3ORVC

Crystal structure of the y294h-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
123
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title Functional Importance of Tyrosine 294 and the Catalytic Selectivity for the Bis-Fe(IV) State of MauG Revealed by Replacement of This Axial Heme Ligand with Histidine .
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 123
sequence length 124
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3orvC00
2AH1D 2I0SD 1MAEL 2IURD 3SXTC 3SLEC 2OK6D 3SJLC 3SVWC 2I0RD 4FA5C 3SWSC 3ORVC 4FB1C 2MTAL 2IUPD 1MAFL 2I0TD 3RLMC 2H3XB 2AGZD 2OJYD 4FANC 3RN0C 1MG3B 4FA4C 3PXSC 2IUQD 2MADL 4L3HC 2GC4B 2J55L 4FA1C 2OK4D 3C75L 2AH0D 2HKRD 4FAVC 1MDAL 4FA9C 2OIZD 3PXTC 2AGLD 4L3GC 4O1QC 3RN1C 2HJBD 2J56L 1MG2B 3PXWC 2HXCD 2HJ4D 2IAAB 2AGYD 4Y5RC 2AGXD 3L4MC 3L4OC 2J57K 4K3IC 2Q7QD 2IUVD 2HKMD 3RMZC 4L1QC 2BBKL 2H47B 2GC7B 2AGWD
chains in the Genus database with same CATH superfamily
2AH1D 2I0SD 1MAEL 2IURD 3SXTC 3SLEC 2OK6D 3SJLC 3SVWC 2I0RD 4FA5C 3SWSC 3ORVC 4FB1C 2MTAL 2IUPD 1MAFL 2I0TD 3RLMC 2H3XB 2AGZD 2OJYD 4FANC 3RN0C 1MG3B 4FA4C 3PXSC 2IUQD 2MADL 4L3HC 2GC4B 2J55L 4FA1C 2OK4D 3C75L 2AH0D 2HKRD 4FAVC 1MDAL 4FA9C 2OIZD 3PXTC 2AGLD 4L3GC 4O1QC 3RN1C 2HJBD 2J56L 1MG2B 3PXWC 2HXCD 2HJ4D 2IAAB 2AGYD 4Y5RC 2AGXD 3L4MC 3L4OC 2J57K 4K3IC 2Q7QD 2IUVD 2HKMD 3RMZC 4L1QC 2BBKL 2H47B 2GC7B 2AGWD
chains in the Genus database with same CATH topology
2AH1D 2I0SD 1MAEL 2IURD 3SXTC 3SLEC 2OK6D 3SJLC 3SVWC 2I0RD 4FA5C 3SWSC 3ORVC 4FB1C 2MTAL 2IUPD 1MAFL 2I0TD 3RLMC 2H3XB 2AGZD 2OJYD 4FANC 3RN0C 1MG3B 4FA4C 3PXSC 2IUQD 2MADL 4L3HC 2GC4B 2J55L 4FA1C 2OK4D 3C75L 2AH0D 2HKRD 4FAVC 1MDAL 4FA9C 2OIZD 3PXTC 2AGLD 4L3GC 4O1QC 3RN1C 2HJBD 2J56L 1MG2B 3PXWC 2HXCD 2HJ4D 2IAAB 2AGYD 4Y5RC 2AGXD 3L4MC 3L4OC 2J57K 4K3IC 2Q7QD 2IUVD 2HKMD 3RMZC 4L1QC 2BBKL 2H47B 2GC7B 2AGWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH1 D;  2I0S D;  1MAE L;  2IUR D;  3SXT C;  3SLE C;  2OK6 D;  3SJL C;  3SVW C;  2I0R D;  4FA5 C;  3SWS C;  3ORV C;  4FB1 C;  2MTA L;  2IUP D;  1MAF L;  2I0T D;  3RLM C;  2H3X B;  2AGZ D;  2OJY D;  4FAN C;  3RN0 C;  1MG3 B;  4FA4 C;  3PXS C;  2IUQ D;  2MAD L;  4L3H C;  2GC4 B;  2J55 L;  4FA1 C;  2OK4 D;  3C75 L;  2AH0 D;  2HKR D;  4FAV C;  1MDA L;  4FA9 C;  2OIZ D;  3PXT C;  2AGL D;  4L3G C;  4O1Q C;  3RN1 C;  2HJB D;  2J56 L;  1MG2 B;  3PXW C;  2HXC D;  2HJ4 D;  2IAA B;  2AGY D;  4Y5R C;  2AGX D;  3L4M C;  3L4O C;  2J57 K;  4K3I C;  2Q7Q D;  2IUV D;  2HKM D;  3RMZ C;  4L1Q C;  2BBK L;  2H47 B;  2GC7 B;  2AGW D; 
#chains in the Genus database with same CATH topology
 2AH1 D;  2I0S D;  1MAE L;  2IUR D;  3SXT C;  3SLE C;  2OK6 D;  3SJL C;  3SVW C;  2I0R D;  4FA5 C;  3SWS C;  3ORV C;  4FB1 C;  2MTA L;  2IUP D;  1MAF L;  2I0T D;  3RLM C;  2H3X B;  2AGZ D;  2OJY D;  4FAN C;  3RN0 C;  1MG3 B;  4FA4 C;  3PXS C;  2IUQ D;  2MAD L;  4L3H C;  2GC4 B;  2J55 L;  4FA1 C;  2OK4 D;  3C75 L;  2AH0 D;  2HKR D;  4FAV C;  1MDA L;  4FA9 C;  2OIZ D;  3PXT C;  2AGL D;  4L3G C;  4O1Q C;  3RN1 C;  2HJB D;  2J56 L;  1MG2 B;  3PXW C;  2HXC D;  2HJ4 D;  2IAA B;  2AGY D;  4Y5R C;  2AGX D;  3L4M C;  3L4O C;  2J57 K;  4K3I C;  2Q7Q D;  2IUV D;  2HKM D;  3RMZ C;  4L1Q C;  2BBK L;  2H47 B;  2GC7 B;  2AGW D; 
#chains in the Genus database with same CATH homology
 2AH1 D;  2I0S D;  1MAE L;  2IUR D;  3SXT C;  3SLE C;  2OK6 D;  3SJL C;  3SVW C;  2I0R D;  4FA5 C;  3SWS C;  3ORV C;  4FB1 C;  2MTA L;  2IUP D;  1MAF L;  2I0T D;  3RLM C;  2H3X B;  2AGZ D;  2OJY D;  4FAN C;  3RN0 C;  1MG3 B;  4FA4 C;  3PXS C;  2IUQ D;  2MAD L;  4L3H C;  2GC4 B;  2J55 L;  4FA1 C;  2OK4 D;  3C75 L;  2AH0 D;  2HKR D;  4FAV C;  1MDA L;  4FA9 C;  2OIZ D;  3PXT C;  2AGL D;  4L3G C;  4O1Q C;  3RN1 C;  2HJB D;  2J56 L;  1MG2 B;  3PXW C;  2HXC D;  2HJ4 D;  2IAA B;  2AGY D;  4Y5R C;  2AGX D;  3L4M C;  3L4O C;  2J57 K;  4K3I C;  2Q7Q D;  2IUV D;  2HKM D;  3RMZ C;  4L1Q C;  2BBK L;  2H47 B;  2GC7 B;  2AGW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...