3L4MC

Crystal structure of the maug/pre-methylamine dehydrogenase complex.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3l4mC00
2AGLD 4O1QC 2I0TD 3SWSC 3SJLC 4L1QC 2H3XB 4FA4C 2MTAL 4FANC 2IAAB 2AH1D 2OK6D 3RN0C 2HJ4D 3L4MC 3ORVC 4L3GC 3RLMC 3SXTC 2IUQD 2HKRD 2HXCD 2GC7B 1MG3B 4L3HC 1MG2B 2IUPD 2Q7QD 4FA1C 2AGXD 2GC4B 2I0RD 4FB1C 2AGYD 2J55L 2OJYD 3C75L 3PXTC 3PXSC 3PXWC 4Y5RC 4FA5C 2I0SD 2HKMD 3L4OC 4K3IC 2AGZD 1MAFL 1MAEL 3SLEC 1MDAL 3RMZC 2OK4D 2BBKL 2OIZD 2AH0D 2IUVD 2HJBD 2IURD 4FAVC 2AGWD 2MADL 4FA9C 3SVWC 3RN1C 2J56L 2J57K 2H47B
chains in the Genus database with same CATH superfamily
2AGLD 4O1QC 2I0TD 3SWSC 3SJLC 4L1QC 2H3XB 4FA4C 2MTAL 4FANC 2IAAB 2AH1D 2OK6D 3RN0C 2HJ4D 3L4MC 3ORVC 4L3GC 3RLMC 3SXTC 2IUQD 2HKRD 2HXCD 2GC7B 1MG3B 4L3HC 1MG2B 2IUPD 2Q7QD 4FA1C 2AGXD 2GC4B 2I0RD 4FB1C 2AGYD 2J55L 2OJYD 3C75L 3PXTC 3PXSC 3PXWC 4Y5RC 4FA5C 2I0SD 2HKMD 3L4OC 4K3IC 2AGZD 1MAFL 1MAEL 3SLEC 1MDAL 3RMZC 2OK4D 2BBKL 2OIZD 2AH0D 2IUVD 2HJBD 2IURD 4FAVC 2AGWD 2MADL 4FA9C 3SVWC 3RN1C 2J56L 2J57K 2H47B
chains in the Genus database with same CATH topology
2AGLD 4O1QC 2I0TD 3SWSC 3SJLC 4L1QC 2H3XB 4FA4C 2MTAL 4FANC 2IAAB 2AH1D 2OK6D 3RN0C 2HJ4D 3L4MC 3ORVC 4L3GC 3RLMC 3SXTC 2IUQD 2HKRD 2HXCD 2GC7B 1MG3B 4L3HC 1MG2B 2IUPD 2Q7QD 4FA1C 2AGXD 2GC4B 2I0RD 4FB1C 2AGYD 2J55L 2OJYD 3C75L 3PXTC 3PXSC 3PXWC 4Y5RC 4FA5C 2I0SD 2HKMD 3L4OC 4K3IC 2AGZD 1MAFL 1MAEL 3SLEC 1MDAL 3RMZC 2OK4D 2BBKL 2OIZD 2AH0D 2IUVD 2HJBD 2IURD 4FAVC 2AGWD 2MADL 4FA9C 3SVWC 3RN1C 2J56L 2J57K 2H47B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL D;  4O1Q C;  2I0T D;  3SWS C;  3SJL C;  4L1Q C;  2H3X B;  4FA4 C;  2MTA L;  4FAN C;  2IAA B;  2AH1 D;  2OK6 D;  3RN0 C;  2HJ4 D;  3L4M C;  3ORV C;  4L3G C;  3RLM C;  3SXT C;  2IUQ D;  2HKR D;  2HXC D;  2GC7 B;  1MG3 B;  4L3H C;  1MG2 B;  2IUP D;  2Q7Q D;  4FA1 C;  2AGX D;  2GC4 B;  2I0R D;  4FB1 C;  2AGY D;  2J55 L;  2OJY D;  3C75 L;  3PXT C;  3PXS C;  3PXW C;  4Y5R C;  4FA5 C;  2I0S D;  2HKM D;  3L4O C;  4K3I C;  2AGZ D;  1MAF L;  1MAE L;  3SLE C;  1MDA L;  3RMZ C;  2OK4 D;  2BBK L;  2OIZ D;  2AH0 D;  2IUV D;  2HJB D;  2IUR D;  4FAV C;  2AGW D;  2MAD L;  4FA9 C;  3SVW C;  3RN1 C;  2J56 L;  2J57 K;  2H47 B; 
#chains in the Genus database with same CATH topology
 2AGL D;  4O1Q C;  2I0T D;  3SWS C;  3SJL C;  4L1Q C;  2H3X B;  4FA4 C;  2MTA L;  4FAN C;  2IAA B;  2AH1 D;  2OK6 D;  3RN0 C;  2HJ4 D;  3L4M C;  3ORV C;  4L3G C;  3RLM C;  3SXT C;  2IUQ D;  2HKR D;  2HXC D;  2GC7 B;  1MG3 B;  4L3H C;  1MG2 B;  2IUP D;  2Q7Q D;  4FA1 C;  2AGX D;  2GC4 B;  2I0R D;  4FB1 C;  2AGY D;  2J55 L;  2OJY D;  3C75 L;  3PXT C;  3PXS C;  3PXW C;  4Y5R C;  4FA5 C;  2I0S D;  2HKM D;  3L4O C;  4K3I C;  2AGZ D;  1MAF L;  1MAE L;  3SLE C;  1MDA L;  3RMZ C;  2OK4 D;  2BBK L;  2OIZ D;  2AH0 D;  2IUV D;  2HJB D;  2IUR D;  4FAV C;  2AGW D;  2MAD L;  4FA9 C;  3SVW C;  3RN1 C;  2J56 L;  2J57 K;  2H47 B; 
#chains in the Genus database with same CATH homology
 2AGL D;  4O1Q C;  2I0T D;  3SWS C;  3SJL C;  4L1Q C;  2H3X B;  4FA4 C;  2MTA L;  4FAN C;  2IAA B;  2AH1 D;  2OK6 D;  3RN0 C;  2HJ4 D;  3L4M C;  3ORV C;  4L3G C;  3RLM C;  3SXT C;  2IUQ D;  2HKR D;  2HXC D;  2GC7 B;  1MG3 B;  4L3H C;  1MG2 B;  2IUP D;  2Q7Q D;  4FA1 C;  2AGX D;  2GC4 B;  2I0R D;  4FB1 C;  2AGY D;  2J55 L;  2OJY D;  3C75 L;  3PXT C;  3PXS C;  3PXW C;  4Y5R C;  4FA5 C;  2I0S D;  2HKM D;  3L4O C;  4K3I C;  2AGZ D;  1MAF L;  1MAE L;  3SLE C;  1MDA L;  3RMZ C;  2OK4 D;  2BBK L;  2OIZ D;  2AH0 D;  2IUV D;  2HJB D;  2IUR D;  4FAV C;  2AGW D;  2MAD L;  4FA9 C;  3SVW C;  3RN1 C;  2J56 L;  2J57 K;  2H47 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...