3SWSC

Crystal structure of the quinone form of methylamine dehydrogenase in complex with the diferric form of maug
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
125
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 125
sequence length 126
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3swsC00
3PXSC 1MG2B 2HJ4D 3RMZC 4O1QC 4FA1C 3PXTC 2AGZD 2I0SD 2IURD 2IUVD 3SXTC 2AGXD 2GC7B 1MDAL 1MAFL 4FA4C 2OIZD 2I0TD 4FA9C 2J55L 2HKRD 3PXWC 3RN0C 2AGWD 4FANC 3SLEC 2AH1D 2OK6D 3SWSC 4L3HC 4FA5C 1MG3B 3C75L 2I0RD 3SJLC 2IAAB 3RN1C 4FAVC 2HJBD 4L1QC 2AGYD 2Q7QD 3L4OC 4FB1C 2HXCD 1MAEL 2IUQD 2MTAL 4Y5RC 3RLMC 2H3XB 2GC4B 2OK4D 3ORVC 2H47B 3SVWC 2AH0D 2BBKL 2J56L 3L4MC 2HKMD 2J57K 2MADL 4L3GC 4K3IC 2IUPD 2OJYD 2AGLD
chains in the Genus database with same CATH superfamily
3PXSC 1MG2B 2HJ4D 3RMZC 4O1QC 4FA1C 3PXTC 2AGZD 2I0SD 2IURD 2IUVD 3SXTC 2AGXD 2GC7B 1MDAL 1MAFL 4FA4C 2OIZD 2I0TD 4FA9C 2J55L 2HKRD 3PXWC 3RN0C 2AGWD 4FANC 3SLEC 2AH1D 2OK6D 3SWSC 4L3HC 4FA5C 1MG3B 3C75L 2I0RD 3SJLC 2IAAB 3RN1C 4FAVC 2HJBD 4L1QC 2AGYD 2Q7QD 3L4OC 4FB1C 2HXCD 1MAEL 2IUQD 2MTAL 4Y5RC 3RLMC 2H3XB 2GC4B 2OK4D 3ORVC 2H47B 3SVWC 2AH0D 2BBKL 2J56L 3L4MC 2HKMD 2J57K 2MADL 4L3GC 4K3IC 2IUPD 2OJYD 2AGLD
chains in the Genus database with same CATH topology
3PXSC 1MG2B 2HJ4D 3RMZC 4O1QC 4FA1C 3PXTC 2AGZD 2I0SD 2IURD 2IUVD 3SXTC 2AGXD 2GC7B 1MDAL 1MAFL 4FA4C 2OIZD 2I0TD 4FA9C 2J55L 2HKRD 3PXWC 3RN0C 2AGWD 4FANC 3SLEC 2AH1D 2OK6D 3SWSC 4L3HC 4FA5C 1MG3B 3C75L 2I0RD 3SJLC 2IAAB 3RN1C 4FAVC 2HJBD 4L1QC 2AGYD 2Q7QD 3L4OC 4FB1C 2HXCD 1MAEL 2IUQD 2MTAL 4Y5RC 3RLMC 2H3XB 2GC4B 2OK4D 3ORVC 2H47B 3SVWC 2AH0D 2BBKL 2J56L 3L4MC 2HKMD 2J57K 2MADL 4L3GC 4K3IC 2IUPD 2OJYD 2AGLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS C;  1MG2 B;  2HJ4 D;  3RMZ C;  4O1Q C;  4FA1 C;  3PXT C;  2AGZ D;  2I0S D;  2IUR D;  2IUV D;  3SXT C;  2AGX D;  2GC7 B;  1MDA L;  1MAF L;  4FA4 C;  2OIZ D;  2I0T D;  4FA9 C;  2J55 L;  2HKR D;  3PXW C;  3RN0 C;  2AGW D;  4FAN C;  3SLE C;  2AH1 D;  2OK6 D;  3SWS C;  4L3H C;  4FA5 C;  1MG3 B;  3C75 L;  2I0R D;  3SJL C;  2IAA B;  3RN1 C;  4FAV C;  2HJB D;  4L1Q C;  2AGY D;  2Q7Q D;  3L4O C;  4FB1 C;  2HXC D;  1MAE L;  2IUQ D;  2MTA L;  4Y5R C;  3RLM C;  2H3X B;  2GC4 B;  2OK4 D;  3ORV C;  2H47 B;  3SVW C;  2AH0 D;  2BBK L;  2J56 L;  3L4M C;  2HKM D;  2J57 K;  2MAD L;  4L3G C;  4K3I C;  2IUP D;  2OJY D;  2AGL D; 
#chains in the Genus database with same CATH topology
 3PXS C;  1MG2 B;  2HJ4 D;  3RMZ C;  4O1Q C;  4FA1 C;  3PXT C;  2AGZ D;  2I0S D;  2IUR D;  2IUV D;  3SXT C;  2AGX D;  2GC7 B;  1MDA L;  1MAF L;  4FA4 C;  2OIZ D;  2I0T D;  4FA9 C;  2J55 L;  2HKR D;  3PXW C;  3RN0 C;  2AGW D;  4FAN C;  3SLE C;  2AH1 D;  2OK6 D;  3SWS C;  4L3H C;  4FA5 C;  1MG3 B;  3C75 L;  2I0R D;  3SJL C;  2IAA B;  3RN1 C;  4FAV C;  2HJB D;  4L1Q C;  2AGY D;  2Q7Q D;  3L4O C;  4FB1 C;  2HXC D;  1MAE L;  2IUQ D;  2MTA L;  4Y5R C;  3RLM C;  2H3X B;  2GC4 B;  2OK4 D;  3ORV C;  2H47 B;  3SVW C;  2AH0 D;  2BBK L;  2J56 L;  3L4M C;  2HKM D;  2J57 K;  2MAD L;  4L3G C;  4K3I C;  2IUP D;  2OJY D;  2AGL D; 
#chains in the Genus database with same CATH homology
 3PXS C;  1MG2 B;  2HJ4 D;  3RMZ C;  4O1Q C;  4FA1 C;  3PXT C;  2AGZ D;  2I0S D;  2IUR D;  2IUV D;  3SXT C;  2AGX D;  2GC7 B;  1MDA L;  1MAF L;  4FA4 C;  2OIZ D;  2I0T D;  4FA9 C;  2J55 L;  2HKR D;  3PXW C;  3RN0 C;  2AGW D;  4FAN C;  3SLE C;  2AH1 D;  2OK6 D;  3SWS C;  4L3H C;  4FA5 C;  1MG3 B;  3C75 L;  2I0R D;  3SJL C;  2IAA B;  3RN1 C;  4FAV C;  2HJB D;  4L1Q C;  2AGY D;  2Q7Q D;  3L4O C;  4FB1 C;  2HXC D;  1MAE L;  2IUQ D;  2MTA L;  4Y5R C;  3RLM C;  2H3X B;  2GC4 B;  2OK4 D;  3ORV C;  2H47 B;  3SVW C;  2AH0 D;  2BBK L;  2J56 L;  3L4M C;  2HKM D;  2J57 K;  2MAD L;  4L3G C;  4K3I C;  2IUP D;  2OJY D;  2AGL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...