4L3GC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex aged 120 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3gC00
4FA4C 3PXTC 4L3GC 4FA5C 3PXWC 3RLMC 2IURD 4Y5RC 2GC4B 3RN0C 4FB1C 2AGYD 2HJBD 4L3HC 3SJLC 3SWSC 1MAFL 2IUQD 2AH0D 2AGLD 2AGWD 2HXCD 3C75L 3L4OC 2J55L 4FAVC 2J57K 2OK6D 4FA9C 3SVWC 4L1QC 2OJYD 2OIZD 3SLEC 1MAEL 4K3IC 2I0TD 1MG3B 2MADL 2HJ4D 2I0SD 1MG2B 4FANC 4O1QC 2H3XB 3RMZC 4FA1C 3SXTC 2IAAB 2AGZD 2HKMD 2AGXD 3L4MC 3ORVC 3PXSC 2IUVD 2IUPD 2OK4D 2J56L 2AH1D 2HKRD 3RN1C 2H47B 1MDAL 2MTAL 2I0RD 2BBKL 2GC7B 2Q7QD
chains in the Genus database with same CATH superfamily
4FA4C 3PXTC 4L3GC 4FA5C 3PXWC 3RLMC 2IURD 4Y5RC 2GC4B 3RN0C 4FB1C 2AGYD 2HJBD 4L3HC 3SJLC 3SWSC 1MAFL 2IUQD 2AH0D 2AGLD 2AGWD 2HXCD 3C75L 3L4OC 2J55L 4FAVC 2J57K 2OK6D 4FA9C 3SVWC 4L1QC 2OJYD 2OIZD 3SLEC 1MAEL 4K3IC 2I0TD 1MG3B 2MADL 2HJ4D 2I0SD 1MG2B 4FANC 4O1QC 2H3XB 3RMZC 4FA1C 3SXTC 2IAAB 2AGZD 2HKMD 2AGXD 3L4MC 3ORVC 3PXSC 2IUVD 2IUPD 2OK4D 2J56L 2AH1D 2HKRD 3RN1C 2H47B 1MDAL 2MTAL 2I0RD 2BBKL 2GC7B 2Q7QD
chains in the Genus database with same CATH topology
4FA4C 3PXTC 4L3GC 4FA5C 3PXWC 3RLMC 2IURD 4Y5RC 2GC4B 3RN0C 4FB1C 2AGYD 2HJBD 4L3HC 3SJLC 3SWSC 1MAFL 2IUQD 2AH0D 2AGLD 2AGWD 2HXCD 3C75L 3L4OC 2J55L 4FAVC 2J57K 2OK6D 4FA9C 3SVWC 4L1QC 2OJYD 2OIZD 3SLEC 1MAEL 4K3IC 2I0TD 1MG3B 2MADL 2HJ4D 2I0SD 1MG2B 4FANC 4O1QC 2H3XB 3RMZC 4FA1C 3SXTC 2IAAB 2AGZD 2HKMD 2AGXD 3L4MC 3ORVC 3PXSC 2IUVD 2IUPD 2OK4D 2J56L 2AH1D 2HKRD 3RN1C 2H47B 1MDAL 2MTAL 2I0RD 2BBKL 2GC7B 2Q7QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 C;  3PXT C;  4L3G C;  4FA5 C;  3PXW C;  3RLM C;  2IUR D;  4Y5R C;  2GC4 B;  3RN0 C;  4FB1 C;  2AGY D;  2HJB D;  4L3H C;  3SJL C;  3SWS C;  1MAF L;  2IUQ D;  2AH0 D;  2AGL D;  2AGW D;  2HXC D;  3C75 L;  3L4O C;  2J55 L;  4FAV C;  2J57 K;  2OK6 D;  4FA9 C;  3SVW C;  4L1Q C;  2OJY D;  2OIZ D;  3SLE C;  1MAE L;  4K3I C;  2I0T D;  1MG3 B;  2MAD L;  2HJ4 D;  2I0S D;  1MG2 B;  4FAN C;  4O1Q C;  2H3X B;  3RMZ C;  4FA1 C;  3SXT C;  2IAA B;  2AGZ D;  2HKM D;  2AGX D;  3L4M C;  3ORV C;  3PXS C;  2IUV D;  2IUP D;  2OK4 D;  2J56 L;  2AH1 D;  2HKR D;  3RN1 C;  2H47 B;  1MDA L;  2MTA L;  2I0R D;  2BBK L;  2GC7 B;  2Q7Q D; 
#chains in the Genus database with same CATH topology
 4FA4 C;  3PXT C;  4L3G C;  4FA5 C;  3PXW C;  3RLM C;  2IUR D;  4Y5R C;  2GC4 B;  3RN0 C;  4FB1 C;  2AGY D;  2HJB D;  4L3H C;  3SJL C;  3SWS C;  1MAF L;  2IUQ D;  2AH0 D;  2AGL D;  2AGW D;  2HXC D;  3C75 L;  3L4O C;  2J55 L;  4FAV C;  2J57 K;  2OK6 D;  4FA9 C;  3SVW C;  4L1Q C;  2OJY D;  2OIZ D;  3SLE C;  1MAE L;  4K3I C;  2I0T D;  1MG3 B;  2MAD L;  2HJ4 D;  2I0S D;  1MG2 B;  4FAN C;  4O1Q C;  2H3X B;  3RMZ C;  4FA1 C;  3SXT C;  2IAA B;  2AGZ D;  2HKM D;  2AGX D;  3L4M C;  3ORV C;  3PXS C;  2IUV D;  2IUP D;  2OK4 D;  2J56 L;  2AH1 D;  2HKR D;  3RN1 C;  2H47 B;  1MDA L;  2MTA L;  2I0R D;  2BBK L;  2GC7 B;  2Q7Q D; 
#chains in the Genus database with same CATH homology
 4FA4 C;  3PXT C;  4L3G C;  4FA5 C;  3PXW C;  3RLM C;  2IUR D;  4Y5R C;  2GC4 B;  3RN0 C;  4FB1 C;  2AGY D;  2HJB D;  4L3H C;  3SJL C;  3SWS C;  1MAF L;  2IUQ D;  2AH0 D;  2AGL D;  2AGW D;  2HXC D;  3C75 L;  3L4O C;  2J55 L;  4FAV C;  2J57 K;  2OK6 D;  4FA9 C;  3SVW C;  4L1Q C;  2OJY D;  2OIZ D;  3SLE C;  1MAE L;  4K3I C;  2I0T D;  1MG3 B;  2MAD L;  2HJ4 D;  2I0S D;  1MG2 B;  4FAN C;  4O1Q C;  2H3X B;  3RMZ C;  4FA1 C;  3SXT C;  2IAA B;  2AGZ D;  2HKM D;  2AGX D;  3L4M C;  3ORV C;  3PXS C;  2IUV D;  2IUP D;  2OK4 D;  2J56 L;  2AH1 D;  2HKR D;  3RN1 C;  2H47 B;  1MDA L;  2MTA L;  2I0R D;  2BBK L;  2GC7 B;  2Q7Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...