4O1QC

Crystal structure of the q103n-maug/pre-methylamine dehydrogenase complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Site-directed mutagenesis of Gln103 reveals the influence of this residue on the redox properties and stability of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4o1qC00
2HKRD 3RLMC 1MG2B 2HXCD 4Y5RC 2MADL 2IUVD 4FA5C 1MAFL 4FB1C 2HJ4D 2I0RD 2OK4D 2H47B 2IAAB 3L4MC 3PXWC 4FAVC 1MDAL 3SVWC 2GC4B 2I0TD 3SWSC 4K3IC 1MAEL 2OIZD 2HKMD 3PXSC 2AGYD 2AH1D 2J57K 2AGXD 2IUPD 2AGLD 2Q7QD 4L3HC 2MTAL 4O1QC 3PXTC 3RN1C 3RN0C 2HJBD 3SXTC 3SLEC 2I0SD 2OK6D 4FANC 4L1QC 2IURD 2IUQD 2J55L 3L4OC 2BBKL 4FA4C 3RMZC 2AGZD 4FA1C 4FA9C 3ORVC 1MG3B 2J56L 2GC7B 2OJYD 3C75L 4L3GC 2AH0D 3SJLC 2H3XB 2AGWD
chains in the Genus database with same CATH superfamily
2HKRD 3RLMC 1MG2B 2HXCD 4Y5RC 2MADL 2IUVD 4FA5C 1MAFL 4FB1C 2HJ4D 2I0RD 2OK4D 2H47B 2IAAB 3L4MC 3PXWC 4FAVC 1MDAL 3SVWC 2GC4B 2I0TD 3SWSC 4K3IC 1MAEL 2OIZD 2HKMD 3PXSC 2AGYD 2AH1D 2J57K 2AGXD 2IUPD 2AGLD 2Q7QD 4L3HC 2MTAL 4O1QC 3PXTC 3RN1C 3RN0C 2HJBD 3SXTC 3SLEC 2I0SD 2OK6D 4FANC 4L1QC 2IURD 2IUQD 2J55L 3L4OC 2BBKL 4FA4C 3RMZC 2AGZD 4FA1C 4FA9C 3ORVC 1MG3B 2J56L 2GC7B 2OJYD 3C75L 4L3GC 2AH0D 3SJLC 2H3XB 2AGWD
chains in the Genus database with same CATH topology
2HKRD 3RLMC 1MG2B 2HXCD 4Y5RC 2MADL 2IUVD 4FA5C 1MAFL 4FB1C 2HJ4D 2I0RD 2OK4D 2H47B 2IAAB 3L4MC 3PXWC 4FAVC 1MDAL 3SVWC 2GC4B 2I0TD 3SWSC 4K3IC 1MAEL 2OIZD 2HKMD 3PXSC 2AGYD 2AH1D 2J57K 2AGXD 2IUPD 2AGLD 2Q7QD 4L3HC 2MTAL 4O1QC 3PXTC 3RN1C 3RN0C 2HJBD 3SXTC 3SLEC 2I0SD 2OK6D 4FANC 4L1QC 2IURD 2IUQD 2J55L 3L4OC 2BBKL 4FA4C 3RMZC 2AGZD 4FA1C 4FA9C 3ORVC 1MG3B 2J56L 2GC7B 2OJYD 3C75L 4L3GC 2AH0D 3SJLC 2H3XB 2AGWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKR D;  3RLM C;  1MG2 B;  2HXC D;  4Y5R C;  2MAD L;  2IUV D;  4FA5 C;  1MAF L;  4FB1 C;  2HJ4 D;  2I0R D;  2OK4 D;  2H47 B;  2IAA B;  3L4M C;  3PXW C;  4FAV C;  1MDA L;  3SVW C;  2GC4 B;  2I0T D;  3SWS C;  4K3I C;  1MAE L;  2OIZ D;  2HKM D;  3PXS C;  2AGY D;  2AH1 D;  2J57 K;  2AGX D;  2IUP D;  2AGL D;  2Q7Q D;  4L3H C;  2MTA L;  4O1Q C;  3PXT C;  3RN1 C;  3RN0 C;  2HJB D;  3SXT C;  3SLE C;  2I0S D;  2OK6 D;  4FAN C;  4L1Q C;  2IUR D;  2IUQ D;  2J55 L;  3L4O C;  2BBK L;  4FA4 C;  3RMZ C;  2AGZ D;  4FA1 C;  4FA9 C;  3ORV C;  1MG3 B;  2J56 L;  2GC7 B;  2OJY D;  3C75 L;  4L3G C;  2AH0 D;  3SJL C;  2H3X B;  2AGW D; 
#chains in the Genus database with same CATH topology
 2HKR D;  3RLM C;  1MG2 B;  2HXC D;  4Y5R C;  2MAD L;  2IUV D;  4FA5 C;  1MAF L;  4FB1 C;  2HJ4 D;  2I0R D;  2OK4 D;  2H47 B;  2IAA B;  3L4M C;  3PXW C;  4FAV C;  1MDA L;  3SVW C;  2GC4 B;  2I0T D;  3SWS C;  4K3I C;  1MAE L;  2OIZ D;  2HKM D;  3PXS C;  2AGY D;  2AH1 D;  2J57 K;  2AGX D;  2IUP D;  2AGL D;  2Q7Q D;  4L3H C;  2MTA L;  4O1Q C;  3PXT C;  3RN1 C;  3RN0 C;  2HJB D;  3SXT C;  3SLE C;  2I0S D;  2OK6 D;  4FAN C;  4L1Q C;  2IUR D;  2IUQ D;  2J55 L;  3L4O C;  2BBK L;  4FA4 C;  3RMZ C;  2AGZ D;  4FA1 C;  4FA9 C;  3ORV C;  1MG3 B;  2J56 L;  2GC7 B;  2OJY D;  3C75 L;  4L3G C;  2AH0 D;  3SJL C;  2H3X B;  2AGW D; 
#chains in the Genus database with same CATH homology
 2HKR D;  3RLM C;  1MG2 B;  2HXC D;  4Y5R C;  2MAD L;  2IUV D;  4FA5 C;  1MAF L;  4FB1 C;  2HJ4 D;  2I0R D;  2OK4 D;  2H47 B;  2IAA B;  3L4M C;  3PXW C;  4FAV C;  1MDA L;  3SVW C;  2GC4 B;  2I0T D;  3SWS C;  4K3I C;  1MAE L;  2OIZ D;  2HKM D;  3PXS C;  2AGY D;  2AH1 D;  2J57 K;  2AGX D;  2IUP D;  2AGL D;  2Q7Q D;  4L3H C;  2MTA L;  4O1Q C;  3PXT C;  3RN1 C;  3RN0 C;  2HJB D;  3SXT C;  3SLE C;  2I0S D;  2OK6 D;  4FAN C;  4L1Q C;  2IUR D;  2IUQ D;  2J55 L;  3L4O C;  2BBK L;  4FA4 C;  3RMZ C;  2AGZ D;  4FA1 C;  4FA9 C;  3ORV C;  1MG3 B;  2J56 L;  2GC7 B;  2OJY D;  3C75 L;  4L3G C;  2AH0 D;  3SJL C;  2H3X B;  2AGW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...