3RN1C

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rn1C00
2IUQD 2AGXD 4FA5C 2GC4B 2AGWD 2IAAB 2IUPD 2HJBD 3SXTC 3SVWC 2OJYD 4K3IC 2BBKL 1MAFL 3L4OC 3C75L 2IURD 3PXSC 2GC7B 2I0SD 2AH1D 2H3XB 3PXTC 4O1QC 4FA4C 2IUVD 2Q7QD 4Y5RC 2HKMD 2OK6D 4FA1C 2J56L 2HXCD 2H47B 4L1QC 2AGYD 1MAEL 3RLMC 4FAVC 3SLEC 3SJLC 2OK4D 2I0TD 4L3HC 3RN0C 3ORVC 1MG3B 4FA9C 2AGLD 1MDAL 2J57K 4FB1C 2AH0D 3L4MC 4FANC 4L3GC 2OIZD 1MG2B 3RN1C 2I0RD 2J55L 3RMZC 2AGZD 2HKRD 3SWSC 2MTAL 2HJ4D 2MADL 3PXWC
chains in the Genus database with same CATH superfamily
2IUQD 2AGXD 4FA5C 2GC4B 2AGWD 2IAAB 2IUPD 2HJBD 3SXTC 3SVWC 2OJYD 4K3IC 2BBKL 1MAFL 3L4OC 3C75L 2IURD 3PXSC 2GC7B 2I0SD 2AH1D 2H3XB 3PXTC 4O1QC 4FA4C 2IUVD 2Q7QD 4Y5RC 2HKMD 2OK6D 4FA1C 2J56L 2HXCD 2H47B 4L1QC 2AGYD 1MAEL 3RLMC 4FAVC 3SLEC 3SJLC 2OK4D 2I0TD 4L3HC 3RN0C 3ORVC 1MG3B 4FA9C 2AGLD 1MDAL 2J57K 4FB1C 2AH0D 3L4MC 4FANC 4L3GC 2OIZD 1MG2B 3RN1C 2I0RD 2J55L 3RMZC 2AGZD 2HKRD 3SWSC 2MTAL 2HJ4D 2MADL 3PXWC
chains in the Genus database with same CATH topology
2IUQD 2AGXD 4FA5C 2GC4B 2AGWD 2IAAB 2IUPD 2HJBD 3SXTC 3SVWC 2OJYD 4K3IC 2BBKL 1MAFL 3L4OC 3C75L 2IURD 3PXSC 2GC7B 2I0SD 2AH1D 2H3XB 3PXTC 4O1QC 4FA4C 2IUVD 2Q7QD 4Y5RC 2HKMD 2OK6D 4FA1C 2J56L 2HXCD 2H47B 4L1QC 2AGYD 1MAEL 3RLMC 4FAVC 3SLEC 3SJLC 2OK4D 2I0TD 4L3HC 3RN0C 3ORVC 1MG3B 4FA9C 2AGLD 1MDAL 2J57K 4FB1C 2AH0D 3L4MC 4FANC 4L3GC 2OIZD 1MG2B 3RN1C 2I0RD 2J55L 3RMZC 2AGZD 2HKRD 3SWSC 2MTAL 2HJ4D 2MADL 3PXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUQ D;  2AGX D;  4FA5 C;  2GC4 B;  2AGW D;  2IAA B;  2IUP D;  2HJB D;  3SXT C;  3SVW C;  2OJY D;  4K3I C;  2BBK L;  1MAF L;  3L4O C;  3C75 L;  2IUR D;  3PXS C;  2GC7 B;  2I0S D;  2AH1 D;  2H3X B;  3PXT C;  4O1Q C;  4FA4 C;  2IUV D;  2Q7Q D;  4Y5R C;  2HKM D;  2OK6 D;  4FA1 C;  2J56 L;  2HXC D;  2H47 B;  4L1Q C;  2AGY D;  1MAE L;  3RLM C;  4FAV C;  3SLE C;  3SJL C;  2OK4 D;  2I0T D;  4L3H C;  3RN0 C;  3ORV C;  1MG3 B;  4FA9 C;  2AGL D;  1MDA L;  2J57 K;  4FB1 C;  2AH0 D;  3L4M C;  4FAN C;  4L3G C;  2OIZ D;  1MG2 B;  3RN1 C;  2I0R D;  2J55 L;  3RMZ C;  2AGZ D;  2HKR D;  3SWS C;  2MTA L;  2HJ4 D;  2MAD L;  3PXW C; 
#chains in the Genus database with same CATH topology
 2IUQ D;  2AGX D;  4FA5 C;  2GC4 B;  2AGW D;  2IAA B;  2IUP D;  2HJB D;  3SXT C;  3SVW C;  2OJY D;  4K3I C;  2BBK L;  1MAF L;  3L4O C;  3C75 L;  2IUR D;  3PXS C;  2GC7 B;  2I0S D;  2AH1 D;  2H3X B;  3PXT C;  4O1Q C;  4FA4 C;  2IUV D;  2Q7Q D;  4Y5R C;  2HKM D;  2OK6 D;  4FA1 C;  2J56 L;  2HXC D;  2H47 B;  4L1Q C;  2AGY D;  1MAE L;  3RLM C;  4FAV C;  3SLE C;  3SJL C;  2OK4 D;  2I0T D;  4L3H C;  3RN0 C;  3ORV C;  1MG3 B;  4FA9 C;  2AGL D;  1MDA L;  2J57 K;  4FB1 C;  2AH0 D;  3L4M C;  4FAN C;  4L3G C;  2OIZ D;  1MG2 B;  3RN1 C;  2I0R D;  2J55 L;  3RMZ C;  2AGZ D;  2HKR D;  3SWS C;  2MTA L;  2HJ4 D;  2MAD L;  3PXW C; 
#chains in the Genus database with same CATH homology
 2IUQ D;  2AGX D;  4FA5 C;  2GC4 B;  2AGW D;  2IAA B;  2IUP D;  2HJB D;  3SXT C;  3SVW C;  2OJY D;  4K3I C;  2BBK L;  1MAF L;  3L4O C;  3C75 L;  2IUR D;  3PXS C;  2GC7 B;  2I0S D;  2AH1 D;  2H3X B;  3PXT C;  4O1Q C;  4FA4 C;  2IUV D;  2Q7Q D;  4Y5R C;  2HKM D;  2OK6 D;  4FA1 C;  2J56 L;  2HXC D;  2H47 B;  4L1Q C;  2AGY D;  1MAE L;  3RLM C;  4FAV C;  3SLE C;  3SJL C;  2OK4 D;  2I0T D;  4L3H C;  3RN0 C;  3ORV C;  1MG3 B;  4FA9 C;  2AGL D;  1MDA L;  2J57 K;  4FB1 C;  2AH0 D;  3L4M C;  4FAN C;  4L3G C;  2OIZ D;  1MG2 B;  3RN1 C;  2I0R D;  2J55 L;  3RMZ C;  2AGZ D;  2HKR D;  3SWS C;  2MTA L;  2HJ4 D;  2MAD L;  3PXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...