  4L3G C;  3PXS C;  4FA1 C;  2IUR D;  1MAF L;  2AGZ D;  2HJB D;  2J57 K;  1MDA L;  3ORV C;  2AGL D;  2AH1 D;  4FAV C;  1MG3 B;  2HKR D;  4FAN C;  2OIZ D;  2Q7Q D;  2OK6 D;  2AGW D;  2HKM D;  2AGY D;  3RN0 C;  4FB1 C;  2AGX D;  2I0T D;  2IUP D;  3L4M C;  3SXT C;  3SLE C;  2J55 L;  4L3H C;  2OJY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...