2IUVD

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 29
structure length 108
sequence length 109
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iuvD00
3PXWC 1MAFL 2AH1D 3SJLC 2AGLD 2H47B 4L3HC 2OK6D 2OIZD 2H3XB 3L4MC 2J55L 4FA5C 2IUQD 2I0TD 2AH0D 2AGZD 2AGXD 2OK4D 3RN1C 2HJ4D 3SVWC 2HXCD 2MTAL 4K3IC 4FANC 2J56L 2HJBD 2IUPD 4FB1C 2BBKL 3SXTC 1MG2B 1MDAL 3SLEC 2HKRD 1MG3B 2GC4B 4O1QC 4FA1C 2IUVD 3RMZC 4L1QC 1MAEL 2IURD 3L4OC 2J57K 3PXSC 3RN0C 3PXTC 4FA9C 4Y5RC 3SWSC 4L3GC 2IAAB 2I0SD 2OJYD 4FAVC 2AGYD 3C75L 2HKMD 2MADL 2GC7B 3ORVC 2AGWD 3RLMC 2Q7QD 4FA4C 2I0RD
chains in the Genus database with same CATH superfamily
3PXWC 1MAFL 2AH1D 3SJLC 2AGLD 2H47B 4L3HC 2OK6D 2OIZD 2H3XB 3L4MC 2J55L 4FA5C 2IUQD 2I0TD 2AH0D 2AGZD 2AGXD 2OK4D 3RN1C 2HJ4D 3SVWC 2HXCD 2MTAL 4K3IC 4FANC 2J56L 2HJBD 2IUPD 4FB1C 2BBKL 3SXTC 1MG2B 1MDAL 3SLEC 2HKRD 1MG3B 2GC4B 4O1QC 4FA1C 2IUVD 3RMZC 4L1QC 1MAEL 2IURD 3L4OC 2J57K 3PXSC 3RN0C 3PXTC 4FA9C 4Y5RC 3SWSC 4L3GC 2IAAB 2I0SD 2OJYD 4FAVC 2AGYD 3C75L 2HKMD 2MADL 2GC7B 3ORVC 2AGWD 3RLMC 2Q7QD 4FA4C 2I0RD
chains in the Genus database with same CATH topology
3PXWC 1MAFL 2AH1D 3SJLC 2AGLD 2H47B 4L3HC 2OK6D 2OIZD 2H3XB 3L4MC 2J55L 4FA5C 2IUQD 2I0TD 2AH0D 2AGZD 2AGXD 2OK4D 3RN1C 2HJ4D 3SVWC 2HXCD 2MTAL 4K3IC 4FANC 2J56L 2HJBD 2IUPD 4FB1C 2BBKL 3SXTC 1MG2B 1MDAL 3SLEC 2HKRD 1MG3B 2GC4B 4O1QC 4FA1C 2IUVD 3RMZC 4L1QC 1MAEL 2IURD 3L4OC 2J57K 3PXSC 3RN0C 3PXTC 4FA9C 4Y5RC 3SWSC 4L3GC 2IAAB 2I0SD 2OJYD 4FAVC 2AGYD 3C75L 2HKMD 2MADL 2GC7B 3ORVC 2AGWD 3RLMC 2Q7QD 4FA4C 2I0RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW C;  1MAF L;  2AH1 D;  3SJL C;  2AGL D;  2H47 B;  4L3H C;  2OK6 D;  2OIZ D;  2H3X B;  3L4M C;  2J55 L;  4FA5 C;  2IUQ D;  2I0T D;  2AH0 D;  2AGZ D;  2AGX D;  2OK4 D;  3RN1 C;  2HJ4 D;  3SVW C;  2HXC D;  2MTA L;  4K3I C;  4FAN C;  2J56 L;  2HJB D;  2IUP D;  4FB1 C;  2BBK L;  3SXT C;  1MG2 B;  1MDA L;  3SLE C;  2HKR D;  1MG3 B;  2GC4 B;  4O1Q C;  4FA1 C;  2IUV D;  3RMZ C;  4L1Q C;  1MAE L;  2IUR D;  3L4O C;  2J57 K;  3PXS C;  3RN0 C;  3PXT C;  4FA9 C;  4Y5R C;  3SWS C;  4L3G C;  2IAA B;  2I0S D;  2OJY D;  4FAV C;  2AGY D;  3C75 L;  2HKM D;  2MAD L;  2GC7 B;  3ORV C;  2AGW D;  3RLM C;  2Q7Q D;  4FA4 C;  2I0R D; 
#chains in the Genus database with same CATH topology
 3PXW C;  1MAF L;  2AH1 D;  3SJL C;  2AGL D;  2H47 B;  4L3H C;  2OK6 D;  2OIZ D;  2H3X B;  3L4M C;  2J55 L;  4FA5 C;  2IUQ D;  2I0T D;  2AH0 D;  2AGZ D;  2AGX D;  2OK4 D;  3RN1 C;  2HJ4 D;  3SVW C;  2HXC D;  2MTA L;  4K3I C;  4FAN C;  2J56 L;  2HJB D;  2IUP D;  4FB1 C;  2BBK L;  3SXT C;  1MG2 B;  1MDA L;  3SLE C;  2HKR D;  1MG3 B;  2GC4 B;  4O1Q C;  4FA1 C;  2IUV D;  3RMZ C;  4L1Q C;  1MAE L;  2IUR D;  3L4O C;  2J57 K;  3PXS C;  3RN0 C;  3PXT C;  4FA9 C;  4Y5R C;  3SWS C;  4L3G C;  2IAA B;  2I0S D;  2OJY D;  4FAV C;  2AGY D;  3C75 L;  2HKM D;  2MAD L;  2GC7 B;  3ORV C;  2AGW D;  3RLM C;  2Q7Q D;  4FA4 C;  2I0R D; 
#chains in the Genus database with same CATH homology
 3PXW C;  1MAF L;  2AH1 D;  3SJL C;  2AGL D;  2H47 B;  4L3H C;  2OK6 D;  2OIZ D;  2H3X B;  3L4M C;  2J55 L;  4FA5 C;  2IUQ D;  2I0T D;  2AH0 D;  2AGZ D;  2AGX D;  2OK4 D;  3RN1 C;  2HJ4 D;  3SVW C;  2HXC D;  2MTA L;  4K3I C;  4FAN C;  2J56 L;  2HJB D;  2IUP D;  4FB1 C;  2BBK L;  3SXT C;  1MG2 B;  1MDA L;  3SLE C;  2HKR D;  1MG3 B;  2GC4 B;  4O1Q C;  4FA1 C;  2IUV D;  3RMZ C;  4L1Q C;  1MAE L;  2IUR D;  3L4O C;  2J57 K;  3PXS C;  3RN0 C;  3PXT C;  4FA9 C;  4Y5R C;  3SWS C;  4L3G C;  2IAA B;  2I0S D;  2OJY D;  4FAV C;  2AGY D;  3C75 L;  2HKM D;  2MAD L;  2GC7 B;  3ORV C;  2AGW D;  3RLM C;  2Q7Q D;  4FA4 C;  2I0R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...