3C75L

Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
b'VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3c75L00
3L4OC 3PXSC 3PXWC 1MG3B 1MDAL 1MAEL 2AGYD 2IAAB 2IURD 3RMZC 2I0SD 3SJLC 4L3HC 2AGZD 4FA9C 2IUVD 2BBKL 1MG2B 2HKRD 2MADL 4K3IC 4L3GC 2HJ4D 3SXTC 3SVWC 2J57K 2HJBD 2HKMD 2OJYD 2OIZD 2I0RD 4FANC 3SLEC 2J56L 4FA4C 1MAFL 2AGXD 3L4MC 3RN0C 4FB1C 2MTAL 4FA5C 3PXTC 3RN1C 2OK4D 2GC4B 2IUQD 3ORVC 2AH0D 4L1QC 3SWSC 4Y5RC 2AH1D 2Q7QD 3C75L 3RLMC 2IUPD 2I0TD 2AGLD 4FAVC 2H47B 2OK6D 2GC7B 2HXCD 4O1QC 2H3XB 2J55L 2AGWD 4FA1C
chains in the Genus database with same CATH superfamily
3L4OC 3PXSC 3PXWC 1MG3B 1MDAL 1MAEL 2AGYD 2IAAB 2IURD 3RMZC 2I0SD 3SJLC 4L3HC 2AGZD 4FA9C 2IUVD 2BBKL 1MG2B 2HKRD 2MADL 4K3IC 4L3GC 2HJ4D 3SXTC 3SVWC 2J57K 2HJBD 2HKMD 2OJYD 2OIZD 2I0RD 4FANC 3SLEC 2J56L 4FA4C 1MAFL 2AGXD 3L4MC 3RN0C 4FB1C 2MTAL 4FA5C 3PXTC 3RN1C 2OK4D 2GC4B 2IUQD 3ORVC 2AH0D 4L1QC 3SWSC 4Y5RC 2AH1D 2Q7QD 3C75L 3RLMC 2IUPD 2I0TD 2AGLD 4FAVC 2H47B 2OK6D 2GC7B 2HXCD 4O1QC 2H3XB 2J55L 2AGWD 4FA1C
chains in the Genus database with same CATH topology
3L4OC 3PXSC 3PXWC 1MG3B 1MDAL 1MAEL 2AGYD 2IAAB 2IURD 3RMZC 2I0SD 3SJLC 4L3HC 2AGZD 4FA9C 2IUVD 2BBKL 1MG2B 2HKRD 2MADL 4K3IC 4L3GC 2HJ4D 3SXTC 3SVWC 2J57K 2HJBD 2HKMD 2OJYD 2OIZD 2I0RD 4FANC 3SLEC 2J56L 4FA4C 1MAFL 2AGXD 3L4MC 3RN0C 4FB1C 2MTAL 4FA5C 3PXTC 3RN1C 2OK4D 2GC4B 2IUQD 3ORVC 2AH0D 4L1QC 3SWSC 4Y5RC 2AH1D 2Q7QD 3C75L 3RLMC 2IUPD 2I0TD 2AGLD 4FAVC 2H47B 2OK6D 2GC7B 2HXCD 4O1QC 2H3XB 2J55L 2AGWD 4FA1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O C;  3PXS C;  3PXW C;  1MG3 B;  1MDA L;  1MAE L;  2AGY D;  2IAA B;  2IUR D;  3RMZ C;  2I0S D;  3SJL C;  4L3H C;  2AGZ D;  4FA9 C;  2IUV D;  2BBK L;  1MG2 B;  2HKR D;  2MAD L;  4K3I C;  4L3G C;  2HJ4 D;  3SXT C;  3SVW C;  2J57 K;  2HJB D;  2HKM D;  2OJY D;  2OIZ D;  2I0R D;  4FAN C;  3SLE C;  2J56 L;  4FA4 C;  1MAF L;  2AGX D;  3L4M C;  3RN0 C;  4FB1 C;  2MTA L;  4FA5 C;  3PXT C;  3RN1 C;  2OK4 D;  2GC4 B;  2IUQ D;  3ORV C;  2AH0 D;  4L1Q C;  3SWS C;  4Y5R C;  2AH1 D;  2Q7Q D;  3C75 L;  3RLM C;  2IUP D;  2I0T D;  2AGL D;  4FAV C;  2H47 B;  2OK6 D;  2GC7 B;  2HXC D;  4O1Q C;  2H3X B;  2J55 L;  2AGW D;  4FA1 C; 
#chains in the Genus database with same CATH topology
 3L4O C;  3PXS C;  3PXW C;  1MG3 B;  1MDA L;  1MAE L;  2AGY D;  2IAA B;  2IUR D;  3RMZ C;  2I0S D;  3SJL C;  4L3H C;  2AGZ D;  4FA9 C;  2IUV D;  2BBK L;  1MG2 B;  2HKR D;  2MAD L;  4K3I C;  4L3G C;  2HJ4 D;  3SXT C;  3SVW C;  2J57 K;  2HJB D;  2HKM D;  2OJY D;  2OIZ D;  2I0R D;  4FAN C;  3SLE C;  2J56 L;  4FA4 C;  1MAF L;  2AGX D;  3L4M C;  3RN0 C;  4FB1 C;  2MTA L;  4FA5 C;  3PXT C;  3RN1 C;  2OK4 D;  2GC4 B;  2IUQ D;  3ORV C;  2AH0 D;  4L1Q C;  3SWS C;  4Y5R C;  2AH1 D;  2Q7Q D;  3C75 L;  3RLM C;  2IUP D;  2I0T D;  2AGL D;  4FAV C;  2H47 B;  2OK6 D;  2GC7 B;  2HXC D;  4O1Q C;  2H3X B;  2J55 L;  2AGW D;  4FA1 C; 
#chains in the Genus database with same CATH homology
 3L4O C;  3PXS C;  3PXW C;  1MG3 B;  1MDA L;  1MAE L;  2AGY D;  2IAA B;  2IUR D;  3RMZ C;  2I0S D;  3SJL C;  4L3H C;  2AGZ D;  4FA9 C;  2IUV D;  2BBK L;  1MG2 B;  2HKR D;  2MAD L;  4K3I C;  4L3G C;  2HJ4 D;  3SXT C;  3SVW C;  2J57 K;  2HJB D;  2HKM D;  2OJY D;  2OIZ D;  2I0R D;  4FAN C;  3SLE C;  2J56 L;  4FA4 C;  1MAF L;  2AGX D;  3L4M C;  3RN0 C;  4FB1 C;  2MTA L;  4FA5 C;  3PXT C;  3RN1 C;  2OK4 D;  2GC4 B;  2IUQ D;  3ORV C;  2AH0 D;  4L1Q C;  3SWS C;  4Y5R C;  2AH1 D;  2Q7Q D;  3C75 L;  3RLM C;  2IUP D;  2I0T D;  2AGL D;  4FAV C;  2H47 B;  2OK6 D;  2GC7 B;  2HXC D;  4O1Q C;  2H3X B;  2J55 L;  2AGW D;  4FA1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...