3C75L

Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus.
pubmed doi rcsb
total genus 32
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3c75L00
4L3HC 2AGXD 3PXTC 3SVWC 2OJYD 2AGLD 2GC4B 2H47B 4K3IC 1MG3B 1MDAL 2IURD 3SLEC 2BBKL 2HJ4D 2OIZD 2IAAB 2AGZD 2I0RD 2J55L 2J56L 2HKRD 3L4OC 2I0TD 2J57K 3RN1C 4FB1C 3RMZC 2Q7QD 4L1QC 4FA4C 2H3XB 2I0SD 3ORVC 2AGYD 2MADL 2IUQD 4L3GC 2AH1D 2OK6D 3C75L 4Y5RC 2HJBD 2IUPD 3RN0C 4FA1C 2IUVD 3RLMC 4O1QC 2AH0D 3SJLC 4FAVC 3SWSC 3PXWC 4FA5C 1MAEL 1MG2B 2GC7B 2HKMD 3SXTC 2MTAL 4FA9C 2OK4D 4FANC 2HXCD 3L4MC 1MAFL 2AGWD 3PXSC
chains in the Genus database with same CATH superfamily
4L3HC 2AGXD 3PXTC 3SVWC 2OJYD 2AGLD 2GC4B 2H47B 4K3IC 1MG3B 1MDAL 2IURD 3SLEC 2BBKL 2HJ4D 2OIZD 2IAAB 2AGZD 2I0RD 2J55L 2J56L 2HKRD 3L4OC 2I0TD 2J57K 3RN1C 4FB1C 3RMZC 2Q7QD 4L1QC 4FA4C 2H3XB 2I0SD 3ORVC 2AGYD 2MADL 2IUQD 4L3GC 2AH1D 2OK6D 3C75L 4Y5RC 2HJBD 2IUPD 3RN0C 4FA1C 2IUVD 3RLMC 4O1QC 2AH0D 3SJLC 4FAVC 3SWSC 3PXWC 4FA5C 1MAEL 1MG2B 2GC7B 2HKMD 3SXTC 2MTAL 4FA9C 2OK4D 4FANC 2HXCD 3L4MC 1MAFL 2AGWD 3PXSC
chains in the Genus database with same CATH topology
4L3HC 2AGXD 3PXTC 3SVWC 2OJYD 2AGLD 2GC4B 2H47B 4K3IC 1MG3B 1MDAL 2IURD 3SLEC 2BBKL 2HJ4D 2OIZD 2IAAB 2AGZD 2I0RD 2J55L 2J56L 2HKRD 3L4OC 2I0TD 2J57K 3RN1C 4FB1C 3RMZC 2Q7QD 4L1QC 4FA4C 2H3XB 2I0SD 3ORVC 2AGYD 2MADL 2IUQD 4L3GC 2AH1D 2OK6D 3C75L 4Y5RC 2HJBD 2IUPD 3RN0C 4FA1C 2IUVD 3RLMC 4O1QC 2AH0D 3SJLC 4FAVC 3SWSC 3PXWC 4FA5C 1MAEL 1MG2B 2GC7B 2HKMD 3SXTC 2MTAL 4FA9C 2OK4D 4FANC 2HXCD 3L4MC 1MAFL 2AGWD 3PXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H C;  2AGX D;  3PXT C;  3SVW C;  2OJY D;  2AGL D;  2GC4 B;  2H47 B;  4K3I C;  1MG3 B;  1MDA L;  2IUR D;  3SLE C;  2BBK L;  2HJ4 D;  2OIZ D;  2IAA B;  2AGZ D;  2I0R D;  2J55 L;  2J56 L;  2HKR D;  3L4O C;  2I0T D;  2J57 K;  3RN1 C;  4FB1 C;  3RMZ C;  2Q7Q D;  4L1Q C;  4FA4 C;  2H3X B;  2I0S D;  3ORV C;  2AGY D;  2MAD L;  2IUQ D;  4L3G C;  2AH1 D;  2OK6 D;  3C75 L;  4Y5R C;  2HJB D;  2IUP D;  3RN0 C;  4FA1 C;  2IUV D;  3RLM C;  4O1Q C;  2AH0 D;  3SJL C;  4FAV C;  3SWS C;  3PXW C;  4FA5 C;  1MAE L;  1MG2 B;  2GC7 B;  2HKM D;  3SXT C;  2MTA L;  4FA9 C;  2OK4 D;  4FAN C;  2HXC D;  3L4M C;  1MAF L;  2AGW D;  3PXS C; 
#chains in the Genus database with same CATH topology
 4L3H C;  2AGX D;  3PXT C;  3SVW C;  2OJY D;  2AGL D;  2GC4 B;  2H47 B;  4K3I C;  1MG3 B;  1MDA L;  2IUR D;  3SLE C;  2BBK L;  2HJ4 D;  2OIZ D;  2IAA B;  2AGZ D;  2I0R D;  2J55 L;  2J56 L;  2HKR D;  3L4O C;  2I0T D;  2J57 K;  3RN1 C;  4FB1 C;  3RMZ C;  2Q7Q D;  4L1Q C;  4FA4 C;  2H3X B;  2I0S D;  3ORV C;  2AGY D;  2MAD L;  2IUQ D;  4L3G C;  2AH1 D;  2OK6 D;  3C75 L;  4Y5R C;  2HJB D;  2IUP D;  3RN0 C;  4FA1 C;  2IUV D;  3RLM C;  4O1Q C;  2AH0 D;  3SJL C;  4FAV C;  3SWS C;  3PXW C;  4FA5 C;  1MAE L;  1MG2 B;  2GC7 B;  2HKM D;  3SXT C;  2MTA L;  4FA9 C;  2OK4 D;  4FAN C;  2HXC D;  3L4M C;  1MAF L;  2AGW D;  3PXS C; 
#chains in the Genus database with same CATH homology
 4L3H C;  2AGX D;  3PXT C;  3SVW C;  2OJY D;  2AGL D;  2GC4 B;  2H47 B;  4K3I C;  1MG3 B;  1MDA L;  2IUR D;  3SLE C;  2BBK L;  2HJ4 D;  2OIZ D;  2IAA B;  2AGZ D;  2I0R D;  2J55 L;  2J56 L;  2HKR D;  3L4O C;  2I0T D;  2J57 K;  3RN1 C;  4FB1 C;  3RMZ C;  2Q7Q D;  4L1Q C;  4FA4 C;  2H3X B;  2I0S D;  3ORV C;  2AGY D;  2MAD L;  2IUQ D;  4L3G C;  2AH1 D;  2OK6 D;  3C75 L;  4Y5R C;  2HJB D;  2IUP D;  3RN0 C;  4FA1 C;  2IUV D;  3RLM C;  4O1Q C;  2AH0 D;  3SJL C;  4FAV C;  3SWS C;  3PXW C;  4FA5 C;  1MAE L;  1MG2 B;  2GC7 B;  2HKM D;  3SXT C;  2MTA L;  4FA9 C;  2OK4 D;  4FAN C;  2HXC D;  3L4M C;  1MAF L;  2AGW D;  3PXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...