3L4MC

Crystal structure of the maug/pre-methylamine dehydrogenase complex.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3l4mC00
4Y5RC 2GC7B 4L3HC 3PXSC 2OIZD 2IUVD 4FA5C 2H3XB 2HXCD 2OK6D 3SJLC 2I0SD 2I0TD 2Q7QD 2OK4D 3SLEC 2AGYD 2AH1D 3ORVC 2IUPD 4O1QC 4FA9C 3RN1C 3RN0C 2BBKL 2HKMD 4FA4C 3SWSC 3PXTC 3SVWC 2AGXD 4K3IC 2AGWD 2HKRD 2IUQD 2OJYD 1MG3B 3RMZC 2GC4B 4L1QC 4FANC 2IURD 3PXWC 4FB1C 4FAVC 2J57K 1MDAL 2H47B 1MAEL 3SXTC 2IAAB 2J55L 2HJBD 1MAFL 2I0RD 2MADL 4L3GC 3L4OC 2HJ4D 2AGLD 3C75L 2AGZD 3L4MC 2AH0D 2J56L 2MTAL 3RLMC 4FA1C 1MG2B
chains in the Genus database with same CATH superfamily
4Y5RC 2GC7B 4L3HC 3PXSC 2OIZD 2IUVD 4FA5C 2H3XB 2HXCD 2OK6D 3SJLC 2I0SD 2I0TD 2Q7QD 2OK4D 3SLEC 2AGYD 2AH1D 3ORVC 2IUPD 4O1QC 4FA9C 3RN1C 3RN0C 2BBKL 2HKMD 4FA4C 3SWSC 3PXTC 3SVWC 2AGXD 4K3IC 2AGWD 2HKRD 2IUQD 2OJYD 1MG3B 3RMZC 2GC4B 4L1QC 4FANC 2IURD 3PXWC 4FB1C 4FAVC 2J57K 1MDAL 2H47B 1MAEL 3SXTC 2IAAB 2J55L 2HJBD 1MAFL 2I0RD 2MADL 4L3GC 3L4OC 2HJ4D 2AGLD 3C75L 2AGZD 3L4MC 2AH0D 2J56L 2MTAL 3RLMC 4FA1C 1MG2B
chains in the Genus database with same CATH topology
4Y5RC 2GC7B 4L3HC 3PXSC 2OIZD 2IUVD 4FA5C 2H3XB 2HXCD 2OK6D 3SJLC 2I0SD 2I0TD 2Q7QD 2OK4D 3SLEC 2AGYD 2AH1D 3ORVC 2IUPD 4O1QC 4FA9C 3RN1C 3RN0C 2BBKL 2HKMD 4FA4C 3SWSC 3PXTC 3SVWC 2AGXD 4K3IC 2AGWD 2HKRD 2IUQD 2OJYD 1MG3B 3RMZC 2GC4B 4L1QC 4FANC 2IURD 3PXWC 4FB1C 4FAVC 2J57K 1MDAL 2H47B 1MAEL 3SXTC 2IAAB 2J55L 2HJBD 1MAFL 2I0RD 2MADL 4L3GC 3L4OC 2HJ4D 2AGLD 3C75L 2AGZD 3L4MC 2AH0D 2J56L 2MTAL 3RLMC 4FA1C 1MG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5R C;  2GC7 B;  4L3H C;  3PXS C;  2OIZ D;  2IUV D;  4FA5 C;  2H3X B;  2HXC D;  2OK6 D;  3SJL C;  2I0S D;  2I0T D;  2Q7Q D;  2OK4 D;  3SLE C;  2AGY D;  2AH1 D;  3ORV C;  2IUP D;  4O1Q C;  4FA9 C;  3RN1 C;  3RN0 C;  2BBK L;  2HKM D;  4FA4 C;  3SWS C;  3PXT C;  3SVW C;  2AGX D;  4K3I C;  2AGW D;  2HKR D;  2IUQ D;  2OJY D;  1MG3 B;  3RMZ C;  2GC4 B;  4L1Q C;  4FAN C;  2IUR D;  3PXW C;  4FB1 C;  4FAV C;  2J57 K;  1MDA L;  2H47 B;  1MAE L;  3SXT C;  2IAA B;  2J55 L;  2HJB D;  1MAF L;  2I0R D;  2MAD L;  4L3G C;  3L4O C;  2HJ4 D;  2AGL D;  3C75 L;  2AGZ D;  3L4M C;  2AH0 D;  2J56 L;  2MTA L;  3RLM C;  4FA1 C;  1MG2 B; 
#chains in the Genus database with same CATH topology
 4Y5R C;  2GC7 B;  4L3H C;  3PXS C;  2OIZ D;  2IUV D;  4FA5 C;  2H3X B;  2HXC D;  2OK6 D;  3SJL C;  2I0S D;  2I0T D;  2Q7Q D;  2OK4 D;  3SLE C;  2AGY D;  2AH1 D;  3ORV C;  2IUP D;  4O1Q C;  4FA9 C;  3RN1 C;  3RN0 C;  2BBK L;  2HKM D;  4FA4 C;  3SWS C;  3PXT C;  3SVW C;  2AGX D;  4K3I C;  2AGW D;  2HKR D;  2IUQ D;  2OJY D;  1MG3 B;  3RMZ C;  2GC4 B;  4L1Q C;  4FAN C;  2IUR D;  3PXW C;  4FB1 C;  4FAV C;  2J57 K;  1MDA L;  2H47 B;  1MAE L;  3SXT C;  2IAA B;  2J55 L;  2HJB D;  1MAF L;  2I0R D;  2MAD L;  4L3G C;  3L4O C;  2HJ4 D;  2AGL D;  3C75 L;  2AGZ D;  3L4M C;  2AH0 D;  2J56 L;  2MTA L;  3RLM C;  4FA1 C;  1MG2 B; 
#chains in the Genus database with same CATH homology
 4Y5R C;  2GC7 B;  4L3H C;  3PXS C;  2OIZ D;  2IUV D;  4FA5 C;  2H3X B;  2HXC D;  2OK6 D;  3SJL C;  2I0S D;  2I0T D;  2Q7Q D;  2OK4 D;  3SLE C;  2AGY D;  2AH1 D;  3ORV C;  2IUP D;  4O1Q C;  4FA9 C;  3RN1 C;  3RN0 C;  2BBK L;  2HKM D;  4FA4 C;  3SWS C;  3PXT C;  3SVW C;  2AGX D;  4K3I C;  2AGW D;  2HKR D;  2IUQ D;  2OJY D;  1MG3 B;  3RMZ C;  2GC4 B;  4L1Q C;  4FAN C;  2IUR D;  3PXW C;  4FB1 C;  4FAV C;  2J57 K;  1MDA L;  2H47 B;  1MAE L;  3SXT C;  2IAA B;  2J55 L;  2HJB D;  1MAF L;  2I0R D;  2MAD L;  4L3G C;  3L4O C;  2HJ4 D;  2AGL D;  3C75 L;  2AGZ D;  3L4M C;  2AH0 D;  2J56 L;  2MTA L;  3RLM C;  4FA1 C;  1MG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...