3SWSC

Crystal structure of the quinone form of methylamine dehydrogenase in complex with the diferric form of maug
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
125
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 125
sequence length 126
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3swsC00
3RN1C 2AGLD 2HJ4D 2HKRD 2J57K 4FA9C 4L3GC 4L1QC 2HKMD 2AGXD 2IURD 2MADL 2OK4D 3SXTC 3PXTC 3SVWC 3RMZC 2HXCD 4FA5C 2IUPD 2IUQD 3PXSC 3ORVC 2GC7B 3SJLC 2IAAB 4L3HC 2OIZD 2AGZD 2J55L 3L4MC 2H47B 4Y5RC 2AH0D 4FB1C 2BBKL 2J56L 4FANC 2AGYD 2I0SD 1MDAL 2MTAL 3C75L 3RLMC 4FA1C 2HJBD 2OK6D 3SWSC 2Q7QD 1MG3B 3SLEC 2AH1D 4O1QC 4FA4C 3L4OC 1MG2B 2IUVD 2H3XB 2I0TD 2I0RD 1MAFL 3PXWC 2AGWD 3RN0C 2GC4B 4FAVC 4K3IC 1MAEL 2OJYD
chains in the Genus database with same CATH superfamily
3RN1C 2AGLD 2HJ4D 2HKRD 2J57K 4FA9C 4L3GC 4L1QC 2HKMD 2AGXD 2IURD 2MADL 2OK4D 3SXTC 3PXTC 3SVWC 3RMZC 2HXCD 4FA5C 2IUPD 2IUQD 3PXSC 3ORVC 2GC7B 3SJLC 2IAAB 4L3HC 2OIZD 2AGZD 2J55L 3L4MC 2H47B 4Y5RC 2AH0D 4FB1C 2BBKL 2J56L 4FANC 2AGYD 2I0SD 1MDAL 2MTAL 3C75L 3RLMC 4FA1C 2HJBD 2OK6D 3SWSC 2Q7QD 1MG3B 3SLEC 2AH1D 4O1QC 4FA4C 3L4OC 1MG2B 2IUVD 2H3XB 2I0TD 2I0RD 1MAFL 3PXWC 2AGWD 3RN0C 2GC4B 4FAVC 4K3IC 1MAEL 2OJYD
chains in the Genus database with same CATH topology
3RN1C 2AGLD 2HJ4D 2HKRD 2J57K 4FA9C 4L3GC 4L1QC 2HKMD 2AGXD 2IURD 2MADL 2OK4D 3SXTC 3PXTC 3SVWC 3RMZC 2HXCD 4FA5C 2IUPD 2IUQD 3PXSC 3ORVC 2GC7B 3SJLC 2IAAB 4L3HC 2OIZD 2AGZD 2J55L 3L4MC 2H47B 4Y5RC 2AH0D 4FB1C 2BBKL 2J56L 4FANC 2AGYD 2I0SD 1MDAL 2MTAL 3C75L 3RLMC 4FA1C 2HJBD 2OK6D 3SWSC 2Q7QD 1MG3B 3SLEC 2AH1D 4O1QC 4FA4C 3L4OC 1MG2B 2IUVD 2H3XB 2I0TD 2I0RD 1MAFL 3PXWC 2AGWD 3RN0C 2GC4B 4FAVC 4K3IC 1MAEL 2OJYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 C;  2AGL D;  2HJ4 D;  2HKR D;  2J57 K;  4FA9 C;  4L3G C;  4L1Q C;  2HKM D;  2AGX D;  2IUR D;  2MAD L;  2OK4 D;  3SXT C;  3PXT C;  3SVW C;  3RMZ C;  2HXC D;  4FA5 C;  2IUP D;  2IUQ D;  3PXS C;  3ORV C;  2GC7 B;  3SJL C;  2IAA B;  4L3H C;  2OIZ D;  2AGZ D;  2J55 L;  3L4M C;  2H47 B;  4Y5R C;  2AH0 D;  4FB1 C;  2BBK L;  2J56 L;  4FAN C;  2AGY D;  2I0S D;  1MDA L;  2MTA L;  3C75 L;  3RLM C;  4FA1 C;  2HJB D;  2OK6 D;  3SWS C;  2Q7Q D;  1MG3 B;  3SLE C;  2AH1 D;  4O1Q C;  4FA4 C;  3L4O C;  1MG2 B;  2IUV D;  2H3X B;  2I0T D;  2I0R D;  1MAF L;  3PXW C;  2AGW D;  3RN0 C;  2GC4 B;  4FAV C;  4K3I C;  1MAE L;  2OJY D; 
#chains in the Genus database with same CATH topology
 3RN1 C;  2AGL D;  2HJ4 D;  2HKR D;  2J57 K;  4FA9 C;  4L3G C;  4L1Q C;  2HKM D;  2AGX D;  2IUR D;  2MAD L;  2OK4 D;  3SXT C;  3PXT C;  3SVW C;  3RMZ C;  2HXC D;  4FA5 C;  2IUP D;  2IUQ D;  3PXS C;  3ORV C;  2GC7 B;  3SJL C;  2IAA B;  4L3H C;  2OIZ D;  2AGZ D;  2J55 L;  3L4M C;  2H47 B;  4Y5R C;  2AH0 D;  4FB1 C;  2BBK L;  2J56 L;  4FAN C;  2AGY D;  2I0S D;  1MDA L;  2MTA L;  3C75 L;  3RLM C;  4FA1 C;  2HJB D;  2OK6 D;  3SWS C;  2Q7Q D;  1MG3 B;  3SLE C;  2AH1 D;  4O1Q C;  4FA4 C;  3L4O C;  1MG2 B;  2IUV D;  2H3X B;  2I0T D;  2I0R D;  1MAF L;  3PXW C;  2AGW D;  3RN0 C;  2GC4 B;  4FAV C;  4K3I C;  1MAE L;  2OJY D; 
#chains in the Genus database with same CATH homology
 3RN1 C;  2AGL D;  2HJ4 D;  2HKR D;  2J57 K;  4FA9 C;  4L3G C;  4L1Q C;  2HKM D;  2AGX D;  2IUR D;  2MAD L;  2OK4 D;  3SXT C;  3PXT C;  3SVW C;  3RMZ C;  2HXC D;  4FA5 C;  2IUP D;  2IUQ D;  3PXS C;  3ORV C;  2GC7 B;  3SJL C;  2IAA B;  4L3H C;  2OIZ D;  2AGZ D;  2J55 L;  3L4M C;  2H47 B;  4Y5R C;  2AH0 D;  4FB1 C;  2BBK L;  2J56 L;  4FAN C;  2AGY D;  2I0S D;  1MDA L;  2MTA L;  3C75 L;  3RLM C;  4FA1 C;  2HJB D;  2OK6 D;  3SWS C;  2Q7Q D;  1MG3 B;  3SLE C;  2AH1 D;  4O1Q C;  4FA4 C;  3L4O C;  1MG2 B;  2IUV D;  2H3X B;  2I0T D;  2I0R D;  1MAF L;  3PXW C;  2AGW D;  3RN0 C;  2GC4 B;  4FAV C;  4K3I C;  1MAE L;  2OJY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...