3RN1C

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rn1C00
3PXWC 1MG2B 2AGZD 2HKRD 2J56L 3RLMC 1MDAL 1MG3B 2IUQD 4K3IC 4FB1C 2IUPD 2OK6D 3ORVC 4O1QC 3SXTC 3SWSC 2AGXD 2I0SD 3SLEC 2J57K 2HJBD 4FA4C 4L3GC 3RN1C 2OJYD 4FA9C 3L4MC 2IAAB 3PXTC 2HKMD 4L3HC 2OK4D 2HJ4D 2AH1D 4L1QC 4FANC 1MAFL 2IUVD 3SJLC 2HXCD 3RMZC 2H47B 2MADL 3C75L 2I0RD 2AGWD 2GC4B 2AH0D 2AGLD 2AGYD 3PXSC 4FA1C 2I0TD 2Q7QD 4FA5C 1MAEL 3RN0C 3SVWC 2MTAL 4Y5RC 2IURD 2OIZD 4FAVC 2GC7B 2BBKL 2J55L 3L4OC 2H3XB
chains in the Genus database with same CATH superfamily
3PXWC 1MG2B 2AGZD 2HKRD 2J56L 3RLMC 1MDAL 1MG3B 2IUQD 4K3IC 4FB1C 2IUPD 2OK6D 3ORVC 4O1QC 3SXTC 3SWSC 2AGXD 2I0SD 3SLEC 2J57K 2HJBD 4FA4C 4L3GC 3RN1C 2OJYD 4FA9C 3L4MC 2IAAB 3PXTC 2HKMD 4L3HC 2OK4D 2HJ4D 2AH1D 4L1QC 4FANC 1MAFL 2IUVD 3SJLC 2HXCD 3RMZC 2H47B 2MADL 3C75L 2I0RD 2AGWD 2GC4B 2AH0D 2AGLD 2AGYD 3PXSC 4FA1C 2I0TD 2Q7QD 4FA5C 1MAEL 3RN0C 3SVWC 2MTAL 4Y5RC 2IURD 2OIZD 4FAVC 2GC7B 2BBKL 2J55L 3L4OC 2H3XB
chains in the Genus database with same CATH topology
3PXWC 1MG2B 2AGZD 2HKRD 2J56L 3RLMC 1MDAL 1MG3B 2IUQD 4K3IC 4FB1C 2IUPD 2OK6D 3ORVC 4O1QC 3SXTC 3SWSC 2AGXD 2I0SD 3SLEC 2J57K 2HJBD 4FA4C 4L3GC 3RN1C 2OJYD 4FA9C 3L4MC 2IAAB 3PXTC 2HKMD 4L3HC 2OK4D 2HJ4D 2AH1D 4L1QC 4FANC 1MAFL 2IUVD 3SJLC 2HXCD 3RMZC 2H47B 2MADL 3C75L 2I0RD 2AGWD 2GC4B 2AH0D 2AGLD 2AGYD 3PXSC 4FA1C 2I0TD 2Q7QD 4FA5C 1MAEL 3RN0C 3SVWC 2MTAL 4Y5RC 2IURD 2OIZD 4FAVC 2GC7B 2BBKL 2J55L 3L4OC 2H3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW C;  1MG2 B;  2AGZ D;  2HKR D;  2J56 L;  3RLM C;  1MDA L;  1MG3 B;  2IUQ D;  4K3I C;  4FB1 C;  2IUP D;  2OK6 D;  3ORV C;  4O1Q C;  3SXT C;  3SWS C;  2AGX D;  2I0S D;  3SLE C;  2J57 K;  2HJB D;  4FA4 C;  4L3G C;  3RN1 C;  2OJY D;  4FA9 C;  3L4M C;  2IAA B;  3PXT C;  2HKM D;  4L3H C;  2OK4 D;  2HJ4 D;  2AH1 D;  4L1Q C;  4FAN C;  1MAF L;  2IUV D;  3SJL C;  2HXC D;  3RMZ C;  2H47 B;  2MAD L;  3C75 L;  2I0R D;  2AGW D;  2GC4 B;  2AH0 D;  2AGL D;  2AGY D;  3PXS C;  4FA1 C;  2I0T D;  2Q7Q D;  4FA5 C;  1MAE L;  3RN0 C;  3SVW C;  2MTA L;  4Y5R C;  2IUR D;  2OIZ D;  4FAV C;  2GC7 B;  2BBK L;  2J55 L;  3L4O C;  2H3X B; 
#chains in the Genus database with same CATH topology
 3PXW C;  1MG2 B;  2AGZ D;  2HKR D;  2J56 L;  3RLM C;  1MDA L;  1MG3 B;  2IUQ D;  4K3I C;  4FB1 C;  2IUP D;  2OK6 D;  3ORV C;  4O1Q C;  3SXT C;  3SWS C;  2AGX D;  2I0S D;  3SLE C;  2J57 K;  2HJB D;  4FA4 C;  4L3G C;  3RN1 C;  2OJY D;  4FA9 C;  3L4M C;  2IAA B;  3PXT C;  2HKM D;  4L3H C;  2OK4 D;  2HJ4 D;  2AH1 D;  4L1Q C;  4FAN C;  1MAF L;  2IUV D;  3SJL C;  2HXC D;  3RMZ C;  2H47 B;  2MAD L;  3C75 L;  2I0R D;  2AGW D;  2GC4 B;  2AH0 D;  2AGL D;  2AGY D;  3PXS C;  4FA1 C;  2I0T D;  2Q7Q D;  4FA5 C;  1MAE L;  3RN0 C;  3SVW C;  2MTA L;  4Y5R C;  2IUR D;  2OIZ D;  4FAV C;  2GC7 B;  2BBK L;  2J55 L;  3L4O C;  2H3X B; 
#chains in the Genus database with same CATH homology
 3PXW C;  1MG2 B;  2AGZ D;  2HKR D;  2J56 L;  3RLM C;  1MDA L;  1MG3 B;  2IUQ D;  4K3I C;  4FB1 C;  2IUP D;  2OK6 D;  3ORV C;  4O1Q C;  3SXT C;  3SWS C;  2AGX D;  2I0S D;  3SLE C;  2J57 K;  2HJB D;  4FA4 C;  4L3G C;  3RN1 C;  2OJY D;  4FA9 C;  3L4M C;  2IAA B;  3PXT C;  2HKM D;  4L3H C;  2OK4 D;  2HJ4 D;  2AH1 D;  4L1Q C;  4FAN C;  1MAF L;  2IUV D;  3SJL C;  2HXC D;  3RMZ C;  2H47 B;  2MAD L;  3C75 L;  2I0R D;  2AGW D;  2GC4 B;  2AH0 D;  2AGL D;  2AGY D;  3PXS C;  4FA1 C;  2I0T D;  2Q7Q D;  4FA5 C;  1MAE L;  3RN0 C;  3SVW C;  2MTA L;  4Y5R C;  2IUR D;  2OIZ D;  4FAV C;  2GC7 B;  2BBK L;  2J55 L;  3L4O C;  2H3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...