4O1QC

Crystal structure of the q103n-maug/pre-methylamine dehydrogenase complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Site-directed mutagenesis of Gln103 reveals the influence of this residue on the redox properties and stability of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4o1qC00
3SVWC 2OIZD 2H3XB 4O1QC 2AH1D 2IUVD 2HKMD 2GC4B 2GC7B 2IURD 2MTAL 4Y5RC 2OJYD 4FB1C 4FA9C 1MG3B 3ORVC 2I0SD 2J57K 3PXTC 1MG2B 2I0RD 4L3HC 4L1QC 2Q7QD 2AGZD 2MADL 3RN0C 1MAEL 2IUPD 2IUQD 4FA5C 2BBKL 3RMZC 2AGXD 2H47B 3L4OC 2HKRD 2J56L 3RLMC 4FA1C 3L4MC 2HJ4D 2IAAB 2J55L 3C75L 3SXTC 1MAFL 3PXWC 3RN1C 3SJLC 4L3GC 4K3IC 2HXCD 2AGLD 3SWSC 2I0TD 2AGWD 3PXSC 2AH0D 2OK4D 1MDAL 4FA4C 2OK6D 4FAVC 3SLEC 2AGYD 2HJBD 4FANC
chains in the Genus database with same CATH superfamily
3SVWC 2OIZD 2H3XB 4O1QC 2AH1D 2IUVD 2HKMD 2GC4B 2GC7B 2IURD 2MTAL 4Y5RC 2OJYD 4FB1C 4FA9C 1MG3B 3ORVC 2I0SD 2J57K 3PXTC 1MG2B 2I0RD 4L3HC 4L1QC 2Q7QD 2AGZD 2MADL 3RN0C 1MAEL 2IUPD 2IUQD 4FA5C 2BBKL 3RMZC 2AGXD 2H47B 3L4OC 2HKRD 2J56L 3RLMC 4FA1C 3L4MC 2HJ4D 2IAAB 2J55L 3C75L 3SXTC 1MAFL 3PXWC 3RN1C 3SJLC 4L3GC 4K3IC 2HXCD 2AGLD 3SWSC 2I0TD 2AGWD 3PXSC 2AH0D 2OK4D 1MDAL 4FA4C 2OK6D 4FAVC 3SLEC 2AGYD 2HJBD 4FANC
chains in the Genus database with same CATH topology
3SVWC 2OIZD 2H3XB 4O1QC 2AH1D 2IUVD 2HKMD 2GC4B 2GC7B 2IURD 2MTAL 4Y5RC 2OJYD 4FB1C 4FA9C 1MG3B 3ORVC 2I0SD 2J57K 3PXTC 1MG2B 2I0RD 4L3HC 4L1QC 2Q7QD 2AGZD 2MADL 3RN0C 1MAEL 2IUPD 2IUQD 4FA5C 2BBKL 3RMZC 2AGXD 2H47B 3L4OC 2HKRD 2J56L 3RLMC 4FA1C 3L4MC 2HJ4D 2IAAB 2J55L 3C75L 3SXTC 1MAFL 3PXWC 3RN1C 3SJLC 4L3GC 4K3IC 2HXCD 2AGLD 3SWSC 2I0TD 2AGWD 3PXSC 2AH0D 2OK4D 1MDAL 4FA4C 2OK6D 4FAVC 3SLEC 2AGYD 2HJBD 4FANC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW C;  2OIZ D;  2H3X B;  4O1Q C;  2AH1 D;  2IUV D;  2HKM D;  2GC4 B;  2GC7 B;  2IUR D;  2MTA L;  4Y5R C;  2OJY D;  4FB1 C;  4FA9 C;  1MG3 B;  3ORV C;  2I0S D;  2J57 K;  3PXT C;  1MG2 B;  2I0R D;  4L3H C;  4L1Q C;  2Q7Q D;  2AGZ D;  2MAD L;  3RN0 C;  1MAE L;  2IUP D;  2IUQ D;  4FA5 C;  2BBK L;  3RMZ C;  2AGX D;  2H47 B;  3L4O C;  2HKR D;  2J56 L;  3RLM C;  4FA1 C;  3L4M C;  2HJ4 D;  2IAA B;  2J55 L;  3C75 L;  3SXT C;  1MAF L;  3PXW C;  3RN1 C;  3SJL C;  4L3G C;  4K3I C;  2HXC D;  2AGL D;  3SWS C;  2I0T D;  2AGW D;  3PXS C;  2AH0 D;  2OK4 D;  1MDA L;  4FA4 C;  2OK6 D;  4FAV C;  3SLE C;  2AGY D;  2HJB D;  4FAN C; 
#chains in the Genus database with same CATH topology
 3SVW C;  2OIZ D;  2H3X B;  4O1Q C;  2AH1 D;  2IUV D;  2HKM D;  2GC4 B;  2GC7 B;  2IUR D;  2MTA L;  4Y5R C;  2OJY D;  4FB1 C;  4FA9 C;  1MG3 B;  3ORV C;  2I0S D;  2J57 K;  3PXT C;  1MG2 B;  2I0R D;  4L3H C;  4L1Q C;  2Q7Q D;  2AGZ D;  2MAD L;  3RN0 C;  1MAE L;  2IUP D;  2IUQ D;  4FA5 C;  2BBK L;  3RMZ C;  2AGX D;  2H47 B;  3L4O C;  2HKR D;  2J56 L;  3RLM C;  4FA1 C;  3L4M C;  2HJ4 D;  2IAA B;  2J55 L;  3C75 L;  3SXT C;  1MAF L;  3PXW C;  3RN1 C;  3SJL C;  4L3G C;  4K3I C;  2HXC D;  2AGL D;  3SWS C;  2I0T D;  2AGW D;  3PXS C;  2AH0 D;  2OK4 D;  1MDA L;  4FA4 C;  2OK6 D;  4FAV C;  3SLE C;  2AGY D;  2HJB D;  4FAN C; 
#chains in the Genus database with same CATH homology
 3SVW C;  2OIZ D;  2H3X B;  4O1Q C;  2AH1 D;  2IUV D;  2HKM D;  2GC4 B;  2GC7 B;  2IUR D;  2MTA L;  4Y5R C;  2OJY D;  4FB1 C;  4FA9 C;  1MG3 B;  3ORV C;  2I0S D;  2J57 K;  3PXT C;  1MG2 B;  2I0R D;  4L3H C;  4L1Q C;  2Q7Q D;  2AGZ D;  2MAD L;  3RN0 C;  1MAE L;  2IUP D;  2IUQ D;  4FA5 C;  2BBK L;  3RMZ C;  2AGX D;  2H47 B;  3L4O C;  2HKR D;  2J56 L;  3RLM C;  4FA1 C;  3L4M C;  2HJ4 D;  2IAA B;  2J55 L;  3C75 L;  3SXT C;  1MAF L;  3PXW C;  3RN1 C;  3SJL C;  4L3G C;  4K3I C;  2HXC D;  2AGL D;  3SWS C;  2I0T D;  2AGW D;  3PXS C;  2AH0 D;  2OK4 D;  1MDA L;  4FA4 C;  2OK6 D;  4FAV C;  3SLE C;  2AGY D;  2HJB D;  4FAN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...