3RMZC

Crystal structure of the w199f-maug/pre-methylamine dehydrogenase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 35
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rmzC00
2IURD 1MAFL 2GC4B 2AH0D 3SLEC 2H47B 1MDAL 3PXSC 2HKMD 2I0SD 2J55L 2MTAL 2J57K 2OK4D 4FA1C 2AGXD 2OIZD 4FANC 3SXTC 2IUQD 1MG2B 2IAAB 2HJBD 4K3IC 4L3HC 4FA5C 4L3GC 3ORVC 2H3XB 2BBKL 1MAEL 2I0RD 2IUPD 3SJLC 4FAVC 2MADL 2HJ4D 3SVWC 3PXWC 2OK6D 3C75L 4FA4C 3RN0C 2HKRD 2HXCD 3RN1C 2GC7B 4FA9C 1MG3B 4O1QC 2AGZD 3SWSC 2Q7QD 2AGLD 2AGYD 4Y5RC 3L4MC 2AGWD 2J56L 4L1QC 2OJYD 3RMZC 4FB1C 2IUVD 2AH1D 2I0TD 3L4OC 3PXTC 3RLMC
chains in the Genus database with same CATH superfamily
2IURD 1MAFL 2GC4B 2AH0D 3SLEC 2H47B 1MDAL 3PXSC 2HKMD 2I0SD 2J55L 2MTAL 2J57K 2OK4D 4FA1C 2AGXD 2OIZD 4FANC 3SXTC 2IUQD 1MG2B 2IAAB 2HJBD 4K3IC 4L3HC 4FA5C 4L3GC 3ORVC 2H3XB 2BBKL 1MAEL 2I0RD 2IUPD 3SJLC 4FAVC 2MADL 2HJ4D 3SVWC 3PXWC 2OK6D 3C75L 4FA4C 3RN0C 2HKRD 2HXCD 3RN1C 2GC7B 4FA9C 1MG3B 4O1QC 2AGZD 3SWSC 2Q7QD 2AGLD 2AGYD 4Y5RC 3L4MC 2AGWD 2J56L 4L1QC 2OJYD 3RMZC 4FB1C 2IUVD 2AH1D 2I0TD 3L4OC 3PXTC 3RLMC
chains in the Genus database with same CATH topology
2IURD 1MAFL 2GC4B 2AH0D 3SLEC 2H47B 1MDAL 3PXSC 2HKMD 2I0SD 2J55L 2MTAL 2J57K 2OK4D 4FA1C 2AGXD 2OIZD 4FANC 3SXTC 2IUQD 1MG2B 2IAAB 2HJBD 4K3IC 4L3HC 4FA5C 4L3GC 3ORVC 2H3XB 2BBKL 1MAEL 2I0RD 2IUPD 3SJLC 4FAVC 2MADL 2HJ4D 3SVWC 3PXWC 2OK6D 3C75L 4FA4C 3RN0C 2HKRD 2HXCD 3RN1C 2GC7B 4FA9C 1MG3B 4O1QC 2AGZD 3SWSC 2Q7QD 2AGLD 2AGYD 4Y5RC 3L4MC 2AGWD 2J56L 4L1QC 2OJYD 3RMZC 4FB1C 2IUVD 2AH1D 2I0TD 3L4OC 3PXTC 3RLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUR D;  1MAF L;  2GC4 B;  2AH0 D;  3SLE C;  2H47 B;  1MDA L;  3PXS C;  2HKM D;  2I0S D;  2J55 L;  2MTA L;  2J57 K;  2OK4 D;  4FA1 C;  2AGX D;  2OIZ D;  4FAN C;  3SXT C;  2IUQ D;  1MG2 B;  2IAA B;  2HJB D;  4K3I C;  4L3H C;  4FA5 C;  4L3G C;  3ORV C;  2H3X B;  2BBK L;  1MAE L;  2I0R D;  2IUP D;  3SJL C;  4FAV C;  2MAD L;  2HJ4 D;  3SVW C;  3PXW C;  2OK6 D;  3C75 L;  4FA4 C;  3RN0 C;  2HKR D;  2HXC D;  3RN1 C;  2GC7 B;  4FA9 C;  1MG3 B;  4O1Q C;  2AGZ D;  3SWS C;  2Q7Q D;  2AGL D;  2AGY D;  4Y5R C;  3L4M C;  2AGW D;  2J56 L;  4L1Q C;  2OJY D;  3RMZ C;  4FB1 C;  2IUV D;  2AH1 D;  2I0T D;  3L4O C;  3PXT C;  3RLM C; 
#chains in the Genus database with same CATH topology
 2IUR D;  1MAF L;  2GC4 B;  2AH0 D;  3SLE C;  2H47 B;  1MDA L;  3PXS C;  2HKM D;  2I0S D;  2J55 L;  2MTA L;  2J57 K;  2OK4 D;  4FA1 C;  2AGX D;  2OIZ D;  4FAN C;  3SXT C;  2IUQ D;  1MG2 B;  2IAA B;  2HJB D;  4K3I C;  4L3H C;  4FA5 C;  4L3G C;  3ORV C;  2H3X B;  2BBK L;  1MAE L;  2I0R D;  2IUP D;  3SJL C;  4FAV C;  2MAD L;  2HJ4 D;  3SVW C;  3PXW C;  2OK6 D;  3C75 L;  4FA4 C;  3RN0 C;  2HKR D;  2HXC D;  3RN1 C;  2GC7 B;  4FA9 C;  1MG3 B;  4O1Q C;  2AGZ D;  3SWS C;  2Q7Q D;  2AGL D;  2AGY D;  4Y5R C;  3L4M C;  2AGW D;  2J56 L;  4L1Q C;  2OJY D;  3RMZ C;  4FB1 C;  2IUV D;  2AH1 D;  2I0T D;  3L4O C;  3PXT C;  3RLM C; 
#chains in the Genus database with same CATH homology
 2IUR D;  1MAF L;  2GC4 B;  2AH0 D;  3SLE C;  2H47 B;  1MDA L;  3PXS C;  2HKM D;  2I0S D;  2J55 L;  2MTA L;  2J57 K;  2OK4 D;  4FA1 C;  2AGX D;  2OIZ D;  4FAN C;  3SXT C;  2IUQ D;  1MG2 B;  2IAA B;  2HJB D;  4K3I C;  4L3H C;  4FA5 C;  4L3G C;  3ORV C;  2H3X B;  2BBK L;  1MAE L;  2I0R D;  2IUP D;  3SJL C;  4FAV C;  2MAD L;  2HJ4 D;  3SVW C;  3PXW C;  2OK6 D;  3C75 L;  4FA4 C;  3RN0 C;  2HKR D;  2HXC D;  3RN1 C;  2GC7 B;  4FA9 C;  1MG3 B;  4O1Q C;  2AGZ D;  3SWS C;  2Q7Q D;  2AGL D;  2AGY D;  4Y5R C;  3L4M C;  2AGW D;  2J56 L;  4L1Q C;  2OJY D;  3RMZ C;  4FB1 C;  2IUV D;  2AH1 D;  2I0T D;  3L4O C;  3PXT C;  3RLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...