2J55L

X-ray reduced paraccocus denitrificans methylamine dehydrogenase o- quinone in complex with amicyanin.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j55L00
4FAVC 2J55L 3PXTC 2OJYD 4L1QC 2GC7B 2MADL 1MG2B 4O1QC 3RLMC 4FA1C 1MG3B 2OK6D 2AH1D 2I0SD 3L4MC 3SWSC 4FA4C 3RN0C 2GC4B 3RN1C 2BBKL 2H3XB 2HJ4D 1MDAL 2H47B 2HKRD 1MAFL 2IURD 4K3IC 3C75L 4L3GC 2J57K 3SLEC 2HJBD 3SVWC 2I0TD 3SJLC 3ORVC 3SXTC 4FA9C 2HKMD 2IUPD 3PXSC 2HXCD 4FANC 2AGZD 3PXWC 2AH0D 2AGYD 3RMZC 4FA5C 2AGWD 2J56L 2OK4D 4Y5RC 4L3HC 3L4OC 2I0RD 2IAAB 2Q7QD 2IUQD 2MTAL 2AGXD 1MAEL 2IUVD 4FB1C 2AGLD 2OIZD
chains in the Genus database with same CATH superfamily
4FAVC 2J55L 3PXTC 2OJYD 4L1QC 2GC7B 2MADL 1MG2B 4O1QC 3RLMC 4FA1C 1MG3B 2OK6D 2AH1D 2I0SD 3L4MC 3SWSC 4FA4C 3RN0C 2GC4B 3RN1C 2BBKL 2H3XB 2HJ4D 1MDAL 2H47B 2HKRD 1MAFL 2IURD 4K3IC 3C75L 4L3GC 2J57K 3SLEC 2HJBD 3SVWC 2I0TD 3SJLC 3ORVC 3SXTC 4FA9C 2HKMD 2IUPD 3PXSC 2HXCD 4FANC 2AGZD 3PXWC 2AH0D 2AGYD 3RMZC 4FA5C 2AGWD 2J56L 2OK4D 4Y5RC 4L3HC 3L4OC 2I0RD 2IAAB 2Q7QD 2IUQD 2MTAL 2AGXD 1MAEL 2IUVD 4FB1C 2AGLD 2OIZD
chains in the Genus database with same CATH topology
4FAVC 2J55L 3PXTC 2OJYD 4L1QC 2GC7B 2MADL 1MG2B 4O1QC 3RLMC 4FA1C 1MG3B 2OK6D 2AH1D 2I0SD 3L4MC 3SWSC 4FA4C 3RN0C 2GC4B 3RN1C 2BBKL 2H3XB 2HJ4D 1MDAL 2H47B 2HKRD 1MAFL 2IURD 4K3IC 3C75L 4L3GC 2J57K 3SLEC 2HJBD 3SVWC 2I0TD 3SJLC 3ORVC 3SXTC 4FA9C 2HKMD 2IUPD 3PXSC 2HXCD 4FANC 2AGZD 3PXWC 2AH0D 2AGYD 3RMZC 4FA5C 2AGWD 2J56L 2OK4D 4Y5RC 4L3HC 3L4OC 2I0RD 2IAAB 2Q7QD 2IUQD 2MTAL 2AGXD 1MAEL 2IUVD 4FB1C 2AGLD 2OIZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV C;  2J55 L;  3PXT C;  2OJY D;  4L1Q C;  2GC7 B;  2MAD L;  1MG2 B;  4O1Q C;  3RLM C;  4FA1 C;  1MG3 B;  2OK6 D;  2AH1 D;  2I0S D;  3L4M C;  3SWS C;  4FA4 C;  3RN0 C;  2GC4 B;  3RN1 C;  2BBK L;  2H3X B;  2HJ4 D;  1MDA L;  2H47 B;  2HKR D;  1MAF L;  2IUR D;  4K3I C;  3C75 L;  4L3G C;  2J57 K;  3SLE C;  2HJB D;  3SVW C;  2I0T D;  3SJL C;  3ORV C;  3SXT C;  4FA9 C;  2HKM D;  2IUP D;  3PXS C;  2HXC D;  4FAN C;  2AGZ D;  3PXW C;  2AH0 D;  2AGY D;  3RMZ C;  4FA5 C;  2AGW D;  2J56 L;  2OK4 D;  4Y5R C;  4L3H C;  3L4O C;  2I0R D;  2IAA B;  2Q7Q D;  2IUQ D;  2MTA L;  2AGX D;  1MAE L;  2IUV D;  4FB1 C;  2AGL D;  2OIZ D; 
#chains in the Genus database with same CATH topology
 4FAV C;  2J55 L;  3PXT C;  2OJY D;  4L1Q C;  2GC7 B;  2MAD L;  1MG2 B;  4O1Q C;  3RLM C;  4FA1 C;  1MG3 B;  2OK6 D;  2AH1 D;  2I0S D;  3L4M C;  3SWS C;  4FA4 C;  3RN0 C;  2GC4 B;  3RN1 C;  2BBK L;  2H3X B;  2HJ4 D;  1MDA L;  2H47 B;  2HKR D;  1MAF L;  2IUR D;  4K3I C;  3C75 L;  4L3G C;  2J57 K;  3SLE C;  2HJB D;  3SVW C;  2I0T D;  3SJL C;  3ORV C;  3SXT C;  4FA9 C;  2HKM D;  2IUP D;  3PXS C;  2HXC D;  4FAN C;  2AGZ D;  3PXW C;  2AH0 D;  2AGY D;  3RMZ C;  4FA5 C;  2AGW D;  2J56 L;  2OK4 D;  4Y5R C;  4L3H C;  3L4O C;  2I0R D;  2IAA B;  2Q7Q D;  2IUQ D;  2MTA L;  2AGX D;  1MAE L;  2IUV D;  4FB1 C;  2AGL D;  2OIZ D; 
#chains in the Genus database with same CATH homology
 4FAV C;  2J55 L;  3PXT C;  2OJY D;  4L1Q C;  2GC7 B;  2MAD L;  1MG2 B;  4O1Q C;  3RLM C;  4FA1 C;  1MG3 B;  2OK6 D;  2AH1 D;  2I0S D;  3L4M C;  3SWS C;  4FA4 C;  3RN0 C;  2GC4 B;  3RN1 C;  2BBK L;  2H3X B;  2HJ4 D;  1MDA L;  2H47 B;  2HKR D;  1MAF L;  2IUR D;  4K3I C;  3C75 L;  4L3G C;  2J57 K;  3SLE C;  2HJB D;  3SVW C;  2I0T D;  3SJL C;  3ORV C;  3SXT C;  4FA9 C;  2HKM D;  2IUP D;  3PXS C;  2HXC D;  4FAN C;  2AGZ D;  3PXW C;  2AH0 D;  2AGY D;  3RMZ C;  4FA5 C;  2AGW D;  2J56 L;  2OK4 D;  4Y5R C;  4L3H C;  3L4O C;  2I0R D;  2IAA B;  2Q7Q D;  2IUQ D;  2MTA L;  2AGX D;  1MAE L;  2IUV D;  4FB1 C;  2AGL D;  2OIZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...