4L3GC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex aged 120 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3gC00
4FA9C 2MADL 2AGZD 2AGWD 4Y5RC 3RLMC 2H47B 2J56L 2HJBD 4L3GC 3RN1C 2I0RD 3PXSC 2GC4B 4FA1C 1MG3B 2OJYD 2HXCD 3C75L 4L3HC 4O1QC 4K3IC 3SVWC 1MG2B 3SJLC 2AGYD 4FA5C 3SWSC 1MAEL 2HJ4D 2Q7QD 1MDAL 2H3XB 4FB1C 2AGLD 4FAVC 2OIZD 2IUPD 2AGXD 3PXWC 2OK6D 2IAAB 2IURD 3PXTC 4FANC 2AH1D 2HKMD 2OK4D 2MTAL 3L4OC 1MAFL 4FA4C 2IUVD 2BBKL 2HKRD 4L1QC 3RMZC 2J57K 3L4MC 3ORVC 2J55L 2I0TD 2AH0D 3RN0C 2IUQD 3SLEC 2I0SD 2GC7B 3SXTC
chains in the Genus database with same CATH superfamily
4FA9C 2MADL 2AGZD 2AGWD 4Y5RC 3RLMC 2H47B 2J56L 2HJBD 4L3GC 3RN1C 2I0RD 3PXSC 2GC4B 4FA1C 1MG3B 2OJYD 2HXCD 3C75L 4L3HC 4O1QC 4K3IC 3SVWC 1MG2B 3SJLC 2AGYD 4FA5C 3SWSC 1MAEL 2HJ4D 2Q7QD 1MDAL 2H3XB 4FB1C 2AGLD 4FAVC 2OIZD 2IUPD 2AGXD 3PXWC 2OK6D 2IAAB 2IURD 3PXTC 4FANC 2AH1D 2HKMD 2OK4D 2MTAL 3L4OC 1MAFL 4FA4C 2IUVD 2BBKL 2HKRD 4L1QC 3RMZC 2J57K 3L4MC 3ORVC 2J55L 2I0TD 2AH0D 3RN0C 2IUQD 3SLEC 2I0SD 2GC7B 3SXTC
chains in the Genus database with same CATH topology
4FA9C 2MADL 2AGZD 2AGWD 4Y5RC 3RLMC 2H47B 2J56L 2HJBD 4L3GC 3RN1C 2I0RD 3PXSC 2GC4B 4FA1C 1MG3B 2OJYD 2HXCD 3C75L 4L3HC 4O1QC 4K3IC 3SVWC 1MG2B 3SJLC 2AGYD 4FA5C 3SWSC 1MAEL 2HJ4D 2Q7QD 1MDAL 2H3XB 4FB1C 2AGLD 4FAVC 2OIZD 2IUPD 2AGXD 3PXWC 2OK6D 2IAAB 2IURD 3PXTC 4FANC 2AH1D 2HKMD 2OK4D 2MTAL 3L4OC 1MAFL 4FA4C 2IUVD 2BBKL 2HKRD 4L1QC 3RMZC 2J57K 3L4MC 3ORVC 2J55L 2I0TD 2AH0D 3RN0C 2IUQD 3SLEC 2I0SD 2GC7B 3SXTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA9 C;  2MAD L;  2AGZ D;  2AGW D;  4Y5R C;  3RLM C;  2H47 B;  2J56 L;  2HJB D;  4L3G C;  3RN1 C;  2I0R D;  3PXS C;  2GC4 B;  4FA1 C;  1MG3 B;  2OJY D;  2HXC D;  3C75 L;  4L3H C;  4O1Q C;  4K3I C;  3SVW C;  1MG2 B;  3SJL C;  2AGY D;  4FA5 C;  3SWS C;  1MAE L;  2HJ4 D;  2Q7Q D;  1MDA L;  2H3X B;  4FB1 C;  2AGL D;  4FAV C;  2OIZ D;  2IUP D;  2AGX D;  3PXW C;  2OK6 D;  2IAA B;  2IUR D;  3PXT C;  4FAN C;  2AH1 D;  2HKM D;  2OK4 D;  2MTA L;  3L4O C;  1MAF L;  4FA4 C;  2IUV D;  2BBK L;  2HKR D;  4L1Q C;  3RMZ C;  2J57 K;  3L4M C;  3ORV C;  2J55 L;  2I0T D;  2AH0 D;  3RN0 C;  2IUQ D;  3SLE C;  2I0S D;  2GC7 B;  3SXT C; 
#chains in the Genus database with same CATH topology
 4FA9 C;  2MAD L;  2AGZ D;  2AGW D;  4Y5R C;  3RLM C;  2H47 B;  2J56 L;  2HJB D;  4L3G C;  3RN1 C;  2I0R D;  3PXS C;  2GC4 B;  4FA1 C;  1MG3 B;  2OJY D;  2HXC D;  3C75 L;  4L3H C;  4O1Q C;  4K3I C;  3SVW C;  1MG2 B;  3SJL C;  2AGY D;  4FA5 C;  3SWS C;  1MAE L;  2HJ4 D;  2Q7Q D;  1MDA L;  2H3X B;  4FB1 C;  2AGL D;  4FAV C;  2OIZ D;  2IUP D;  2AGX D;  3PXW C;  2OK6 D;  2IAA B;  2IUR D;  3PXT C;  4FAN C;  2AH1 D;  2HKM D;  2OK4 D;  2MTA L;  3L4O C;  1MAF L;  4FA4 C;  2IUV D;  2BBK L;  2HKR D;  4L1Q C;  3RMZ C;  2J57 K;  3L4M C;  3ORV C;  2J55 L;  2I0T D;  2AH0 D;  3RN0 C;  2IUQ D;  3SLE C;  2I0S D;  2GC7 B;  3SXT C; 
#chains in the Genus database with same CATH homology
 4FA9 C;  2MAD L;  2AGZ D;  2AGW D;  4Y5R C;  3RLM C;  2H47 B;  2J56 L;  2HJB D;  4L3G C;  3RN1 C;  2I0R D;  3PXS C;  2GC4 B;  4FA1 C;  1MG3 B;  2OJY D;  2HXC D;  3C75 L;  4L3H C;  4O1Q C;  4K3I C;  3SVW C;  1MG2 B;  3SJL C;  2AGY D;  4FA5 C;  3SWS C;  1MAE L;  2HJ4 D;  2Q7Q D;  1MDA L;  2H3X B;  4FB1 C;  2AGL D;  4FAV C;  2OIZ D;  2IUP D;  2AGX D;  3PXW C;  2OK6 D;  2IAA B;  2IUR D;  3PXT C;  4FAN C;  2AH1 D;  2HKM D;  2OK4 D;  2MTA L;  3L4O C;  1MAF L;  4FA4 C;  2IUV D;  2BBK L;  2HKR D;  4L1Q C;  3RMZ C;  2J57 K;  3L4M C;  3ORV C;  2J55 L;  2I0T D;  2AH0 D;  3RN0 C;  2IUQ D;  3SLE C;  2I0S D;  2GC7 B;  3SXT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...