2IUVD

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
molecule tags Oxidoreductase
total genus 29
structure length 108
sequence length 109
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iuvD00
2IAAB 2AH1D 2OK6D 4L3GC 4Y5RC 2AGLD 3RN1C 2IURD 3L4MC 3RLMC 2GC7B 2HJ4D 3SWSC 4FB1C 3L4OC 3PXSC 2GC4B 1MG3B 2IUPD 2I0TD 2OIZD 2J56L 4FA5C 3PXTC 3PXWC 4FAVC 1MG2B 2BBKL 3ORVC 2HKRD 2AGXD 2AGWD 1MDAL 1MAFL 2IUVD 4FA9C 2IUQD 3RMZC 2J57K 2MTAL 2I0RD 4L1QC 2OK4D 2AH0D 2AGYD 2AGZD 2Q7QD 4L3HC 3SXTC 2HKMD 2J55L 2OJYD 3SLEC 2I0SD 2MADL 1MAEL 4K3IC 2HXCD 3SVWC 2H3XB 4FA4C 4O1QC 3RN0C 4FA1C 2HJBD 3C75L 4FANC 2H47B 3SJLC
chains in the Genus database with same CATH superfamily
2IAAB 2AH1D 2OK6D 4L3GC 4Y5RC 2AGLD 3RN1C 2IURD 3L4MC 3RLMC 2GC7B 2HJ4D 3SWSC 4FB1C 3L4OC 3PXSC 2GC4B 1MG3B 2IUPD 2I0TD 2OIZD 2J56L 4FA5C 3PXTC 3PXWC 4FAVC 1MG2B 2BBKL 3ORVC 2HKRD 2AGXD 2AGWD 1MDAL 1MAFL 2IUVD 4FA9C 2IUQD 3RMZC 2J57K 2MTAL 2I0RD 4L1QC 2OK4D 2AH0D 2AGYD 2AGZD 2Q7QD 4L3HC 3SXTC 2HKMD 2J55L 2OJYD 3SLEC 2I0SD 2MADL 1MAEL 4K3IC 2HXCD 3SVWC 2H3XB 4FA4C 4O1QC 3RN0C 4FA1C 2HJBD 3C75L 4FANC 2H47B 3SJLC
chains in the Genus database with same CATH topology
2IAAB 2AH1D 2OK6D 4L3GC 4Y5RC 2AGLD 3RN1C 2IURD 3L4MC 3RLMC 2GC7B 2HJ4D 3SWSC 4FB1C 3L4OC 3PXSC 2GC4B 1MG3B 2IUPD 2I0TD 2OIZD 2J56L 4FA5C 3PXTC 3PXWC 4FAVC 1MG2B 2BBKL 3ORVC 2HKRD 2AGXD 2AGWD 1MDAL 1MAFL 2IUVD 4FA9C 2IUQD 3RMZC 2J57K 2MTAL 2I0RD 4L1QC 2OK4D 2AH0D 2AGYD 2AGZD 2Q7QD 4L3HC 3SXTC 2HKMD 2J55L 2OJYD 3SLEC 2I0SD 2MADL 1MAEL 4K3IC 2HXCD 3SVWC 2H3XB 4FA4C 4O1QC 3RN0C 4FA1C 2HJBD 3C75L 4FANC 2H47B 3SJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA B;  2AH1 D;  2OK6 D;  4L3G C;  4Y5R C;  2AGL D;  3RN1 C;  2IUR D;  3L4M C;  3RLM C;  2GC7 B;  2HJ4 D;  3SWS C;  4FB1 C;  3L4O C;  3PXS C;  2GC4 B;  1MG3 B;  2IUP D;  2I0T D;  2OIZ D;  2J56 L;  4FA5 C;  3PXT C;  3PXW C;  4FAV C;  1MG2 B;  2BBK L;  3ORV C;  2HKR D;  2AGX D;  2AGW D;  1MDA L;  1MAF L;  2IUV D;  4FA9 C;  2IUQ D;  3RMZ C;  2J57 K;  2MTA L;  2I0R D;  4L1Q C;  2OK4 D;  2AH0 D;  2AGY D;  2AGZ D;  2Q7Q D;  4L3H C;  3SXT C;  2HKM D;  2J55 L;  2OJY D;  3SLE C;  2I0S D;  2MAD L;  1MAE L;  4K3I C;  2HXC D;  3SVW C;  2H3X B;  4FA4 C;  4O1Q C;  3RN0 C;  4FA1 C;  2HJB D;  3C75 L;  4FAN C;  2H47 B;  3SJL C; 
#chains in the Genus database with same CATH topology
 2IAA B;  2AH1 D;  2OK6 D;  4L3G C;  4Y5R C;  2AGL D;  3RN1 C;  2IUR D;  3L4M C;  3RLM C;  2GC7 B;  2HJ4 D;  3SWS C;  4FB1 C;  3L4O C;  3PXS C;  2GC4 B;  1MG3 B;  2IUP D;  2I0T D;  2OIZ D;  2J56 L;  4FA5 C;  3PXT C;  3PXW C;  4FAV C;  1MG2 B;  2BBK L;  3ORV C;  2HKR D;  2AGX D;  2AGW D;  1MDA L;  1MAF L;  2IUV D;  4FA9 C;  2IUQ D;  3RMZ C;  2J57 K;  2MTA L;  2I0R D;  4L1Q C;  2OK4 D;  2AH0 D;  2AGY D;  2AGZ D;  2Q7Q D;  4L3H C;  3SXT C;  2HKM D;  2J55 L;  2OJY D;  3SLE C;  2I0S D;  2MAD L;  1MAE L;  4K3I C;  2HXC D;  3SVW C;  2H3X B;  4FA4 C;  4O1Q C;  3RN0 C;  4FA1 C;  2HJB D;  3C75 L;  4FAN C;  2H47 B;  3SJL C; 
#chains in the Genus database with same CATH homology
 2IAA B;  2AH1 D;  2OK6 D;  4L3G C;  4Y5R C;  2AGL D;  3RN1 C;  2IUR D;  3L4M C;  3RLM C;  2GC7 B;  2HJ4 D;  3SWS C;  4FB1 C;  3L4O C;  3PXS C;  2GC4 B;  1MG3 B;  2IUP D;  2I0T D;  2OIZ D;  2J56 L;  4FA5 C;  3PXT C;  3PXW C;  4FAV C;  1MG2 B;  2BBK L;  3ORV C;  2HKR D;  2AGX D;  2AGW D;  1MDA L;  1MAF L;  2IUV D;  4FA9 C;  2IUQ D;  3RMZ C;  2J57 K;  2MTA L;  2I0R D;  4L1Q C;  2OK4 D;  2AH0 D;  2AGY D;  2AGZ D;  2Q7Q D;  4L3H C;  3SXT C;  2HKM D;  2J55 L;  2OJY D;  3SLE C;  2I0S D;  2MAD L;  1MAE L;  4K3I C;  2HXC D;  3SVW C;  2H3X B;  4FA4 C;  4O1Q C;  3RN0 C;  4FA1 C;  2HJB D;  3C75 L;  4FAN C;  2H47 B;  3SJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...