3SXTC

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sxtC00
4Y5RC 2AGLD 2I0RD 2MTAL 2IUVD 3SVWC 2IAAB 2GC4B 2J57K 2AH0D 3ORVC 3SXTC 3PXSC 4FANC 2J56L 2OK4D 4FA5C 3RN0C 1MAEL 3RMZC 2AGWD 2HJ4D 3L4OC 2IURD 2HXCD 2BBKL 3L4MC 3RN1C 1MG3B 2I0TD 2Q7QD 2AGYD 1MDAL 3C75L 4FB1C 1MAFL 2HJBD 4FA9C 2OK6D 3RLMC 2HKMD 4FAVC 2AGZD 2J55L 2I0SD 3PXTC 4L1QC 1MG2B 4O1QC 2IUQD 3SLEC 2AGXD 4L3GC 3SWSC 2H47B 3PXWC 2HKRD 4L3HC 3SJLC 2GC7B 2H3XB 4FA1C 4K3IC 2OIZD 2OJYD 4FA4C 2AH1D 2MADL 2IUPD
chains in the Genus database with same CATH superfamily
4Y5RC 2AGLD 2I0RD 2MTAL 2IUVD 3SVWC 2IAAB 2GC4B 2J57K 2AH0D 3ORVC 3SXTC 3PXSC 4FANC 2J56L 2OK4D 4FA5C 3RN0C 1MAEL 3RMZC 2AGWD 2HJ4D 3L4OC 2IURD 2HXCD 2BBKL 3L4MC 3RN1C 1MG3B 2I0TD 2Q7QD 2AGYD 1MDAL 3C75L 4FB1C 1MAFL 2HJBD 4FA9C 2OK6D 3RLMC 2HKMD 4FAVC 2AGZD 2J55L 2I0SD 3PXTC 4L1QC 1MG2B 4O1QC 2IUQD 3SLEC 2AGXD 4L3GC 3SWSC 2H47B 3PXWC 2HKRD 4L3HC 3SJLC 2GC7B 2H3XB 4FA1C 4K3IC 2OIZD 2OJYD 4FA4C 2AH1D 2MADL 2IUPD
chains in the Genus database with same CATH topology
4Y5RC 2AGLD 2I0RD 2MTAL 2IUVD 3SVWC 2IAAB 2GC4B 2J57K 2AH0D 3ORVC 3SXTC 3PXSC 4FANC 2J56L 2OK4D 4FA5C 3RN0C 1MAEL 3RMZC 2AGWD 2HJ4D 3L4OC 2IURD 2HXCD 2BBKL 3L4MC 3RN1C 1MG3B 2I0TD 2Q7QD 2AGYD 1MDAL 3C75L 4FB1C 1MAFL 2HJBD 4FA9C 2OK6D 3RLMC 2HKMD 4FAVC 2AGZD 2J55L 2I0SD 3PXTC 4L1QC 1MG2B 4O1QC 2IUQD 3SLEC 2AGXD 4L3GC 3SWSC 2H47B 3PXWC 2HKRD 4L3HC 3SJLC 2GC7B 2H3XB 4FA1C 4K3IC 2OIZD 2OJYD 4FA4C 2AH1D 2MADL 2IUPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5R C;  2AGL D;  2I0R D;  2MTA L;  2IUV D;  3SVW C;  2IAA B;  2GC4 B;  2J57 K;  2AH0 D;  3ORV C;  3SXT C;  3PXS C;  4FAN C;  2J56 L;  2OK4 D;  4FA5 C;  3RN0 C;  1MAE L;  3RMZ C;  2AGW D;  2HJ4 D;  3L4O C;  2IUR D;  2HXC D;  2BBK L;  3L4M C;  3RN1 C;  1MG3 B;  2I0T D;  2Q7Q D;  2AGY D;  1MDA L;  3C75 L;  4FB1 C;  1MAF L;  2HJB D;  4FA9 C;  2OK6 D;  3RLM C;  2HKM D;  4FAV C;  2AGZ D;  2J55 L;  2I0S D;  3PXT C;  4L1Q C;  1MG2 B;  4O1Q C;  2IUQ D;  3SLE C;  2AGX D;  4L3G C;  3SWS C;  2H47 B;  3PXW C;  2HKR D;  4L3H C;  3SJL C;  2GC7 B;  2H3X B;  4FA1 C;  4K3I C;  2OIZ D;  2OJY D;  4FA4 C;  2AH1 D;  2MAD L;  2IUP D; 
#chains in the Genus database with same CATH topology
 4Y5R C;  2AGL D;  2I0R D;  2MTA L;  2IUV D;  3SVW C;  2IAA B;  2GC4 B;  2J57 K;  2AH0 D;  3ORV C;  3SXT C;  3PXS C;  4FAN C;  2J56 L;  2OK4 D;  4FA5 C;  3RN0 C;  1MAE L;  3RMZ C;  2AGW D;  2HJ4 D;  3L4O C;  2IUR D;  2HXC D;  2BBK L;  3L4M C;  3RN1 C;  1MG3 B;  2I0T D;  2Q7Q D;  2AGY D;  1MDA L;  3C75 L;  4FB1 C;  1MAF L;  2HJB D;  4FA9 C;  2OK6 D;  3RLM C;  2HKM D;  4FAV C;  2AGZ D;  2J55 L;  2I0S D;  3PXT C;  4L1Q C;  1MG2 B;  4O1Q C;  2IUQ D;  3SLE C;  2AGX D;  4L3G C;  3SWS C;  2H47 B;  3PXW C;  2HKR D;  4L3H C;  3SJL C;  2GC7 B;  2H3X B;  4FA1 C;  4K3I C;  2OIZ D;  2OJY D;  4FA4 C;  2AH1 D;  2MAD L;  2IUP D; 
#chains in the Genus database with same CATH homology
 4Y5R C;  2AGL D;  2I0R D;  2MTA L;  2IUV D;  3SVW C;  2IAA B;  2GC4 B;  2J57 K;  2AH0 D;  3ORV C;  3SXT C;  3PXS C;  4FAN C;  2J56 L;  2OK4 D;  4FA5 C;  3RN0 C;  1MAE L;  3RMZ C;  2AGW D;  2HJ4 D;  3L4O C;  2IUR D;  2HXC D;  2BBK L;  3L4M C;  3RN1 C;  1MG3 B;  2I0T D;  2Q7Q D;  2AGY D;  1MDA L;  3C75 L;  4FB1 C;  1MAF L;  2HJB D;  4FA9 C;  2OK6 D;  3RLM C;  2HKM D;  4FAV C;  2AGZ D;  2J55 L;  2I0S D;  3PXT C;  4L1Q C;  1MG2 B;  4O1Q C;  2IUQ D;  3SLE C;  2AGX D;  4L3G C;  3SWS C;  2H47 B;  3PXW C;  2HKR D;  4L3H C;  3SJL C;  2GC7 B;  2H3X B;  4FA1 C;  4K3I C;  2OIZ D;  2OJY D;  4FA4 C;  2AH1 D;  2MAD L;  2IUP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...