4O1QC

Crystal structure of the q103n-maug/pre-methylamine dehydrogenase complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Site-directed mutagenesis of Gln103 reveals the influence of this residue on the redox properties and stability of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4o1qC00
2MADL 4FA4C 1MG2B 2AGWD 2J57K 2HJ4D 2J56L 3RLMC 4L1QC 4FB1C 2OK4D 4FA9C 2IAAB 2I0SD 3SVWC 3RN1C 2BBKL 2HJBD 3SWSC 3C75L 2MTAL 2IURD 2Q7QD 4O1QC 3PXTC 3SXTC 4FA1C 1MDAL 2GC4B 2AGXD 2AH0D 4FANC 2OJYD 3PXWC 2AGYD 2I0RD 2IUQD 2IUPD 4L3GC 1MAFL 2I0TD 2IUVD 3L4MC 3ORVC 4FAVC 3SJLC 3PXSC 3L4OC 3SLEC 2OIZD 1MAEL 2AH1D 2AGZD 2J55L 2H47B 4K3IC 2AGLD 4FA5C 2GC7B 2H3XB 2HXCD 3RN0C 4Y5RC 2HKRD 2HKMD 4L3HC 1MG3B 2OK6D 3RMZC
chains in the Genus database with same CATH superfamily
2MADL 4FA4C 1MG2B 2AGWD 2J57K 2HJ4D 2J56L 3RLMC 4L1QC 4FB1C 2OK4D 4FA9C 2IAAB 2I0SD 3SVWC 3RN1C 2BBKL 2HJBD 3SWSC 3C75L 2MTAL 2IURD 2Q7QD 4O1QC 3PXTC 3SXTC 4FA1C 1MDAL 2GC4B 2AGXD 2AH0D 4FANC 2OJYD 3PXWC 2AGYD 2I0RD 2IUQD 2IUPD 4L3GC 1MAFL 2I0TD 2IUVD 3L4MC 3ORVC 4FAVC 3SJLC 3PXSC 3L4OC 3SLEC 2OIZD 1MAEL 2AH1D 2AGZD 2J55L 2H47B 4K3IC 2AGLD 4FA5C 2GC7B 2H3XB 2HXCD 3RN0C 4Y5RC 2HKRD 2HKMD 4L3HC 1MG3B 2OK6D 3RMZC
chains in the Genus database with same CATH topology
2MADL 4FA4C 1MG2B 2AGWD 2J57K 2HJ4D 2J56L 3RLMC 4L1QC 4FB1C 2OK4D 4FA9C 2IAAB 2I0SD 3SVWC 3RN1C 2BBKL 2HJBD 3SWSC 3C75L 2MTAL 2IURD 2Q7QD 4O1QC 3PXTC 3SXTC 4FA1C 1MDAL 2GC4B 2AGXD 2AH0D 4FANC 2OJYD 3PXWC 2AGYD 2I0RD 2IUQD 2IUPD 4L3GC 1MAFL 2I0TD 2IUVD 3L4MC 3ORVC 4FAVC 3SJLC 3PXSC 3L4OC 3SLEC 2OIZD 1MAEL 2AH1D 2AGZD 2J55L 2H47B 4K3IC 2AGLD 4FA5C 2GC7B 2H3XB 2HXCD 3RN0C 4Y5RC 2HKRD 2HKMD 4L3HC 1MG3B 2OK6D 3RMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAD L;  4FA4 C;  1MG2 B;  2AGW D;  2J57 K;  2HJ4 D;  2J56 L;  3RLM C;  4L1Q C;  4FB1 C;  2OK4 D;  4FA9 C;  2IAA B;  2I0S D;  3SVW C;  3RN1 C;  2BBK L;  2HJB D;  3SWS C;  3C75 L;  2MTA L;  2IUR D;  2Q7Q D;  4O1Q C;  3PXT C;  3SXT C;  4FA1 C;  1MDA L;  2GC4 B;  2AGX D;  2AH0 D;  4FAN C;  2OJY D;  3PXW C;  2AGY D;  2I0R D;  2IUQ D;  2IUP D;  4L3G C;  1MAF L;  2I0T D;  2IUV D;  3L4M C;  3ORV C;  4FAV C;  3SJL C;  3PXS C;  3L4O C;  3SLE C;  2OIZ D;  1MAE L;  2AH1 D;  2AGZ D;  2J55 L;  2H47 B;  4K3I C;  2AGL D;  4FA5 C;  2GC7 B;  2H3X B;  2HXC D;  3RN0 C;  4Y5R C;  2HKR D;  2HKM D;  4L3H C;  1MG3 B;  2OK6 D;  3RMZ C; 
#chains in the Genus database with same CATH topology
 2MAD L;  4FA4 C;  1MG2 B;  2AGW D;  2J57 K;  2HJ4 D;  2J56 L;  3RLM C;  4L1Q C;  4FB1 C;  2OK4 D;  4FA9 C;  2IAA B;  2I0S D;  3SVW C;  3RN1 C;  2BBK L;  2HJB D;  3SWS C;  3C75 L;  2MTA L;  2IUR D;  2Q7Q D;  4O1Q C;  3PXT C;  3SXT C;  4FA1 C;  1MDA L;  2GC4 B;  2AGX D;  2AH0 D;  4FAN C;  2OJY D;  3PXW C;  2AGY D;  2I0R D;  2IUQ D;  2IUP D;  4L3G C;  1MAF L;  2I0T D;  2IUV D;  3L4M C;  3ORV C;  4FAV C;  3SJL C;  3PXS C;  3L4O C;  3SLE C;  2OIZ D;  1MAE L;  2AH1 D;  2AGZ D;  2J55 L;  2H47 B;  4K3I C;  2AGL D;  4FA5 C;  2GC7 B;  2H3X B;  2HXC D;  3RN0 C;  4Y5R C;  2HKR D;  2HKM D;  4L3H C;  1MG3 B;  2OK6 D;  3RMZ C; 
#chains in the Genus database with same CATH homology
 2MAD L;  4FA4 C;  1MG2 B;  2AGW D;  2J57 K;  2HJ4 D;  2J56 L;  3RLM C;  4L1Q C;  4FB1 C;  2OK4 D;  4FA9 C;  2IAA B;  2I0S D;  3SVW C;  3RN1 C;  2BBK L;  2HJB D;  3SWS C;  3C75 L;  2MTA L;  2IUR D;  2Q7Q D;  4O1Q C;  3PXT C;  3SXT C;  4FA1 C;  1MDA L;  2GC4 B;  2AGX D;  2AH0 D;  4FAN C;  2OJY D;  3PXW C;  2AGY D;  2I0R D;  2IUQ D;  2IUP D;  4L3G C;  1MAF L;  2I0T D;  2IUV D;  3L4M C;  3ORV C;  4FAV C;  3SJL C;  3PXS C;  3L4O C;  3SLE C;  2OIZ D;  1MAE L;  2AH1 D;  2AGZ D;  2J55 L;  2H47 B;  4K3I C;  2AGL D;  4FA5 C;  2GC7 B;  2H3X B;  2HXC D;  3RN0 C;  4Y5R C;  2HKR D;  2HKM D;  4L3H C;  1MG3 B;  2OK6 D;  3RMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...