3RN1C

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rn1C00
3SLEC 2OK6D 2HXCD 2BBKL 3RMZC 2H47B 3ORVC 4L3GC 3SWSC 4FA5C 4L1QC 4K3IC 2AGWD 3PXTC 3RN0C 4FA9C 2OK4D 3SVWC 2I0TD 2MADL 3L4OC 2AGZD 2AGYD 2I0RD 2J56L 4O1QC 3RN1C 2AGXD 2AH1D 2H3XB 3PXWC 3C75L 4L3HC 4Y5RC 3L4MC 1MG3B 2AH0D 2OJYD 2HJBD 4FA4C 2GC4B 2IUVD 2AGLD 1MG2B 3SJLC 1MAFL 2IURD 2IAAB 4FB1C 2J57K 4FA1C 2I0SD 1MAEL 2IUQD 3PXSC 3SXTC 2HKMD 2HKRD 2J55L 2HJ4D 3RLMC 2Q7QD 4FANC 4FAVC 2GC7B 2IUPD 2MTAL 2OIZD 1MDAL
chains in the Genus database with same CATH superfamily
3SLEC 2OK6D 2HXCD 2BBKL 3RMZC 2H47B 3ORVC 4L3GC 3SWSC 4FA5C 4L1QC 4K3IC 2AGWD 3PXTC 3RN0C 4FA9C 2OK4D 3SVWC 2I0TD 2MADL 3L4OC 2AGZD 2AGYD 2I0RD 2J56L 4O1QC 3RN1C 2AGXD 2AH1D 2H3XB 3PXWC 3C75L 4L3HC 4Y5RC 3L4MC 1MG3B 2AH0D 2OJYD 2HJBD 4FA4C 2GC4B 2IUVD 2AGLD 1MG2B 3SJLC 1MAFL 2IURD 2IAAB 4FB1C 2J57K 4FA1C 2I0SD 1MAEL 2IUQD 3PXSC 3SXTC 2HKMD 2HKRD 2J55L 2HJ4D 3RLMC 2Q7QD 4FANC 4FAVC 2GC7B 2IUPD 2MTAL 2OIZD 1MDAL
chains in the Genus database with same CATH topology
3SLEC 2OK6D 2HXCD 2BBKL 3RMZC 2H47B 3ORVC 4L3GC 3SWSC 4FA5C 4L1QC 4K3IC 2AGWD 3PXTC 3RN0C 4FA9C 2OK4D 3SVWC 2I0TD 2MADL 3L4OC 2AGZD 2AGYD 2I0RD 2J56L 4O1QC 3RN1C 2AGXD 2AH1D 2H3XB 3PXWC 3C75L 4L3HC 4Y5RC 3L4MC 1MG3B 2AH0D 2OJYD 2HJBD 4FA4C 2GC4B 2IUVD 2AGLD 1MG2B 3SJLC 1MAFL 2IURD 2IAAB 4FB1C 2J57K 4FA1C 2I0SD 1MAEL 2IUQD 3PXSC 3SXTC 2HKMD 2HKRD 2J55L 2HJ4D 3RLMC 2Q7QD 4FANC 4FAVC 2GC7B 2IUPD 2MTAL 2OIZD 1MDAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SLE C;  2OK6 D;  2HXC D;  2BBK L;  3RMZ C;  2H47 B;  3ORV C;  4L3G C;  3SWS C;  4FA5 C;  4L1Q C;  4K3I C;  2AGW D;  3PXT C;  3RN0 C;  4FA9 C;  2OK4 D;  3SVW C;  2I0T D;  2MAD L;  3L4O C;  2AGZ D;  2AGY D;  2I0R D;  2J56 L;  4O1Q C;  3RN1 C;  2AGX D;  2AH1 D;  2H3X B;  3PXW C;  3C75 L;  4L3H C;  4Y5R C;  3L4M C;  1MG3 B;  2AH0 D;  2OJY D;  2HJB D;  4FA4 C;  2GC4 B;  2IUV D;  2AGL D;  1MG2 B;  3SJL C;  1MAF L;  2IUR D;  2IAA B;  4FB1 C;  2J57 K;  4FA1 C;  2I0S D;  1MAE L;  2IUQ D;  3PXS C;  3SXT C;  2HKM D;  2HKR D;  2J55 L;  2HJ4 D;  3RLM C;  2Q7Q D;  4FAN C;  4FAV C;  2GC7 B;  2IUP D;  2MTA L;  2OIZ D;  1MDA L; 
#chains in the Genus database with same CATH topology
 3SLE C;  2OK6 D;  2HXC D;  2BBK L;  3RMZ C;  2H47 B;  3ORV C;  4L3G C;  3SWS C;  4FA5 C;  4L1Q C;  4K3I C;  2AGW D;  3PXT C;  3RN0 C;  4FA9 C;  2OK4 D;  3SVW C;  2I0T D;  2MAD L;  3L4O C;  2AGZ D;  2AGY D;  2I0R D;  2J56 L;  4O1Q C;  3RN1 C;  2AGX D;  2AH1 D;  2H3X B;  3PXW C;  3C75 L;  4L3H C;  4Y5R C;  3L4M C;  1MG3 B;  2AH0 D;  2OJY D;  2HJB D;  4FA4 C;  2GC4 B;  2IUV D;  2AGL D;  1MG2 B;  3SJL C;  1MAF L;  2IUR D;  2IAA B;  4FB1 C;  2J57 K;  4FA1 C;  2I0S D;  1MAE L;  2IUQ D;  3PXS C;  3SXT C;  2HKM D;  2HKR D;  2J55 L;  2HJ4 D;  3RLM C;  2Q7Q D;  4FAN C;  4FAV C;  2GC7 B;  2IUP D;  2MTA L;  2OIZ D;  1MDA L; 
#chains in the Genus database with same CATH homology
 3SLE C;  2OK6 D;  2HXC D;  2BBK L;  3RMZ C;  2H47 B;  3ORV C;  4L3G C;  3SWS C;  4FA5 C;  4L1Q C;  4K3I C;  2AGW D;  3PXT C;  3RN0 C;  4FA9 C;  2OK4 D;  3SVW C;  2I0T D;  2MAD L;  3L4O C;  2AGZ D;  2AGY D;  2I0R D;  2J56 L;  4O1Q C;  3RN1 C;  2AGX D;  2AH1 D;  2H3X B;  3PXW C;  3C75 L;  4L3H C;  4Y5R C;  3L4M C;  1MG3 B;  2AH0 D;  2OJY D;  2HJB D;  4FA4 C;  2GC4 B;  2IUV D;  2AGL D;  1MG2 B;  3SJL C;  1MAF L;  2IUR D;  2IAA B;  4FB1 C;  2J57 K;  4FA1 C;  2I0S D;  1MAE L;  2IUQ D;  3PXS C;  3SXT C;  2HKM D;  2HKR D;  2J55 L;  2HJ4 D;  3RLM C;  2Q7Q D;  4FAN C;  4FAV C;  2GC7 B;  2IUP D;  2MTA L;  2OIZ D;  1MDA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...