3SXTC

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
source organism Paracoccus denitrificans
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sxtC00
2IUPD 2I0RD 2OIZD 2AGWD 4FB1C 2AH0D 2IURD 4L1QC 4FA9C 1MDAL 2HJ4D 4K3IC 2AGLD 2OK4D 3RN0C 2HJBD 4FA5C 2AGYD 2BBKL 2H47B 2OK6D 3RLMC 4FA1C 2OJYD 4FANC 3PXSC 3RMZC 1MAEL 2Q7QD 4FA4C 2HKRD 2GC7B 2AGZD 2HKMD 3L4OC 3SXTC 3SWSC 2MTAL 2J56L 4O1QC 3SLEC 2J55L 2I0SD 3PXWC 2AH1D 2J57K 3C75L 4L3HC 3PXTC 4L3GC 1MG2B 2I0TD 2IAAB 2H3XB 3SVWC 1MG3B 3RN1C 1MAFL 3ORVC 2MADL 3L4MC 4Y5RC 4FAVC 2AGXD 3SJLC 2HXCD 2IUVD 2IUQD 2GC4B
chains in the Genus database with same CATH superfamily
2IUPD 2I0RD 2OIZD 2AGWD 4FB1C 2AH0D 2IURD 4L1QC 4FA9C 1MDAL 2HJ4D 4K3IC 2AGLD 2OK4D 3RN0C 2HJBD 4FA5C 2AGYD 2BBKL 2H47B 2OK6D 3RLMC 4FA1C 2OJYD 4FANC 3PXSC 3RMZC 1MAEL 2Q7QD 4FA4C 2HKRD 2GC7B 2AGZD 2HKMD 3L4OC 3SXTC 3SWSC 2MTAL 2J56L 4O1QC 3SLEC 2J55L 2I0SD 3PXWC 2AH1D 2J57K 3C75L 4L3HC 3PXTC 4L3GC 1MG2B 2I0TD 2IAAB 2H3XB 3SVWC 1MG3B 3RN1C 1MAFL 3ORVC 2MADL 3L4MC 4Y5RC 4FAVC 2AGXD 3SJLC 2HXCD 2IUVD 2IUQD 2GC4B
chains in the Genus database with same CATH topology
2IUPD 2I0RD 2OIZD 2AGWD 4FB1C 2AH0D 2IURD 4L1QC 4FA9C 1MDAL 2HJ4D 4K3IC 2AGLD 2OK4D 3RN0C 2HJBD 4FA5C 2AGYD 2BBKL 2H47B 2OK6D 3RLMC 4FA1C 2OJYD 4FANC 3PXSC 3RMZC 1MAEL 2Q7QD 4FA4C 2HKRD 2GC7B 2AGZD 2HKMD 3L4OC 3SXTC 3SWSC 2MTAL 2J56L 4O1QC 3SLEC 2J55L 2I0SD 3PXWC 2AH1D 2J57K 3C75L 4L3HC 3PXTC 4L3GC 1MG2B 2I0TD 2IAAB 2H3XB 3SVWC 1MG3B 3RN1C 1MAFL 3ORVC 2MADL 3L4MC 4Y5RC 4FAVC 2AGXD 3SJLC 2HXCD 2IUVD 2IUQD 2GC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUP D;  2I0R D;  2OIZ D;  2AGW D;  4FB1 C;  2AH0 D;  2IUR D;  4L1Q C;  4FA9 C;  1MDA L;  2HJ4 D;  4K3I C;  2AGL D;  2OK4 D;  3RN0 C;  2HJB D;  4FA5 C;  2AGY D;  2BBK L;  2H47 B;  2OK6 D;  3RLM C;  4FA1 C;  2OJY D;  4FAN C;  3PXS C;  3RMZ C;  1MAE L;  2Q7Q D;  4FA4 C;  2HKR D;  2GC7 B;  2AGZ D;  2HKM D;  3L4O C;  3SXT C;  3SWS C;  2MTA L;  2J56 L;  4O1Q C;  3SLE C;  2J55 L;  2I0S D;  3PXW C;  2AH1 D;  2J57 K;  3C75 L;  4L3H C;  3PXT C;  4L3G C;  1MG2 B;  2I0T D;  2IAA B;  2H3X B;  3SVW C;  1MG3 B;  3RN1 C;  1MAF L;  3ORV C;  2MAD L;  3L4M C;  4Y5R C;  4FAV C;  2AGX D;  3SJL C;  2HXC D;  2IUV D;  2IUQ D;  2GC4 B; 
#chains in the Genus database with same CATH topology
 2IUP D;  2I0R D;  2OIZ D;  2AGW D;  4FB1 C;  2AH0 D;  2IUR D;  4L1Q C;  4FA9 C;  1MDA L;  2HJ4 D;  4K3I C;  2AGL D;  2OK4 D;  3RN0 C;  2HJB D;  4FA5 C;  2AGY D;  2BBK L;  2H47 B;  2OK6 D;  3RLM C;  4FA1 C;  2OJY D;  4FAN C;  3PXS C;  3RMZ C;  1MAE L;  2Q7Q D;  4FA4 C;  2HKR D;  2GC7 B;  2AGZ D;  2HKM D;  3L4O C;  3SXT C;  3SWS C;  2MTA L;  2J56 L;  4O1Q C;  3SLE C;  2J55 L;  2I0S D;  3PXW C;  2AH1 D;  2J57 K;  3C75 L;  4L3H C;  3PXT C;  4L3G C;  1MG2 B;  2I0T D;  2IAA B;  2H3X B;  3SVW C;  1MG3 B;  3RN1 C;  1MAF L;  3ORV C;  2MAD L;  3L4M C;  4Y5R C;  4FAV C;  2AGX D;  3SJL C;  2HXC D;  2IUV D;  2IUQ D;  2GC4 B; 
#chains in the Genus database with same CATH homology
 2IUP D;  2I0R D;  2OIZ D;  2AGW D;  4FB1 C;  2AH0 D;  2IUR D;  4L1Q C;  4FA9 C;  1MDA L;  2HJ4 D;  4K3I C;  2AGL D;  2OK4 D;  3RN0 C;  2HJB D;  4FA5 C;  2AGY D;  2BBK L;  2H47 B;  2OK6 D;  3RLM C;  4FA1 C;  2OJY D;  4FAN C;  3PXS C;  3RMZ C;  1MAE L;  2Q7Q D;  4FA4 C;  2HKR D;  2GC7 B;  2AGZ D;  2HKM D;  3L4O C;  3SXT C;  3SWS C;  2MTA L;  2J56 L;  4O1Q C;  3SLE C;  2J55 L;  2I0S D;  3PXW C;  2AH1 D;  2J57 K;  3C75 L;  4L3H C;  3PXT C;  4L3G C;  1MG2 B;  2I0T D;  2IAA B;  2H3X B;  3SVW C;  1MG3 B;  3RN1 C;  1MAF L;  3ORV C;  2MAD L;  3L4M C;  4Y5R C;  4FAV C;  2AGX D;  3SJL C;  2HXC D;  2IUV D;  2IUQ D;  2GC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...