4FA9C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 30 days
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa9C00
3SWSC 2J56L 4FANC 3RN0C 2Q7QD 2H47B 3SVWC 4L3HC 3PXSC 3RMZC 2OIZD 3PXTC 2AH0D 3L4OC 4Y5RC 2AH1D 2AGZD 2I0RD 2IURD 2IAAB 2IUQD 2IUPD 2IUVD 4L3GC 3RLMC 3SXTC 3SLEC 4FA1C 1MDAL 2HJBD 2I0TD 2AGXD 4K3IC 4O1QC 3RN1C 4FA9C 2GC7B 3ORVC 1MAFL 2MADL 2HKRD 2OK4D 3L4MC 4FB1C 2OJYD 2HXCD 3SJLC 2HJ4D 2AGWD 2I0SD 2AGYD 2J55L 2J57K 2OK6D 3PXWC 4FA4C 1MG2B 4L1QC 3C75L 2H3XB 4FA5C 2MTAL 4FAVC 1MG3B 2BBKL 2GC4B 2HKMD 1MAEL 2AGLD
chains in the Genus database with same CATH superfamily
3SWSC 2J56L 4FANC 3RN0C 2Q7QD 2H47B 3SVWC 4L3HC 3PXSC 3RMZC 2OIZD 3PXTC 2AH0D 3L4OC 4Y5RC 2AH1D 2AGZD 2I0RD 2IURD 2IAAB 2IUQD 2IUPD 2IUVD 4L3GC 3RLMC 3SXTC 3SLEC 4FA1C 1MDAL 2HJBD 2I0TD 2AGXD 4K3IC 4O1QC 3RN1C 4FA9C 2GC7B 3ORVC 1MAFL 2MADL 2HKRD 2OK4D 3L4MC 4FB1C 2OJYD 2HXCD 3SJLC 2HJ4D 2AGWD 2I0SD 2AGYD 2J55L 2J57K 2OK6D 3PXWC 4FA4C 1MG2B 4L1QC 3C75L 2H3XB 4FA5C 2MTAL 4FAVC 1MG3B 2BBKL 2GC4B 2HKMD 1MAEL 2AGLD
chains in the Genus database with same CATH topology
3SWSC 2J56L 4FANC 3RN0C 2Q7QD 2H47B 3SVWC 4L3HC 3PXSC 3RMZC 2OIZD 3PXTC 2AH0D 3L4OC 4Y5RC 2AH1D 2AGZD 2I0RD 2IURD 2IAAB 2IUQD 2IUPD 2IUVD 4L3GC 3RLMC 3SXTC 3SLEC 4FA1C 1MDAL 2HJBD 2I0TD 2AGXD 4K3IC 4O1QC 3RN1C 4FA9C 2GC7B 3ORVC 1MAFL 2MADL 2HKRD 2OK4D 3L4MC 4FB1C 2OJYD 2HXCD 3SJLC 2HJ4D 2AGWD 2I0SD 2AGYD 2J55L 2J57K 2OK6D 3PXWC 4FA4C 1MG2B 4L1QC 3C75L 2H3XB 4FA5C 2MTAL 4FAVC 1MG3B 2BBKL 2GC4B 2HKMD 1MAEL 2AGLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS C;  2J56 L;  4FAN C;  3RN0 C;  2Q7Q D;  2H47 B;  3SVW C;  4L3H C;  3PXS C;  3RMZ C;  2OIZ D;  3PXT C;  2AH0 D;  3L4O C;  4Y5R C;  2AH1 D;  2AGZ D;  2I0R D;  2IUR D;  2IAA B;  2IUQ D;  2IUP D;  2IUV D;  4L3G C;  3RLM C;  3SXT C;  3SLE C;  4FA1 C;  1MDA L;  2HJB D;  2I0T D;  2AGX D;  4K3I C;  4O1Q C;  3RN1 C;  4FA9 C;  2GC7 B;  3ORV C;  1MAF L;  2MAD L;  2HKR D;  2OK4 D;  3L4M C;  4FB1 C;  2OJY D;  2HXC D;  3SJL C;  2HJ4 D;  2AGW D;  2I0S D;  2AGY D;  2J55 L;  2J57 K;  2OK6 D;  3PXW C;  4FA4 C;  1MG2 B;  4L1Q C;  3C75 L;  2H3X B;  4FA5 C;  2MTA L;  4FAV C;  1MG3 B;  2BBK L;  2GC4 B;  2HKM D;  1MAE L;  2AGL D; 
#chains in the Genus database with same CATH topology
 3SWS C;  2J56 L;  4FAN C;  3RN0 C;  2Q7Q D;  2H47 B;  3SVW C;  4L3H C;  3PXS C;  3RMZ C;  2OIZ D;  3PXT C;  2AH0 D;  3L4O C;  4Y5R C;  2AH1 D;  2AGZ D;  2I0R D;  2IUR D;  2IAA B;  2IUQ D;  2IUP D;  2IUV D;  4L3G C;  3RLM C;  3SXT C;  3SLE C;  4FA1 C;  1MDA L;  2HJB D;  2I0T D;  2AGX D;  4K3I C;  4O1Q C;  3RN1 C;  4FA9 C;  2GC7 B;  3ORV C;  1MAF L;  2MAD L;  2HKR D;  2OK4 D;  3L4M C;  4FB1 C;  2OJY D;  2HXC D;  3SJL C;  2HJ4 D;  2AGW D;  2I0S D;  2AGY D;  2J55 L;  2J57 K;  2OK6 D;  3PXW C;  4FA4 C;  1MG2 B;  4L1Q C;  3C75 L;  2H3X B;  4FA5 C;  2MTA L;  4FAV C;  1MG3 B;  2BBK L;  2GC4 B;  2HKM D;  1MAE L;  2AGL D; 
#chains in the Genus database with same CATH homology
 3SWS C;  2J56 L;  4FAN C;  3RN0 C;  2Q7Q D;  2H47 B;  3SVW C;  4L3H C;  3PXS C;  3RMZ C;  2OIZ D;  3PXT C;  2AH0 D;  3L4O C;  4Y5R C;  2AH1 D;  2AGZ D;  2I0R D;  2IUR D;  2IAA B;  2IUQ D;  2IUP D;  2IUV D;  4L3G C;  3RLM C;  3SXT C;  3SLE C;  4FA1 C;  1MDA L;  2HJB D;  2I0T D;  2AGX D;  4K3I C;  4O1Q C;  3RN1 C;  4FA9 C;  2GC7 B;  3ORV C;  1MAF L;  2MAD L;  2HKR D;  2OK4 D;  3L4M C;  4FB1 C;  2OJY D;  2HXC D;  3SJL C;  2HJ4 D;  2AGW D;  2I0S D;  2AGY D;  2J55 L;  2J57 K;  2OK6 D;  3PXW C;  4FA4 C;  1MG2 B;  4L1Q C;  3C75 L;  2H3X B;  4FA5 C;  2MTA L;  4FAV C;  1MG3 B;  2BBK L;  2GC4 B;  2HKM D;  1MAE L;  2AGL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...