3ORVC

Crystal structure of the y294h-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
123
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Functional Importance of Tyrosine 294 and the Catalytic Selectivity for the Bis-Fe(IV) State of MauG Revealed by Replacement of This Axial Heme Ligand with Histidine .
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 123
sequence length 124
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3orvC00
4FB1C 2AGZD 2HXCD 2H3XB 1MAFL 2I0TD 3SJLC 3RN1C 2J56L 2HKRD 3L4MC 3SWSC 2GC4B 4Y5RC 3PXWC 4K3IC 2I0SD 2HJBD 2IAAB 2AH1D 3SXTC 3SLEC 3RLMC 2AH0D 4FA1C 2MTAL 2BBKL 2Q7QD 4L3GC 1MDAL 3PXTC 4FA5C 2MADL 3RN0C 2OK6D 2AGLD 2I0RD 2OK4D 2OJYD 3PXSC 2AGWD 2H47B 2OIZD 3ORVC 2IUPD 1MAEL 2GC7B 4O1QC 4L1QC 4FAVC 3SVWC 2HJ4D 4FANC 2HKMD 3L4OC 1MG3B 2IUVD 2AGYD 2J55L 2AGXD 1MG2B 2J57K 3C75L 4FA9C 4L3HC 3RMZC 2IURD 4FA4C 2IUQD
chains in the Genus database with same CATH superfamily
4FB1C 2AGZD 2HXCD 2H3XB 1MAFL 2I0TD 3SJLC 3RN1C 2J56L 2HKRD 3L4MC 3SWSC 2GC4B 4Y5RC 3PXWC 4K3IC 2I0SD 2HJBD 2IAAB 2AH1D 3SXTC 3SLEC 3RLMC 2AH0D 4FA1C 2MTAL 2BBKL 2Q7QD 4L3GC 1MDAL 3PXTC 4FA5C 2MADL 3RN0C 2OK6D 2AGLD 2I0RD 2OK4D 2OJYD 3PXSC 2AGWD 2H47B 2OIZD 3ORVC 2IUPD 1MAEL 2GC7B 4O1QC 4L1QC 4FAVC 3SVWC 2HJ4D 4FANC 2HKMD 3L4OC 1MG3B 2IUVD 2AGYD 2J55L 2AGXD 1MG2B 2J57K 3C75L 4FA9C 4L3HC 3RMZC 2IURD 4FA4C 2IUQD
chains in the Genus database with same CATH topology
4FB1C 2AGZD 2HXCD 2H3XB 1MAFL 2I0TD 3SJLC 3RN1C 2J56L 2HKRD 3L4MC 3SWSC 2GC4B 4Y5RC 3PXWC 4K3IC 2I0SD 2HJBD 2IAAB 2AH1D 3SXTC 3SLEC 3RLMC 2AH0D 4FA1C 2MTAL 2BBKL 2Q7QD 4L3GC 1MDAL 3PXTC 4FA5C 2MADL 3RN0C 2OK6D 2AGLD 2I0RD 2OK4D 2OJYD 3PXSC 2AGWD 2H47B 2OIZD 3ORVC 2IUPD 1MAEL 2GC7B 4O1QC 4L1QC 4FAVC 3SVWC 2HJ4D 4FANC 2HKMD 3L4OC 1MG3B 2IUVD 2AGYD 2J55L 2AGXD 1MG2B 2J57K 3C75L 4FA9C 4L3HC 3RMZC 2IURD 4FA4C 2IUQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FB1 C;  2AGZ D;  2HXC D;  2H3X B;  1MAF L;  2I0T D;  3SJL C;  3RN1 C;  2J56 L;  2HKR D;  3L4M C;  3SWS C;  2GC4 B;  4Y5R C;  3PXW C;  4K3I C;  2I0S D;  2HJB D;  2IAA B;  2AH1 D;  3SXT C;  3SLE C;  3RLM C;  2AH0 D;  4FA1 C;  2MTA L;  2BBK L;  2Q7Q D;  4L3G C;  1MDA L;  3PXT C;  4FA5 C;  2MAD L;  3RN0 C;  2OK6 D;  2AGL D;  2I0R D;  2OK4 D;  2OJY D;  3PXS C;  2AGW D;  2H47 B;  2OIZ D;  3ORV C;  2IUP D;  1MAE L;  2GC7 B;  4O1Q C;  4L1Q C;  4FAV C;  3SVW C;  2HJ4 D;  4FAN C;  2HKM D;  3L4O C;  1MG3 B;  2IUV D;  2AGY D;  2J55 L;  2AGX D;  1MG2 B;  2J57 K;  3C75 L;  4FA9 C;  4L3H C;  3RMZ C;  2IUR D;  4FA4 C;  2IUQ D; 
#chains in the Genus database with same CATH topology
 4FB1 C;  2AGZ D;  2HXC D;  2H3X B;  1MAF L;  2I0T D;  3SJL C;  3RN1 C;  2J56 L;  2HKR D;  3L4M C;  3SWS C;  2GC4 B;  4Y5R C;  3PXW C;  4K3I C;  2I0S D;  2HJB D;  2IAA B;  2AH1 D;  3SXT C;  3SLE C;  3RLM C;  2AH0 D;  4FA1 C;  2MTA L;  2BBK L;  2Q7Q D;  4L3G C;  1MDA L;  3PXT C;  4FA5 C;  2MAD L;  3RN0 C;  2OK6 D;  2AGL D;  2I0R D;  2OK4 D;  2OJY D;  3PXS C;  2AGW D;  2H47 B;  2OIZ D;  3ORV C;  2IUP D;  1MAE L;  2GC7 B;  4O1Q C;  4L1Q C;  4FAV C;  3SVW C;  2HJ4 D;  4FAN C;  2HKM D;  3L4O C;  1MG3 B;  2IUV D;  2AGY D;  2J55 L;  2AGX D;  1MG2 B;  2J57 K;  3C75 L;  4FA9 C;  4L3H C;  3RMZ C;  2IUR D;  4FA4 C;  2IUQ D; 
#chains in the Genus database with same CATH homology
 4FB1 C;  2AGZ D;  2HXC D;  2H3X B;  1MAF L;  2I0T D;  3SJL C;  3RN1 C;  2J56 L;  2HKR D;  3L4M C;  3SWS C;  2GC4 B;  4Y5R C;  3PXW C;  4K3I C;  2I0S D;  2HJB D;  2IAA B;  2AH1 D;  3SXT C;  3SLE C;  3RLM C;  2AH0 D;  4FA1 C;  2MTA L;  2BBK L;  2Q7Q D;  4L3G C;  1MDA L;  3PXT C;  4FA5 C;  2MAD L;  3RN0 C;  2OK6 D;  2AGL D;  2I0R D;  2OK4 D;  2OJY D;  3PXS C;  2AGW D;  2H47 B;  2OIZ D;  3ORV C;  2IUP D;  1MAE L;  2GC7 B;  4O1Q C;  4L1Q C;  4FAV C;  3SVW C;  2HJ4 D;  4FAN C;  2HKM D;  3L4O C;  1MG3 B;  2IUV D;  2AGY D;  2J55 L;  2AGX D;  1MG2 B;  2J57 K;  3C75 L;  4FA9 C;  4L3H C;  3RMZ C;  2IUR D;  4FA4 C;  2IUQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...