2J55L

X-ray reduced paraccocus denitrificans methylamine dehydrogenase o- quinone in complex with amicyanin.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j55L00
4K3IC 2BBKL 1MG2B 2IURD 3L4MC 3PXTC 2J55L 1MAEL 2AH1D 2GC4B 1MAFL 2HJBD 2H47B 3ORVC 3RN0C 2HKRD 2IUQD 4L1QC 4O1QC 2IUPD 4FAVC 3RLMC 2AGWD 2J57K 3L4OC 4L3GC 2IUVD 2AGZD 2HKMD 3RMZC 2OJYD 3C75L 1MDAL 3PXWC 2OIZD 3SJLC 1MG3B 2OK6D 4FA9C 2H3XB 3SWSC 3SVWC 4L3HC 2AH0D 4FB1C 2AGLD 2GC7B 3SXTC 2AGXD 4Y5RC 2I0RD 2I0SD 4FANC 2IAAB 2MADL 3PXSC 2J56L 4FA4C 2AGYD 2Q7QD 3RN1C 4FA5C 3SLEC 2I0TD 4FA1C 2OK4D 2HXCD 2HJ4D 2MTAL
chains in the Genus database with same CATH superfamily
4K3IC 2BBKL 1MG2B 2IURD 3L4MC 3PXTC 2J55L 1MAEL 2AH1D 2GC4B 1MAFL 2HJBD 2H47B 3ORVC 3RN0C 2HKRD 2IUQD 4L1QC 4O1QC 2IUPD 4FAVC 3RLMC 2AGWD 2J57K 3L4OC 4L3GC 2IUVD 2AGZD 2HKMD 3RMZC 2OJYD 3C75L 1MDAL 3PXWC 2OIZD 3SJLC 1MG3B 2OK6D 4FA9C 2H3XB 3SWSC 3SVWC 4L3HC 2AH0D 4FB1C 2AGLD 2GC7B 3SXTC 2AGXD 4Y5RC 2I0RD 2I0SD 4FANC 2IAAB 2MADL 3PXSC 2J56L 4FA4C 2AGYD 2Q7QD 3RN1C 4FA5C 3SLEC 2I0TD 4FA1C 2OK4D 2HXCD 2HJ4D 2MTAL
chains in the Genus database with same CATH topology
4K3IC 2BBKL 1MG2B 2IURD 3L4MC 3PXTC 2J55L 1MAEL 2AH1D 2GC4B 1MAFL 2HJBD 2H47B 3ORVC 3RN0C 2HKRD 2IUQD 4L1QC 4O1QC 2IUPD 4FAVC 3RLMC 2AGWD 2J57K 3L4OC 4L3GC 2IUVD 2AGZD 2HKMD 3RMZC 2OJYD 3C75L 1MDAL 3PXWC 2OIZD 3SJLC 1MG3B 2OK6D 4FA9C 2H3XB 3SWSC 3SVWC 4L3HC 2AH0D 4FB1C 2AGLD 2GC7B 3SXTC 2AGXD 4Y5RC 2I0RD 2I0SD 4FANC 2IAAB 2MADL 3PXSC 2J56L 4FA4C 2AGYD 2Q7QD 3RN1C 4FA5C 3SLEC 2I0TD 4FA1C 2OK4D 2HXCD 2HJ4D 2MTAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I C;  2BBK L;  1MG2 B;  2IUR D;  3L4M C;  3PXT C;  2J55 L;  1MAE L;  2AH1 D;  2GC4 B;  1MAF L;  2HJB D;  2H47 B;  3ORV C;  3RN0 C;  2HKR D;  2IUQ D;  4L1Q C;  4O1Q C;  2IUP D;  4FAV C;  3RLM C;  2AGW D;  2J57 K;  3L4O C;  4L3G C;  2IUV D;  2AGZ D;  2HKM D;  3RMZ C;  2OJY D;  3C75 L;  1MDA L;  3PXW C;  2OIZ D;  3SJL C;  1MG3 B;  2OK6 D;  4FA9 C;  2H3X B;  3SWS C;  3SVW C;  4L3H C;  2AH0 D;  4FB1 C;  2AGL D;  2GC7 B;  3SXT C;  2AGX D;  4Y5R C;  2I0R D;  2I0S D;  4FAN C;  2IAA B;  2MAD L;  3PXS C;  2J56 L;  4FA4 C;  2AGY D;  2Q7Q D;  3RN1 C;  4FA5 C;  3SLE C;  2I0T D;  4FA1 C;  2OK4 D;  2HXC D;  2HJ4 D;  2MTA L; 
#chains in the Genus database with same CATH topology
 4K3I C;  2BBK L;  1MG2 B;  2IUR D;  3L4M C;  3PXT C;  2J55 L;  1MAE L;  2AH1 D;  2GC4 B;  1MAF L;  2HJB D;  2H47 B;  3ORV C;  3RN0 C;  2HKR D;  2IUQ D;  4L1Q C;  4O1Q C;  2IUP D;  4FAV C;  3RLM C;  2AGW D;  2J57 K;  3L4O C;  4L3G C;  2IUV D;  2AGZ D;  2HKM D;  3RMZ C;  2OJY D;  3C75 L;  1MDA L;  3PXW C;  2OIZ D;  3SJL C;  1MG3 B;  2OK6 D;  4FA9 C;  2H3X B;  3SWS C;  3SVW C;  4L3H C;  2AH0 D;  4FB1 C;  2AGL D;  2GC7 B;  3SXT C;  2AGX D;  4Y5R C;  2I0R D;  2I0S D;  4FAN C;  2IAA B;  2MAD L;  3PXS C;  2J56 L;  4FA4 C;  2AGY D;  2Q7Q D;  3RN1 C;  4FA5 C;  3SLE C;  2I0T D;  4FA1 C;  2OK4 D;  2HXC D;  2HJ4 D;  2MTA L; 
#chains in the Genus database with same CATH homology
 4K3I C;  2BBK L;  1MG2 B;  2IUR D;  3L4M C;  3PXT C;  2J55 L;  1MAE L;  2AH1 D;  2GC4 B;  1MAF L;  2HJB D;  2H47 B;  3ORV C;  3RN0 C;  2HKR D;  2IUQ D;  4L1Q C;  4O1Q C;  2IUP D;  4FAV C;  3RLM C;  2AGW D;  2J57 K;  3L4O C;  4L3G C;  2IUV D;  2AGZ D;  2HKM D;  3RMZ C;  2OJY D;  3C75 L;  1MDA L;  3PXW C;  2OIZ D;  3SJL C;  1MG3 B;  2OK6 D;  4FA9 C;  2H3X B;  3SWS C;  3SVW C;  4L3H C;  2AH0 D;  4FB1 C;  2AGL D;  2GC7 B;  3SXT C;  2AGX D;  4Y5R C;  2I0R D;  2I0S D;  4FAN C;  2IAA B;  2MAD L;  3PXS C;  2J56 L;  4FA4 C;  2AGY D;  2Q7Q D;  3RN1 C;  4FA5 C;  3SLE C;  2I0T D;  4FA1 C;  2OK4 D;  2HXC D;  2HJ4 D;  2MTA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...